F453511

General Info

Members Datasets Scaffolds Average Seq Length
487 172 487 67

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_230856_c1|nmdc:mga0rr50_230856_c1_18_266
Length 82
Sequence VSGGGAWQRRRGDPEVITWRDYEDIAIALNEGHPDLDPLTVRFTDLHRWVIELPGFTDDPKGSNEKILEAIQMAWLDEYRNR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
133 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.62
Rhizosphere 99.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10110266 3300003203 Unclassified 815
2 Ga0065704_10802958 3300005289 Unclassified 524
3 Ga0065707_10015215 3300005295 Bacteria 1877
4 Ga0065707_10026108 3300005295 Bacteria 2143
5 Ga0065707_10691444 3300005295 Bacteria 644
6 Ga0070690_100680690 3300005330 Bacteria 788
7 Ga0070670_100712689 3300005331 Bacteria 903
8 Ga0068869_100115343 3300005334 Bacteria 2048
9 Ga0070680_100040075 3300005336 Bacteria 3791
10 Ga0070680_102010015 3300005336 Bacteria 501
11 Ga0070660_101510358 3300005339 Unclassified 571
12 Ga0070689_100498114 3300005340 Bacteria 1043
13 Ga0070689_100918749 3300005340 Bacteria 775
14 Ga0070668_100347576 3300005347 Bacteria 1254
15 Ga0070669_100603581 3300005353 Bacteria 920
16 Ga0070669_100604215 3300005353 Unclassified 919
17 Ga0070675_102022965 3300005354 Bacteria 531
18 Ga0070673_101986400 3300005364 Bacteria 552
19 Ga0070667_102285606 3300005367 Bacteria 509
20 Ga0070703_10386231 3300005406 Bacteria 606
21 Ga0070705_100003128 3300005440 Bacteria 8135
22 Ga0070700_101522763 3300005441 Bacteria 569
23 Ga0070694_100113944 3300005444 Bacteria 1930
24 Ga0070708_100002329 3300005445 Bacteria 14699
25 Ga0070708_100017838 3300005445 Bacteria 5931
26 Ga0070708_100093316 3300005445 Bacteria 2744
27 Ga0070708_100279725 3300005445 Bacteria 1570
28 Ga0070662_100504090 3300005457 Unclassified 1010
29 Ga0070681_10245487 3300005458 Bacteria 1703
30 Ga0070681_10748304 3300005458 Unclassified 894
31 Ga0068867_100633936 3300005459 Unclassified 936
32 Ga0070706_100009014 3300005467 Bacteria 9288
33 Ga0070706_100141066 3300005467 Bacteria 2250
34 Ga0070706_100170999 3300005467 Bacteria 2029
35 Ga0070706_100531079 3300005467 Bacteria 1094
36 Ga0070706_100915020 3300005467 Unclassified 810
37 Ga0070707_100000579 3300005468 Bacteria 36811
38 Ga0070707_100012309 3300005468 Bacteria 7987
39 Ga0070707_100265628 3300005468 Bacteria 1669
40 Ga0070707_100294675 3300005468 Bacteria 1576
41 Ga0070698_100011482 3300005471 Bacteria 9401
42 Ga0070699_100000936 3300005518 Bacteria 27208
43 Ga0070699_100467866 3300005518 Bacteria 1143
44 Ga0070699_100560392 3300005518 Bacteria 1040
45 Ga0070699_100819026 3300005518 Bacteria 852
46 Ga0070699_100910305 3300005518 Bacteria 806
47 Ga0070699_101213273 3300005518 Bacteria 692
48 Ga0070699_101441627 3300005518 Bacteria 631
49 Ga0070697_100044912 3300005536 Bacteria 3579
50 Ga0070697_100059129 3300005536 Bacteria 3120
51 Ga0070697_100106514 3300005536 Bacteria 2332
52 Ga0070697_100554413 3300005536 Bacteria 1008
53 Ga0070697_100720128 3300005536 Bacteria 881
54 Ga0070697_100810742 3300005536 Bacteria 828
55 Ga0070672_100302379 3300005543 Unclassified 1356
56 Ga0070672_100599718 3300005543 Bacteria 959
57 Ga0070672_101705337 3300005543 Unclassified 566
58 Ga0070672_101739813 3300005543 Bacteria 560
59 Ga0070695_100064210 3300005545 Bacteria 2388
60 Ga0070695_100390812 3300005545 Bacteria 1052
61 Ga0070695_100838092 3300005545 Bacteria 739
62 Ga0070696_100009785 3300005546 Bacteria 6415
63 Ga0070696_100067021 3300005546 Bacteria 2519
64 Ga0070696_100532146 3300005546 Bacteria 939
65 Ga0070696_100557636 3300005546 Unclassified 919
66 Ga0070696_100560068 3300005546 Bacteria 917
67 Ga0070696_101027707 3300005546 Bacteria 690
68 Ga0070704_100038552 3300005549 Bacteria 3274
69 Ga0070704_100223925 3300005549 Bacteria 1531
70 Ga0070704_100467945 3300005549 Bacteria 1088
71 Ga0070704_101144577 3300005549 Bacteria 708
72 Ga0070704_102099674 3300005549 Bacteria 525
73 Ga0070702_101393467 3300005615 Bacteria 573
74 Ga0068859_101044168 3300005617 Unclassified 898
75 Ga0068859_101062987 3300005617 Unclassified 890
76 Ga0068859_101934781 3300005617 Bacteria 651
77 Ga0068866_10426238 3300005718 Bacteria 862
78 Ga0068866_10671591 3300005718 Bacteria 708
79 Ga0068863_101359016 3300005841 Bacteria 718
80 Ga0068858_100957803 3300005842 Bacteria 838
81 Ga0068860_101410794 3300005843 Bacteria 718
82 Ga0068862_100625520 3300005844 Unclassified 1036
83 Ga0068862_100714203 3300005844 Bacteria 972
84 Ga0081539_10000002 3300005985 Bacteria 601032
85 Ga0075432_10253474 3300006058 Bacteria 715
86 Ga0075432_10350797 3300006058 Unclassified 625
87 Ga0070716_101383195 3300006173 Bacteria 572
88 Ga0075428_100001207 3300006844 Bacteria 27623
89 Ga0075428_100003481 3300006844 Bacteria 17227
90 Ga0075428_100032199 3300006844 Bacteria 5791
91 Ga0075428_100049588 3300006844 Bacteria 4606
92 Ga0075428_100084930 3300006844 Bacteria 3453
93 Ga0075428_100318646 3300006844 Archaea 1671
94 Ga0075428_101881317 3300006844 Bacteria 622
95 Ga0075428_102130534 3300006844 Bacteria 579
96 Ga0075428_102637950 3300006844 Bacteria 513
97 Ga0075430_100000097 3300006846 Bacteria 51729
98 Ga0075430_100003407 3300006846 Bacteria 13281
99 Ga0075430_100033122 3300006846 Bacteria 4386
100 Ga0075430_100184844 3300006846 Bacteria 1733
101 Ga0075430_100557715 3300006846 Bacteria 945
102 Ga0075430_100751122 3300006846 Bacteria 804
103 Ga0075431_100000049 3300006847 Bacteria 63960
104 Ga0075431_100000199 3300006847 Bacteria 44112
105 Ga0075431_100004054 3300006847 Bacteria 14277
106 Ga0075431_100043133 3300006847 Bacteria 4655
107 Ga0075431_100063350 3300006847 Bacteria 3815
108 Ga0075431_100088257 3300006847 Bacteria 3200
109 Ga0075431_100112266 3300006847 Bacteria 2813
110 Ga0075431_100287089 3300006847 Bacteria 1665
111 Ga0075431_100287317 3300006847 Bacteria 1664
112 Ga0075431_100314244 3300006847 Bacteria 1581
113 Ga0075431_100413305 3300006847 Bacteria 1349
114 Ga0075431_100983657 3300006847 Bacteria 811
115 Ga0075431_101544567 3300006847 Bacteria 622
116 Ga0075433_10000995 3300006852 Bacteria 20128
117 Ga0075433_10008986 3300006852 Bacteria 7980
118 Ga0075433_10011320 3300006852 Bacteria 7180
119 Ga0075433_10035944 3300006852 Bacteria 4264
120 Ga0075433_10044878 3300006852 Bacteria 3841
121 Ga0075433_10101488 3300006852 Bacteria 2548
122 Ga0075433_10173728 3300006852 Bacteria 1917
123 Ga0075433_10290529 3300006852 Bacteria 1448
124 Ga0075433_10370357 3300006852 Bacteria 1265
125 Ga0075433_10869399 3300006852 Bacteria 787
126 Ga0075433_11452298 3300006852 Bacteria 593
127 Ga0075434_100002030 3300006871 Bacteria 17571
128 Ga0075434_100006385 3300006871 Bacteria 10806
129 Ga0075434_100022423 3300006871 Bacteria 6150
130 Ga0075434_100032218 3300006871 Bacteria 5167
131 Ga0075434_100122180 3300006871 Bacteria 2620
132 Ga0075434_100154124 3300006871 Bacteria 2318
133 Ga0075434_100211205 3300006871 Bacteria 1961
134 Ga0075434_100432986 3300006871 Bacteria 1336
135 Ga0075434_100480371 3300006871 Bacteria 1264
136 Ga0075434_100618511 3300006871 Bacteria 1102
137 Ga0075429_100003383 3300006880 Bacteria 13598
138 Ga0075429_100007768 3300006880 Bacteria 9313
139 Ga0075429_100017245 3300006880 Bacteria 6246
140 Ga0075429_100017803 3300006880 Bacteria 6145
141 Ga0075429_100024639 3300006880 Bacteria 5222
142 Ga0075429_100082940 3300006880 Bacteria 2795
143 Ga0075429_100251670 3300006880 Bacteria 1547
144 Ga0075429_100290686 3300006880 Bacteria 1431
145 Ga0075429_100783922 3300006880 Unclassified 835
146 Ga0075429_100785308 3300006880 Bacteria 834
147 Ga0075429_100840244 3300006880 Bacteria 804
148 Ga0075429_100864678 3300006880 Bacteria 791
149 Ga0068865_100874794 3300006881 Unclassified 780
150 Ga0075436_100013559 3300006914 Bacteria 5582
151 Ga0075436_100024487 3300006914 Bacteria 4149
152 Ga0075436_100243452 3300006914 Bacteria 1279
153 Ga0075436_100475778 3300006914 Bacteria 912
154 Ga0075436_101127591 3300006914 Bacteria 591
155 Ga0097620_101044512 3300006931 Unclassified 898
156 Ga0097620_101063035 3300006931 Unclassified 890
157 Ga0097620_101934814 3300006931 Bacteria 651
158 Ga0075435_100013384 3300007076 Bacteria 6100
159 Ga0075435_100098971 3300007076 Bacteria 2414
160 Ga0075435_100101652 3300007076 Bacteria 2382
161 Ga0075435_100101673 3300007076 Bacteria 2382
162 Ga0075435_100114184 3300007076 Bacteria 2248
163 Ga0075435_100178381 3300007076 Bacteria 1795
164 Ga0075435_100195029 3300007076 Bacteria 1715
165 Ga0075435_100572852 3300007076 Bacteria 978
166 Ga0075435_101140063 3300007076 Bacteria 682
167 Ga0099794_10004439 3300007265 Bacteria 5516
168 Ga0099794_10141320 3300007265 Unclassified 1219
169 Ga0099794_10336567 3300007265 Bacteria 784
170 Ga0099794_10737577 3300007265 Bacteria 526
171 Ga0111539_10004676 3300009094 Bacteria 17886
172 Ga0111539_10005166 3300009094 Bacteria 16919
173 Ga0111539_10847667 3300009094 Unclassified 1063
174 Ga0111539_11944191 3300009094 Bacteria 682
175 Ga0114129_10000037 3300009147 Bacteria 108744
176 Ga0114129_10000462 3300009147 Bacteria 48711
177 Ga0114129_10000721 3300009147 Bacteria 41915
178 Ga0114129_10003163 3300009147 Bacteria 23097
179 Ga0114129_10003609 3300009147 Bacteria 21765
180 Ga0114129_10018018 3300009147 Bacteria 10058
181 Ga0114129_10031014 3300009147 Bacteria 7561
182 Ga0114129_10073142 3300009147 Bacteria 4776
183 Ga0114129_10098332 3300009147 Bacteria 4051
184 Ga0114129_10129440 3300009147 Bacteria 3469
185 Ga0114129_10150998 3300009147 Archaea 3179
186 Ga0114129_10160695 3300009147 Bacteria 3069
187 Ga0114129_10304364 3300009147 Bacteria 2123
188 Ga0114129_10393415 3300009147 Bacteria 1828
189 Ga0114129_10501914 3300009147 Bacteria 1584
190 Ga0114129_10675050 3300009147 Bacteria 1331
191 Ga0114129_10769413 3300009147 Bacteria 1231
192 Ga0114129_10923680 3300009147 Bacteria 1104
193 Ga0114129_12260996 3300009147 Bacteria 653
194 Ga0114129_12617208 3300009147 Bacteria 602
195 Ga0105242_11967106 3300009176 Bacteria 626
196 Ga0105249_10490956 3300009553 Bacteria 1272
197 Ga0105249_11505451 3300009553 Bacteria 745
198 Ga0157371_11534146 3300013102 Bacteria 520
199 Ga0157374_10710922 3300013296 Bacteria 1018
200 Ga0157378_10177851 3300013297 Bacteria 2000
201 Ga0157378_10922129 3300013297 Bacteria 905
202 Ga0163162_10506100 3300013306 Unclassified 1338
203 Ga0163162_12333013 3300013306 Bacteria 615
204 Ga0163163_11797784 3300014325 Bacteria 673
205 Ga0157380_10796947 3300014326 Bacteria 961
206 Ga0157380_12809008 3300014326 Bacteria 553
207 Ga0163161_11772100 3300017792 Bacteria 548
208 Ga0207642_10874357 3300025899 Bacteria 575
209 Ga0207684_10000105 3300025910 Bacteria 160905
210 Ga0207684_10029967 3300025910 Bacteria 4632
211 Ga0207684_10089306 3300025910 Bacteria 2626
212 Ga0207684_10730061 3300025910 Bacteria 840
213 Ga0207684_11645615 3300025910 Bacteria 519
214 Ga0207660_10013639 3300025917 Bacteria 5328
215 Ga0207660_10804111 3300025917 Bacteria 767
216 Ga0207652_10412275 3300025921 Bacteria 1219
217 Ga0207646_10000893 3300025922 Bacteria 38454
218 Ga0207646_10012761 3300025922 Bacteria 8059
219 Ga0207646_10031099 3300025922 Bacteria 4834
220 Ga0207646_10504268 3300025922 Bacteria 1090
221 Ga0207681_10285187 3300025923 Bacteria 1302
222 Ga0207681_10528210 3300025923 Bacteria 969
223 Ga0207681_11556231 3300025923 Bacteria 554
224 Ga0207686_10857292 3300025934 Bacteria 731
225 Ga0207670_10396139 3300025936 Bacteria 1103
226 Ga0207704_11297275 3300025938 Unclassified 622
227 Ga0207665_10459802 3300025939 Bacteria 978
228 Ga0207691_10583141 3300025940 Unclassified 947
229 Ga0207691_10743910 3300025940 Bacteria 826
230 Ga0207689_10187884 3300025942 Bacteria 1704
231 Ga0207689_10378164 3300025942 Bacteria 1179
232 Ga0207651_10289685 3300025960 Bacteria 1357
233 Ga0207668_10311678 3300025972 Bacteria 1303
234 Ga0207658_11600081 3300025986 Bacteria 596
235 Ga0207703_11005629 3300026035 Bacteria 800
236 Ga0207708_10535077 3300026075 Bacteria 986
237 Ga0207641_10365248 3300026088 Bacteria 1379
238 Ga0209588_1007150 3300027671 Bacteria 3272
239 Ga0209588_1009054 3300027671 Bacteria 2965
240 Ga0209971_1031698 3300027682 Archaea 1268
241 Ga0209966_1024078 3300027695 Unclassified 1200
242 Ga0209966_1135115 3300027695 Bacteria 570
243 Ga0209974_10269548 3300027876 Unclassified 645
244 Ga0207428_10000049 3300027907 Bacteria 179267
245 Ga0207428_10020524 3300027907 Bacteria 5611
246 Ga0207428_10476572 3300027907 Bacteria 908
247 Ga0207428_10816142 3300027907 Unclassified 662
248 Ga0268266_10604732 3300028379 Bacteria 1053
249 Ga0268265_11812136 3300028380 Bacteria 617
250 Ga0268264_10727674 3300028381 Bacteria 987
251 Ga0268264_11459694 3300028381 Unclassified 695
252 Ga0265770_1122828 3300030878 Unclassified 548
253 Ga0307408_100047382 3300031548 Bacteria 3078
254 Ga0307408_100169269 3300031548 Bacteria 1743
255 Ga0307408_100438604 3300031548 Bacteria 1130
256 Ga0307405_11966746 3300031731 Unclassified 523
257 Ga0307410_10779210 3300031852 Unclassified 812
258 Ga0307407_11444769 3300031903 Unclassified 543
259 Ga0307412_11151662 3300031911 Unclassified 692
260 Ga0307416_101445815 3300032002 Unclassified 793
261 Ga0307416_103775279 3300032002 Unclassified 507
262 Ga0307411_11130277 3300032005 Unclassified 707
263 Ga0307411_11185036 3300032005 Bacteria 692
264 Ga0373930_0128651 3300034816 Bacteria 622
265 Ga0373948_0005412 3300034817 Bacteria 2070
266 Ga0373948_0190076 3300034817 Bacteria 531
267 Ga0373950_0049078 3300034818 Bacteria 826
268 Ga0373958_0174733 3300034819 Bacteria 550
269 Ga0373928_0120759 3300035084 Bacteria 702
270 Ga0373940_0008284 3300035088 Bacteria 2379
271 Ga0373940_0033834 3300035088 Bacteria 1376
272 Ga0373940_0160287 3300035088 Bacteria 722
273 Ga0373949_0009489 3300035090 Bacteria 2132
274 Ga0373949_0025729 3300035090 Bacteria 1375
275 Ga0373932_0198161 3300035112 Bacteria 712
276 Ga0373932_0417171 3300035112 Bacteria 522
277 Ga0373939_0162413 3300035114 Bacteria 821
278 Ga0373941_0013329 3300035115 Bacteria 2171
279 Ga0373941_0148656 3300035115 Bacteria 858
280 Ga0373941_0451427 3300035115 Bacteria 540
281 Ga0373960_0039494 3300035121 Bacteria 1358
282 Ga0373960_0192850 3300035121 Bacteria 717
283 Ga0373942_0087333 3300035207 Bacteria 935
284 Ga0373942_0250789 3300035207 Bacteria 602
285 Ga0373962_0007886 3300035242 Bacteria 2613
286 Ga0373931_0001089 3300035691 Bacteria 11514
287 Ga0373931_0683564 3300035691 Bacteria 677
288 Ga0395900_0008541 3300037418 Bacteria 10528
289 Ga0395900_0117457 3300037418 Bacteria 2729
290 Ga0395900_0524275 3300037418 Bacteria 1132
291 Ga0395898_0019612 3300037466 Bacteria 6880
292 Ga0395905_0025786 3300037471 Bacteria 5542
293 Ga0395901_0688356 3300038443 Bacteria 1021
294 Ga0395901_1177619 3300038443 Bacteria 733
295 Ga0242420_037897 3300038996 Bacteria 914
296 Ga0242420_065884 3300038996 Bacteria 729
297 Ga0439439_0178234 3300041406 Bacteria 611
298 Ga0439446_0211034 3300042156 Bacteria 658
299 Ga0439435_0295808 3300042436 Bacteria 554
300 Ga0451577_0027189 3300042876 Bacteria 5178
301 Ga0451577_0047771 3300042876 Bacteria 3826
302 Ga0453683_0014159 3300044673 Bacteria 5184
303 Ga0453683_0110988 3300044673 Bacteria 1724
304 Ga0453683_0125685 3300044673 Bacteria 1615
305 Ga0453683_0170085 3300044673 Bacteria 1380
306 Ga0453683_0296561 3300044673 Bacteria 1034
307 Ga0453683_0298323 3300044673 Bacteria 1031
308 Ga0453683_1234888 3300044673 Bacteria 501
309 Ga0453684_0162077 3300044712 Bacteria 2644
310 Ga0451576_0151899 3300045051 Bacteria 2415
311 Ga0451576_0501236 3300045051 Bacteria 1275
312 Ga0451576_0977173 3300045051 Bacteria 887
313 Ga0451576_1170844 3300045051 Bacteria 803
314 Ga0495580_0002331 3300046472 Bacteria 16573
315 Ga0495642_0077397 3300046528 Bacteria 1397
316 Ga0495659_0186809 3300046664 Bacteria 846
317 Ga0495669_0149870 3300046684 Bacteria 1104
318 Ga0495670_0454343 3300046691 Bacteria 694
319 Ga0496102_0684866 3300048905 Bacteria 948
320 Ga0496103_0043481 3300048906 Bacteria 2766
321 Ga0496115_1213246 3300048918 Bacteria 566
322 Ga0501292_026974 3300049515 Unclassified 951
323 Ga0501299_051333 3300049522 Unclassified 853
324 Ga0501031_1084610 3300049568 Bacteria 511
325 Ga0501036_0197016 3300049572 Bacteria 1694
326 Ga0501036_1034331 3300049572 Bacteria 672
327 Ga0501038_0249654 3300049574 Bacteria 1406
328 Ga0501039_0195497 3300049575 Bacteria 1590
329 Ga0501040_0011893 3300049576 Bacteria 5694
330 Ga0501040_0886846 3300049576 Bacteria 646
331 Ga0501042_0095528 3300049578 Bacteria 2135
332 Ga0501042_0432847 3300049578 Unclassified 954
333 Ga0501042_0546663 3300049578 Bacteria 842
334 Ga0501042_1014923 3300049578 Bacteria 605
335 Ga0501043_0348875 3300049579 Unclassified 1125
336 Ga0501046_0560876 3300049580 Bacteria 813
337 Ga0501048_0030366 3300049582 Bacteria 3910
338 Ga0501048_0196295 3300049582 Bacteria 1431
339 Ga0501067_0021287 3300049583 Bacteria 3588
340 Ga0501068_0117865 3300049584 Unclassified 1654
341 Ga0501069_0259072 3300049585 Bacteria 1015
342 Ga0501069_1016863 3300049585 Bacteria 506
343 Ga0501070_0525604 3300049586 Bacteria 949
344 Ga0501071_0023135 3300049587 Bacteria 4338
345 Ga0501071_0389570 3300049587 Unclassified 1063
346 Ga0501071_1360526 3300049587 Bacteria 548
347 Ga0501072_0016727 3300049588 Bacteria 5635
348 Ga0501072_0188986 3300049588 Bacteria 1643
349 Ga0501072_0272863 3300049588 Bacteria 1345
350 Ga0501072_0619601 3300049588 Bacteria 853
351 Ga0501072_0670961 3300049588 Bacteria 815
352 Ga0501075_0033504 3300049591 Bacteria 3822
353 Ga0501075_0100208 3300049591 Bacteria 2200
354 Ga0501075_0148505 3300049591 Bacteria 1787
355 Ga0501075_0912893 3300049591 Bacteria 668
356 Ga0501075_1179155 3300049591 Bacteria 581
357 Ga0501076_0003954 3300049592 Bacteria 10462
358 Ga0501076_0201575 3300049592 Bacteria 1625
359 Ga0501076_1271396 3300049592 Bacteria 605
360 Ga0501077_0058715 3300049593 Bacteria 2442
361 Ga0501077_0197658 3300049593 Bacteria 1277
362 Ga0501077_0207893 3300049593 Bacteria 1244
363 Ga0501077_0463497 3300049593 Bacteria 811
364 Ga0501079_0014479 3300049741 Bacteria 6014
365 Ga0501079_0431380 3300049741 Bacteria 1035
366 Ga0501079_0856565 3300049741 Bacteria 716
367 Ga0501079_1546784 3300049741 Bacteria 522
368 Ga0501080_0541638 3300049742 Unclassified 1037
369 Ga0501080_0557443 3300049742 Bacteria 1020
370 Ga0501080_1693207 3300049742 Bacteria 534
371 Ga0501081_0016853 3300049743 Bacteria 4829
372 Ga0501081_0044069 3300049743 Bacteria 3062
373 Ga0501081_0196431 3300049743 Bacteria 1462
374 Ga0501083_0093136 3300049744 Bacteria 1989
375 Ga0501083_0665694 3300049744 Bacteria 677
376 Ga0501035_0709494 3300049822 Bacteria 811
377 Ga0501035_0740325 3300049822 Bacteria 790
378 Ga0501035_0849480 3300049822 Bacteria 726
379 Ga0501045_0027035 3300049824 Bacteria 4131
380 Ga0501045_0206262 3300049824 Bacteria 1464
381 nmdc:mga05p37_113447_c1 3300050507 Bacteria 3332
382 nmdc:mga05p37_1172777_c1 3300050507 Bacteria 797
383 nmdc:mga05p37_117942_c1 3300050507 Bacteria 3261
384 nmdc:mga05p37_1222_c1 3300050507 Bacteria 29364
385 nmdc:mga05p37_129322_c1 3300050507 Bacteria 3099
386 nmdc:mga05p37_13279_c1 3300050507 Bacteria 9862
387 nmdc:mga05p37_1445378_c1 3300050507 Bacteria 689
388 nmdc:mga05p37_1606057_c1 3300050507 Bacteria 640
389 nmdc:mga05p37_23764_c1 3300050507 Bacteria 7443
390 nmdc:mga05p37_309364_c1 3300050507 Bacteria 1873
391 nmdc:mga05p37_323_c1 3300050507 Bacteria 50943
392 nmdc:mga05p37_35190_c1 3300050507 Bacteria 6140
393 nmdc:mga05p37_43830_c1 3300050507 Bacteria 5505
394 nmdc:mga05p37_485885_c1 3300050507 Bacteria 1421
395 nmdc:mga05p37_521791_c1 3300050507 Bacteria 1359
396 nmdc:mga05p37_66520_c1 3300050507 Bacteria 4433
397 nmdc:mga05p37_6_c1 3300050507 Bacteria 155503
398 nmdc:mga05p37_739039_c1 3300050507 Bacteria 1087
399 nmdc:mga05p37_84_c1 3300050507 Bacteria 83805
400 nmdc:mga09592_1052076_c1 3300050508 Bacteria 678
401 nmdc:mga09592_118163_c1 3300050508 Bacteria 2276
402 nmdc:mga09592_1307603_c1 3300050508 Bacteria 596
403 nmdc:mga09592_1536_c1 3300050508 Bacteria 18593
404 nmdc:mga09592_1649886_c1 3300050508 Bacteria 518
405 nmdc:mga09592_1719522_c1 3300050508 Bacteria 505
406 nmdc:mga09592_190810_c1 3300050508 Bacteria 1774
407 nmdc:mga09592_20401_c1 3300050508 Bacteria 5448
408 nmdc:mga09592_289932_c1 3300050508 Bacteria 1419
409 nmdc:mga09592_3621_c1 3300050508 Bacteria 12465
410 nmdc:mga09592_80268_c1 3300050508 Bacteria 2778
411 nmdc:mga09592_83776_c1 3300050508 Bacteria 2718
412 nmdc:mga09592_9634_c1 3300050508 Bacteria 7849
413 nmdc:mga0qj67_1099_c1 3300050509 Bacteria 18741
414 nmdc:mga0qj67_1545366_c1 3300050509 Bacteria 510
415 nmdc:mga0qj67_258978_c1 3300050509 Bacteria 1411
416 nmdc:mga0qj67_35096_c1 3300050509 Bacteria 3920
417 nmdc:mga0qj67_38789_c1 3300050509 Bacteria 3738
418 nmdc:mga0qj67_451476_c1 3300050509 Bacteria 1035
419 nmdc:mga0qj67_517683_c1 3300050509 Bacteria 958
420 nmdc:mga0qj67_57878_c1 3300050509 Bacteria 3073
421 nmdc:mga06r32_108639_c1 3300050510 Bacteria 2727
422 nmdc:mga06r32_1774962_c1 3300050510 Bacteria 553
423 nmdc:mga06r32_23569_c1 3300050510 Bacteria 5698
424 nmdc:mga06r32_268980_c1 3300050510 Bacteria 1692
425 nmdc:mga06r32_277835_c1 3300050510 Bacteria 1662
426 nmdc:mga06r32_2918_c1 3300050510 Bacteria 15336
427 nmdc:mga06r32_460336_c1 3300050510 Bacteria 1251
428 nmdc:mga06r32_479_c1 3300050510 Bacteria 34392
429 nmdc:mga06r32_551399_c1 3300050510 Archaea 1127
430 nmdc:mga06r32_78250_c1 3300050510 Bacteria 3214
431 nmdc:mga06r32_79678_c1 3300050510 Bacteria 3186
432 nmdc:mga06r32_801669_c1 3300050510 Bacteria 902
433 nmdc:mga06r32_937839_c1 3300050510 Bacteria 821
434 nmdc:mga06r32_981460_c1 3300050510 Bacteria 798
435 nmdc:mga08y16_155212_c1 3300050511 Bacteria 2379
436 nmdc:mga08y16_190_c1 3300050511 Bacteria 55016
437 nmdc:mga0n895_100_c1 3300050512 Bacteria 50742
438 nmdc:mga0n895_15575_c1 3300050512 Bacteria 6940
439 nmdc:mga0n895_272475_c1 3300050512 Unclassified 1717
440 nmdc:mga0n895_28975_c1 3300050512 Bacteria 5275
441 nmdc:mga0n895_309317_c1 3300050512 Bacteria 1602
442 nmdc:mga0n895_324038_c1 3300050512 Bacteria 1561
443 nmdc:mga0n895_356377_c1 3300050512 Bacteria 1482
444 nmdc:mga0n895_373602_c1 3300050512 Bacteria 1443
445 nmdc:mga0n895_657075_c1 3300050512 Bacteria 1047
446 nmdc:mga0n895_723795_c1 3300050512 Unclassified 990
447 nmdc:mga0rr50_1178901_c1 3300050513 Bacteria 651
448 nmdc:mga0rr50_127767_c1 3300050513 Bacteria 2031
449 nmdc:mga0rr50_139894_c1 3300050513 Bacteria 1946
450 nmdc:mga0rr50_1492448_c1 3300050513 Bacteria 571
451 nmdc:mga0rr50_1713323_c1 3300050513 Bacteria 530
452 nmdc:mga0rr50_227226_c1 3300050513 Bacteria 1543
453 nmdc:mga0rr50_230856_c1 3300050513 Bacteria 1531
454 nmdc:mga0rr50_2838_c1 3300050513 Bacteria 9854
455 nmdc:mga0rr50_422956_c1 3300050513 Bacteria 1127
456 nmdc:mga0rr50_534708_c1 3300050513 Bacteria 998
457 nmdc:mga0rr50_91000_c1 3300050513 Bacteria 2375
458 nmdc:mga08x19_1035145_c1 3300050514 Bacteria 583
459 nmdc:mga08x19_1185_c1 3300050514 Bacteria 16338
460 nmdc:mga08x19_14665_c1 3300050514 Bacteria 2510
461 nmdc:mga08x19_176070_c1 3300050514 Bacteria 1459
462 nmdc:mga08x19_454921_c1 3300050514 Bacteria 901
463 nmdc:mga08x19_595476_c1 3300050514 Bacteria 783
464 nmdc:mga08x19_934521_c1 3300050514 Bacteria 616
465 nmdc:mga0a205_101538_c1 3300050515 Bacteria 2775
466 nmdc:mga0a205_177370_c1 3300050515 Bacteria 2026
467 nmdc:mga0a205_19701_c1 3300050515 Bacteria 6365
468 nmdc:mga0a205_6433_c1 3300050515 Bacteria 10620
469 nmdc:mga0a205_691786_c1 3300050515 Bacteria 870
470 nmdc:mga0a205_8521_c1 3300050515 Bacteria 9324
471 nmdc:mga0a205_9259_c1 3300050515 Bacteria 8995
472 nmdc:mga0a205_95103_c1 3300050515 Bacteria 2878
473 Ga0501084_0147660 3300054114 Bacteria 1981
474 Ga0501084_0150910 3300054114 Bacteria 1959
475 Ga0501084_0540947 3300054114 Bacteria 984
476 Ga0501084_0625302 3300054114 Bacteria 909
477 Ga0501084_1695756 3300054114 Bacteria 528
478 Ga0590071_018947 3300059421 Bacteria 1620
479 Ga0590074_025359 3300059423 Bacteria 1033
480 Ga0590075_075577 3300059424 Bacteria 871
481 Ga0501082_0055193 3300060353 Bacteria 3423
482 Ga0501082_0194874 3300060353 Bacteria 1762
483 Ga0501082_1518198 3300060353 Bacteria 585
484 Ga0530510_0161027 3300061734 Bacteria 1660
485 Ga0530510_0298601 3300061734 Bacteria 1205
486 Ga0530510_1090132 3300061734 Bacteria 612
487 Ga0530510_1389055 3300061734 Bacteria 539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10802958 Ga0065704_108029582 66
2 3300005295 Ga0065707_10026108 Ga0065707_100261082 66
3 3300005295 Ga0065707_10691444 Ga0065707_106914442 66
4 3300005330 Ga0070690_100680690 Ga0070690_1006806902 66
5 3300005334 Ga0068869_100115343 Ga0068869_1001153433 66
6 3300005339 Ga0070660_101510358 Ga0070660_1015103582 66
7 3300005347 Ga0070668_100347576 Ga0070668_1003475763 66
8 3300005353 Ga0070669_100603581 Ga0070669_1006035812 66
9 3300005353 Ga0070669_100604215 Ga0070669_1006042153 66
10 3300005354 Ga0070675_102022965 Ga0070675_1020229652 66
11 3300005440 Ga0070705_100003128 Ga0070705_10000312811 66
12 3300005445 Ga0070708_100002329 Ga0070708_10000232915 66
13 3300005445 Ga0070708_100093316 Ga0070708_1000933163 66
14 3300005467 Ga0070706_100009014 Ga0070706_10000901411 66
15 3300005467 Ga0070706_100915020 Ga0070706_1009150203 66
16 3300005468 Ga0070707_100000579 Ga0070707_10000057918 66
17 3300005468 Ga0070707_100265628 Ga0070707_1002656282 66
18 3300005471 Ga0070698_100011482 Ga0070698_10001148211 66
19 3300005518 Ga0070699_100000936 Ga0070699_10000093622 66
20 3300005518 Ga0070699_100910305 Ga0070699_1009103051 66
21 3300005536 Ga0070697_100044912 Ga0070697_1000449128 66
22 3300005536 Ga0070697_100059129 Ga0070697_1000591293 66
23 3300005536 Ga0070697_100720128 Ga0070697_1007201282 66
24 3300005543 Ga0070672_100599718 Ga0070672_1005997182 66
25 3300005543 Ga0070672_101705337 Ga0070672_1017053372 66
26 3300005545 Ga0070695_100390812 Ga0070695_1003908123 66
27 3300005546 Ga0070696_100532146 Ga0070696_1005321463 66
28 3300005546 Ga0070696_101027707 Ga0070696_1010277072 66
29 3300005549 Ga0070704_101144577 Ga0070704_1011445772 66
30 3300005841 Ga0068863_101359016 Ga0068863_1013590163 66
31 3300005843 Ga0068860_101410794 Ga0068860_1014107943 66
32 3300005844 Ga0068862_100625520 Ga0068862_1006255202 66
33 3300006058 Ga0075432_10253474 Ga0075432_102534743 66
34 3300006058 Ga0075432_10350797 Ga0075432_103507972 66
35 3300006844 Ga0075428_100001207 Ga0075428_10000120712 66
36 3300006844 Ga0075428_100003481 Ga0075428_10000348113 66
37 3300006844 Ga0075428_100032199 Ga0075428_10003219910 66
38 3300006844 Ga0075428_100318646 Ga0075428_1003186463 66
39 3300006844 Ga0075428_102130534 Ga0075428_1021305342 66
40 3300006844 Ga0075428_102637950 Ga0075428_1026379502 66
41 3300006846 Ga0075430_100003407 Ga0075430_1000034073 66
42 3300006846 Ga0075430_100033122 Ga0075430_1000331225 66
43 3300006846 Ga0075430_100557715 Ga0075430_1005577152 66
44 3300006847 Ga0075431_100000049 Ga0075431_10000004935 66
45 3300006847 Ga0075431_100004054 Ga0075431_10000405412 66
46 3300006847 Ga0075431_100043133 Ga0075431_1000431334 66
47 3300006847 Ga0075431_100063350 Ga0075431_1000633505 66
48 3300006847 Ga0075431_100088257 Ga0075431_1000882573 66
49 3300006847 Ga0075431_100287089 Ga0075431_1002870895 66
50 3300006852 Ga0075433_10000995 Ga0075433_1000099510 66
51 3300006852 Ga0075433_10008986 Ga0075433_100089867 66
52 3300006852 Ga0075433_10011320 Ga0075433_1001132011 66
53 3300006852 Ga0075433_10044878 Ga0075433_100448783 66
54 3300006852 Ga0075433_10869399 Ga0075433_108693993 66
55 3300006871 Ga0075434_100002030 Ga0075434_10000203013 66
56 3300006871 Ga0075434_100006385 Ga0075434_1000063851 66
57 3300006871 Ga0075434_100154124 Ga0075434_1001541245 66
58 3300006871 Ga0075434_100432986 Ga0075434_1004329864 66
59 3300006880 Ga0075429_100003383 Ga0075429_10000338312 66
60 3300006880 Ga0075429_100007768 Ga0075429_10000776812 66
61 3300006880 Ga0075429_100017245 Ga0075429_1000172457 66
62 3300006880 Ga0075429_100024639 Ga0075429_1000246399 66
63 3300006880 Ga0075429_100082940 Ga0075429_1000829403 66
64 3300006880 Ga0075429_100785308 Ga0075429_1007853083 66
65 3300006880 Ga0075429_100864678 Ga0075429_1008646782 66
66 3300006914 Ga0075436_100013559 Ga0075436_1000135597 66
67 3300006914 Ga0075436_100024487 Ga0075436_1000244873 66
68 3300006914 Ga0075436_100243452 Ga0075436_1002434522 66
69 3300007076 Ga0075435_100013384 Ga0075435_1000133848 66
70 3300007076 Ga0075435_100101652 Ga0075435_1001016523 66
71 3300007076 Ga0075435_100114184 Ga0075435_1001141843 66
72 3300007076 Ga0075435_100572852 Ga0075435_1005728522 66
73 3300007076 Ga0075435_101140063 Ga0075435_1011400631 66
74 3300007265 Ga0099794_10141320 Ga0099794_101413202 66
75 3300009094 Ga0111539_10004676 Ga0111539_1000467621 66
76 3300009094 Ga0111539_10005166 Ga0111539_1000516614 66
77 3300009147 Ga0114129_10000037 Ga0114129_10000037111 66
78 3300009147 Ga0114129_10000462 Ga0114129_1000046239 66
79 3300009147 Ga0114129_10000721 Ga0114129_1000072143 66
80 3300009147 Ga0114129_10003163 Ga0114129_1000316312 66
81 3300009147 Ga0114129_10003609 Ga0114129_1000360913 66
82 3300009147 Ga0114129_10031014 Ga0114129_100310143 66
83 3300009147 Ga0114129_10129440 Ga0114129_101294405 66
84 3300009147 Ga0114129_10304364 Ga0114129_103043644 66
85 3300009147 Ga0114129_10675050 Ga0114129_106750502 66
86 3300009147 Ga0114129_10769413 Ga0114129_107694132 66
87 3300009553 Ga0105249_11505451 Ga0105249_115054512 66
88 3300014326 Ga0157380_10796947 Ga0157380_107969473 66
89 3300025910 Ga0207684_10000105 Ga0207684_1000010589 66
90 3300025910 Ga0207684_11645615 Ga0207684_116456152 66
91 3300025917 Ga0207660_10804111 Ga0207660_108041113 66
92 3300025922 Ga0207646_10000893 Ga0207646_1000089327 66
93 3300025923 Ga0207681_10285187 Ga0207681_102851872 66
94 3300025923 Ga0207681_10528210 Ga0207681_105282102 66
95 3300025942 Ga0207689_10187884 Ga0207689_101878844 66
96 3300025972 Ga0207668_10311678 Ga0207668_103116783 66
97 3300026088 Ga0207641_10365248 Ga0207641_103652484 66
98 3300027671 Ga0209588_1007150 Ga0209588_10071503 66
99 3300027682 Ga0209971_1031698 Ga0209971_10316984 66
100 3300027695 Ga0209966_1024078 Ga0209966_10240782 66
101 3300027876 Ga0209974_10269548 Ga0209974_102695482 66
102 3300027907 Ga0207428_10000049 Ga0207428_1000004974 66
103 3300027907 Ga0207428_10020524 Ga0207428_100205248 66
104 3300027907 Ga0207428_10476572 Ga0207428_104765723 66
105 3300027907 Ga0207428_10816142 Ga0207428_108161422 66
106 3300028381 Ga0268264_10727674 Ga0268264_107276742 66
107 3300028381 Ga0268264_11459694 Ga0268264_114596942 66
108 3300031548 Ga0307408_100047382 Ga0307408_1000473825 66
109 3300031548 Ga0307408_100438604 Ga0307408_1004386043 66
110 3300031731 Ga0307405_11966746 Ga0307405_119667462 66
111 3300032005 Ga0307411_11185036 Ga0307411_111850363 66
112 3300034817 Ga0373948_0190076 Ga0373948_0190076_140_340 66
113 3300034818 Ga0373950_0049078 Ga0373950_0049078_606_806 66
114 3300034819 Ga0373958_0174733 Ga0373958_0174733_72_272 66
115 3300035084 Ga0373928_0120759 Ga0373928_0120759_420_620 66
116 3300035088 Ga0373940_0008284 Ga0373940_0008284_733_933 66
117 3300035088 Ga0373940_0033834 Ga0373940_0033834_35_235 66
118 3300035090 Ga0373949_0009489 Ga0373949_0009489_1733_1933 66
119 3300035090 Ga0373949_0025729 Ga0373949_0025729_295_495 66
120 3300035112 Ga0373932_0198161 Ga0373932_0198161_189_389 66
121 3300035114 Ga0373939_0162413 Ga0373939_0162413_267_467 66
122 3300035115 Ga0373941_0148656 Ga0373941_0148656_602_802 66
123 3300035115 Ga0373941_0451427 Ga0373941_0451427_72_272 66
124 3300035121 Ga0373960_0039494 Ga0373960_0039494_204_404 66
125 3300035207 Ga0373942_0087333 Ga0373942_0087333_448_648 66
126 3300035207 Ga0373942_0250789 Ga0373942_0250789_227_427 66
127 3300035242 Ga0373962_0007886 Ga0373962_0007886_1242_1442 66
128 3300035691 Ga0373931_0683564 Ga0373931_0683564_327_527 66
129 3300038996 Ga0242420_037897 Ga0242420_037897_139_339 66
130 3300042876 Ga0451577_0047771 Ga0451577_0047771_2429_2629 66
131 3300044673 Ga0453683_0296561 Ga0453683_0296561_173_373 66
132 3300045051 Ga0451576_0151899 Ga0451576_0151899_293_493 66
133 3300045051 Ga0451576_0501236 Ga0451576_0501236_52_252 66
134 3300045051 Ga0451576_0977173 Ga0451576_0977173_52_252 66
135 3300049515 Ga0501292_026974 Ga0501292_026974_285_485 66
136 3300049568 Ga0501031_1084610 Ga0501031_1084610_136_336 66
137 3300049572 Ga0501036_0197016 Ga0501036_0197016_1481_1681 66
138 3300049578 Ga0501042_0095528 Ga0501042_0095528_1901_2101 66
139 3300049578 Ga0501042_1014923 Ga0501042_1014923_49_249 66
140 3300049580 Ga0501046_0560876 Ga0501046_0560876_491_691 66
141 3300049582 Ga0501048_0030366 Ga0501048_0030366_2535_2735 66
142 3300049583 Ga0501067_0021287 Ga0501067_0021287_1219_1419 66
143 3300049584 Ga0501068_0117865 Ga0501068_0117865_358_558 66
144 3300049585 Ga0501069_0259072 Ga0501069_0259072_316_516 66
145 3300049585 Ga0501069_1016863 Ga0501069_1016863_179_379 66
146 3300049586 Ga0501070_0525604 Ga0501070_0525604_275_475 66
147 3300049587 Ga0501071_0023135 Ga0501071_0023135_549_749 66
148 3300049588 Ga0501072_0670961 Ga0501072_0670961_604_804 66
149 3300049592 Ga0501076_0003954 Ga0501076_0003954_3943_4143 66
150 3300049593 Ga0501077_0463497 Ga0501077_0463497_590_790 66
151 3300049741 Ga0501079_0014479 Ga0501079_0014479_2043_2243 66
152 3300049741 Ga0501079_0431380 Ga0501079_0431380_80_280 66
153 3300049742 Ga0501080_0541638 Ga0501080_0541638_10_210 66
154 3300049744 Ga0501083_0093136 Ga0501083_0093136_425_625 66
155 3300049824 Ga0501045_0027035 Ga0501045_0027035_1529_1729 66
156 3300050507 nmdc:mga05p37_1172777_c1 nmdc:mga05p37_1172777_c1_295_495 66
157 3300050507 nmdc:mga05p37_129322_c1 nmdc:mga05p37_129322_c1_2824_3024 66
158 3300050507 nmdc:mga05p37_23764_c1 nmdc:mga05p37_23764_c1_2866_3066 66
159 3300050507 nmdc:mga05p37_323_c1 nmdc:mga05p37_323_c1_30510_30710 66
160 3300050507 nmdc:mga05p37_43830_c1 nmdc:mga05p37_43830_c1_4322_4522 66
161 3300050507 nmdc:mga05p37_485885_c1 nmdc:mga05p37_485885_c1_131_331 66
162 3300050507 nmdc:mga05p37_6_c1 nmdc:mga05p37_6_c1_18121_18321 66
163 3300050507 nmdc:mga05p37_739039_c1 nmdc:mga05p37_739039_c1_19_219 66
164 3300050507 nmdc:mga05p37_84_c1 nmdc:mga05p37_84_c1_57357_57557 66
165 3300050508 nmdc:mga09592_118163_c1 nmdc:mga09592_118163_c1_1190_1390 66
166 3300050508 nmdc:mga09592_1536_c1 nmdc:mga09592_1536_c1_1650_1850 66
167 3300050508 nmdc:mga09592_1649886_c1 nmdc:mga09592_1649886_c1_97_297 66
168 3300050508 nmdc:mga09592_190810_c1 nmdc:mga09592_190810_c1_1272_1472 66
169 3300050508 nmdc:mga09592_20401_c1 nmdc:mga09592_20401_c1_3686_3886 66
170 3300050508 nmdc:mga09592_3621_c1 nmdc:mga09592_3621_c1_2327_2527 66
171 3300050508 nmdc:mga09592_83776_c1 nmdc:mga09592_83776_c1_420_620 66
172 3300050508 nmdc:mga09592_9634_c1 nmdc:mga09592_9634_c1_6867_7067 66
173 3300050509 nmdc:mga0qj67_35096_c1 nmdc:mga0qj67_35096_c1_2755_2955 66
174 3300050509 nmdc:mga0qj67_38789_c1 nmdc:mga0qj67_38789_c1_589_789 66
175 3300050509 nmdc:mga0qj67_517683_c1 nmdc:mga0qj67_517683_c1_464_664 66
176 3300050509 nmdc:mga0qj67_57878_c1 nmdc:mga0qj67_57878_c1_1449_1649 66
177 3300050510 nmdc:mga06r32_108639_c1 nmdc:mga06r32_108639_c1_932_1132 66
178 3300050510 nmdc:mga06r32_23569_c1 nmdc:mga06r32_23569_c1_5047_5247 66
179 3300050510 nmdc:mga06r32_479_c1 nmdc:mga06r32_479_c1_15997_16197 66
180 3300050510 nmdc:mga06r32_551399_c1 nmdc:mga06r32_551399_c1_647_847 66
181 3300050510 nmdc:mga06r32_79678_c1 nmdc:mga06r32_79678_c1_1700_1900 66
182 3300050510 nmdc:mga06r32_937839_c1 nmdc:mga06r32_937839_c1_17_217 66
183 3300050510 nmdc:mga06r32_981460_c1 nmdc:mga06r32_981460_c1_54_254 66
184 3300050511 nmdc:mga08y16_155212_c1 nmdc:mga08y16_155212_c1_255_455 66
185 3300050511 nmdc:mga08y16_190_c1 nmdc:mga08y16_190_c1_14830_15030 66
186 3300050512 nmdc:mga0n895_100_c1 nmdc:mga0n895_100_c1_18545_18745 66
187 3300050512 nmdc:mga0n895_15575_c1 nmdc:mga0n895_15575_c1_3784_3984 66
188 3300050512 nmdc:mga0n895_272475_c1 nmdc:mga0n895_272475_c1_329_529 66
189 3300050512 nmdc:mga0n895_309317_c1 nmdc:mga0n895_309317_c1_511_711 66
190 3300050512 nmdc:mga0n895_356377_c1 nmdc:mga0n895_356377_c1_577_777 66
191 3300050512 nmdc:mga0n895_373602_c1 nmdc:mga0n895_373602_c1_66_266 66
192 3300050513 nmdc:mga0rr50_1178901_c1 nmdc:mga0rr50_1178901_c1_44_244 66
193 3300050513 nmdc:mga0rr50_1713323_c1 nmdc:mga0rr50_1713323_c1_270_470 66
194 3300050513 nmdc:mga0rr50_227226_c1 nmdc:mga0rr50_227226_c1_454_654 66
195 3300050513 nmdc:mga0rr50_2838_c1 nmdc:mga0rr50_2838_c1_2894_3094 66
196 3300050513 nmdc:mga0rr50_534708_c1 nmdc:mga0rr50_534708_c1_469_669 66
197 3300050514 nmdc:mga08x19_1035145_c1 nmdc:mga08x19_1035145_c1_122_322 66
198 3300050514 nmdc:mga08x19_1185_c1 nmdc:mga08x19_1185_c1_14605_14805 66
199 3300050514 nmdc:mga08x19_14665_c1 nmdc:mga08x19_14665_c1_2288_2488 66
200 3300050514 nmdc:mga08x19_176070_c1 nmdc:mga08x19_176070_c1_105_305 66
201 3300050514 nmdc:mga08x19_934521_c1 nmdc:mga08x19_934521_c1_269_469 66
202 3300050515 nmdc:mga0a205_101538_c1 nmdc:mga0a205_101538_c1_70_270 66
203 3300050515 nmdc:mga0a205_19701_c1 nmdc:mga0a205_19701_c1_4020_4220 66
204 3300050515 nmdc:mga0a205_6433_c1 nmdc:mga0a205_6433_c1_2111_2311 66
205 3300050515 nmdc:mga0a205_9259_c1 nmdc:mga0a205_9259_c1_4884_5084 66
206 3300050515 nmdc:mga0a205_95103_c1 nmdc:mga0a205_95103_c1_1506_1706 66
207 3300059424 Ga0590075_075577 Ga0590075_075577_117_317 66
208 3300060353 Ga0501082_0194874 Ga0501082_0194874_1529_1729 66
209 3300061734 Ga0530510_0298601 Ga0530510_0298601_53_253 66
210 3300061734 Ga0530510_1090132 Ga0530510_1090132_334_534 66
211 3300003203 JGI25406J46586_10110266 JGI25406J46586_101102662 67
212 3300005295 Ga0065707_10015215 Ga0065707_100152153 67
213 3300005331 Ga0070670_100712689 Ga0070670_1007126893 67
214 3300005336 Ga0070680_100040075 Ga0070680_1000400755 67
215 3300005336 Ga0070680_102010015 Ga0070680_1020100151 67
216 3300005340 Ga0070689_100498114 Ga0070689_1004981142 67
217 3300005340 Ga0070689_100918749 Ga0070689_1009187493 67
218 3300005364 Ga0070673_101986400 Ga0070673_1019864002 67
219 3300005367 Ga0070667_102285606 Ga0070667_1022856061 67
220 3300005406 Ga0070703_10386231 Ga0070703_103862312 67
221 3300005441 Ga0070700_101522763 Ga0070700_1015227632 67
222 3300005444 Ga0070694_100113944 Ga0070694_1001139443 67
223 3300005445 Ga0070708_100017838 Ga0070708_1000178387 67
224 3300005445 Ga0070708_100279725 Ga0070708_1002797251 67
225 3300005457 Ga0070662_100504090 Ga0070662_1005040903 67
226 3300005458 Ga0070681_10245487 Ga0070681_102454875 67
227 3300005458 Ga0070681_10748304 Ga0070681_107483042 67
228 3300005459 Ga0068867_100633936 Ga0068867_1006339362 67
229 3300005467 Ga0070706_100141066 Ga0070706_1001410663 67
230 3300005467 Ga0070706_100170999 Ga0070706_1001709995 67
231 3300005467 Ga0070706_100531079 Ga0070706_1005310793 67
232 3300005468 Ga0070707_100012309 Ga0070707_10001230912 67
233 3300005468 Ga0070707_100294675 Ga0070707_1002946753 67
234 3300005518 Ga0070699_100467866 Ga0070699_1004678663 67
235 3300005518 Ga0070699_100560392 Ga0070699_1005603922 67
236 3300005518 Ga0070699_100819026 Ga0070699_1008190263 67
237 3300005518 Ga0070699_101213273 Ga0070699_1012132732 67
238 3300005518 Ga0070699_101441627 Ga0070699_1014416272 67
239 3300005536 Ga0070697_100106514 Ga0070697_1001065143 67
240 3300005536 Ga0070697_100554413 Ga0070697_1005544133 67
241 3300005536 Ga0070697_100810742 Ga0070697_1008107422 67
242 3300005543 Ga0070672_100302379 Ga0070672_1003023792 67
243 3300005543 Ga0070672_101739813 Ga0070672_1017398131 67
244 3300005545 Ga0070695_100064210 Ga0070695_1000642105 67
245 3300005545 Ga0070695_100838092 Ga0070695_1008380923 67
246 3300005546 Ga0070696_100009785 Ga0070696_1000097853 67
247 3300005546 Ga0070696_100067021 Ga0070696_1000670213 67
248 3300005546 Ga0070696_100557636 Ga0070696_1005576362 67
249 3300005546 Ga0070696_100560068 Ga0070696_1005600682 67
250 3300005549 Ga0070704_100038552 Ga0070704_1000385523 67
251 3300005549 Ga0070704_100223925 Ga0070704_1002239252 67
252 3300005549 Ga0070704_100467945 Ga0070704_1004679451 67
253 3300005549 Ga0070704_102099674 Ga0070704_1020996741 67
254 3300005615 Ga0070702_101393467 Ga0070702_1013934671 67
255 3300005617 Ga0068859_101044168 Ga0068859_1010441683 67
256 3300005617 Ga0068859_101062987 Ga0068859_1010629873 67
257 3300005617 Ga0068859_101934781 Ga0068859_1019347813 67
258 3300005718 Ga0068866_10426238 Ga0068866_104262382 67
259 3300005718 Ga0068866_10671591 Ga0068866_106715911 67
260 3300005842 Ga0068858_100957803 Ga0068858_1009578032 67
261 3300005844 Ga0068862_100714203 Ga0068862_1007142033 67
262 3300005985 Ga0081539_10000002 Ga0081539_10000002168 67
263 3300006173 Ga0070716_101383195 Ga0070716_1013831952 67
264 3300006844 Ga0075428_100049588 Ga0075428_1000495883 67
265 3300006844 Ga0075428_100084930 Ga0075428_1000849303 67
266 3300006844 Ga0075428_101881317 Ga0075428_1018813172 67
267 3300006846 Ga0075430_100000097 Ga0075430_10000009724 67
268 3300006846 Ga0075430_100184844 Ga0075430_1001848443 67
269 3300006846 Ga0075430_100751122 Ga0075430_1007511222 67
270 3300006847 Ga0075431_100000199 Ga0075431_10000019917 67
271 3300006847 Ga0075431_100112266 Ga0075431_1001122663 67
272 3300006847 Ga0075431_100287317 Ga0075431_1002873173 67
273 3300006847 Ga0075431_100314244 Ga0075431_1003142444 67
274 3300006847 Ga0075431_100413305 Ga0075431_1004133052 67
275 3300006847 Ga0075431_100983657 Ga0075431_1009836572 67
276 3300006847 Ga0075431_101544567 Ga0075431_1015445672 67
277 3300006852 Ga0075433_10035944 Ga0075433_100359448 67
278 3300006852 Ga0075433_10101488 Ga0075433_101014881 67
279 3300006852 Ga0075433_10173728 Ga0075433_101737282 67
280 3300006852 Ga0075433_10290529 Ga0075433_102905293 67
281 3300006852 Ga0075433_10370357 Ga0075433_103703573 67
282 3300006852 Ga0075433_11452298 Ga0075433_114522981 67
283 3300006871 Ga0075434_100022423 Ga0075434_1000224234 67
284 3300006871 Ga0075434_100032218 Ga0075434_1000322188 67
285 3300006871 Ga0075434_100122180 Ga0075434_1001221805 67
286 3300006871 Ga0075434_100211205 Ga0075434_1002112053 67
287 3300006871 Ga0075434_100480371 Ga0075434_1004803714 67
288 3300006871 Ga0075434_100618511 Ga0075434_1006185113 67
289 3300006880 Ga0075429_100017803 Ga0075429_1000178035 67
290 3300006880 Ga0075429_100251670 Ga0075429_1002516703 67
291 3300006880 Ga0075429_100290686 Ga0075429_1002906863 67
292 3300006880 Ga0075429_100783922 Ga0075429_1007839222 67
293 3300006880 Ga0075429_100840244 Ga0075429_1008402442 67
294 3300006881 Ga0068865_100874794 Ga0068865_1008747942 67
295 3300006914 Ga0075436_100475778 Ga0075436_1004757783 67
296 3300006914 Ga0075436_101127591 Ga0075436_1011275912 67
297 3300006931 Ga0097620_101044512 Ga0097620_1010445122 67
298 3300006931 Ga0097620_101063035 Ga0097620_1010630352 67
299 3300006931 Ga0097620_101934814 Ga0097620_1019348141 67
300 3300007076 Ga0075435_100098971 Ga0075435_1000989713 67
301 3300007076 Ga0075435_100101673 Ga0075435_1001016735 67
302 3300007076 Ga0075435_100178381 Ga0075435_1001783814 67
303 3300007076 Ga0075435_100195029 Ga0075435_1001950294 67
304 3300007265 Ga0099794_10004439 Ga0099794_100044393 67
305 3300007265 Ga0099794_10336567 Ga0099794_103365673 67
306 3300007265 Ga0099794_10737577 Ga0099794_107375772 67
307 3300009094 Ga0111539_10847667 Ga0111539_108476673 67
308 3300009094 Ga0111539_11944191 Ga0111539_119441912 67
309 3300009147 Ga0114129_10018018 Ga0114129_1001801815 67
310 3300009147 Ga0114129_10073142 Ga0114129_100731425 67
311 3300009147 Ga0114129_10098332 Ga0114129_100983323 67
312 3300009147 Ga0114129_10150998 Ga0114129_101509985 67
313 3300009147 Ga0114129_10160695 Ga0114129_101606953 67
314 3300009147 Ga0114129_10393415 Ga0114129_103934152 67
315 3300009147 Ga0114129_10501914 Ga0114129_105019143 67
316 3300009147 Ga0114129_10923680 Ga0114129_109236803 67
317 3300009147 Ga0114129_12260996 Ga0114129_122609962 67
318 3300009147 Ga0114129_12617208 Ga0114129_126172082 67
319 3300009176 Ga0105242_11967106 Ga0105242_119671062 67
320 3300009553 Ga0105249_10490956 Ga0105249_104909563 67
321 3300013102 Ga0157371_11534146 Ga0157371_115341462 67
322 3300013296 Ga0157374_10710922 Ga0157374_107109222 67
323 3300013297 Ga0157378_10177851 Ga0157378_101778512 67
324 3300013297 Ga0157378_10922129 Ga0157378_109221291 67
325 3300013306 Ga0163162_10506100 Ga0163162_105061003 67
326 3300013306 Ga0163162_12333013 Ga0163162_123330132 67
327 3300014325 Ga0163163_11797784 Ga0163163_117977843 67
328 3300014326 Ga0157380_12809008 Ga0157380_128090082 67
329 3300017792 Ga0163161_11772100 Ga0163161_117721002 67
330 3300025899 Ga0207642_10874357 Ga0207642_108743572 67
331 3300025910 Ga0207684_10029967 Ga0207684_100299675 67
332 3300025910 Ga0207684_10089306 Ga0207684_100893063 67
333 3300025910 Ga0207684_10730061 Ga0207684_107300613 67
334 3300025917 Ga0207660_10013639 Ga0207660_100136393 67
335 3300025921 Ga0207652_10412275 Ga0207652_104122751 67
336 3300025922 Ga0207646_10012761 Ga0207646_1001276112 67
337 3300025922 Ga0207646_10031099 Ga0207646_100310993 67
338 3300025922 Ga0207646_10504268 Ga0207646_105042684 67
339 3300025923 Ga0207681_11556231 Ga0207681_115562312 67
340 3300025934 Ga0207686_10857292 Ga0207686_108572922 67
341 3300025936 Ga0207670_10396139 Ga0207670_103961393 67
342 3300025938 Ga0207704_11297275 Ga0207704_112972752 67
343 3300025939 Ga0207665_10459802 Ga0207665_104598022 67
344 3300025940 Ga0207691_10583141 Ga0207691_105831413 67
345 3300025940 Ga0207691_10743910 Ga0207691_107439102 67
346 3300025942 Ga0207689_10378164 Ga0207689_103781643 67
347 3300025960 Ga0207651_10289685 Ga0207651_102896853 67
348 3300025986 Ga0207658_11600081 Ga0207658_116000812 67
349 3300026035 Ga0207703_11005629 Ga0207703_110056292 67
350 3300026075 Ga0207708_10535077 Ga0207708_105350772 67
351 3300027671 Ga0209588_1009054 Ga0209588_10090543 67
352 3300027695 Ga0209966_1135115 Ga0209966_11351152 67
353 3300028379 Ga0268266_10604732 Ga0268266_106047323 67
354 3300028380 Ga0268265_11812136 Ga0268265_118121362 67
355 3300030878 Ga0265770_1122828 Ga0265770_11228281 67
356 3300031548 Ga0307408_100169269 Ga0307408_1001692691 67
357 3300031852 Ga0307410_10779210 Ga0307410_107792102 67
358 3300031903 Ga0307407_11444769 Ga0307407_114447691 67
359 3300031911 Ga0307412_11151662 Ga0307412_111516622 67
360 3300032002 Ga0307416_101445815 Ga0307416_1014458153 67
361 3300032002 Ga0307416_103775279 Ga0307416_1037752792 67
362 3300032005 Ga0307411_11130277 Ga0307411_111302772 67
363 3300034816 Ga0373930_0128651 Ga0373930_0128651_243_449 67
364 3300034817 Ga0373948_0005412 Ga0373948_0005412_67_273 67
365 3300035088 Ga0373940_0160287 Ga0373940_0160287_87_293 67
366 3300035112 Ga0373932_0417171 Ga0373932_0417171_216_422 67
367 3300035115 Ga0373941_0013329 Ga0373941_0013329_369_575 67
368 3300035121 Ga0373960_0192850 Ga0373960_0192850_64_270 67
369 3300035691 Ga0373931_0001089 Ga0373931_0001089_11227_11433 67
370 3300037418 Ga0395900_0008541 Ga0395900_0008541_4241_4447 67
371 3300037418 Ga0395900_0117457 Ga0395900_0117457_370_573 67
372 3300037418 Ga0395900_0524275 Ga0395900_0524275_148_354 67
373 3300037466 Ga0395898_0019612 Ga0395898_0019612_55_261 67
374 3300037471 Ga0395905_0025786 Ga0395905_0025786_1117_1320 67
375 3300038443 Ga0395901_0688356 Ga0395901_0688356_727_933 67
376 3300038443 Ga0395901_1177619 Ga0395901_1177619_164_370 67
377 3300038996 Ga0242420_065884 Ga0242420_065884_474_677 67
378 3300041406 Ga0439439_0178234 Ga0439439_0178234_57_269 67
379 3300042156 Ga0439446_0211034 Ga0439446_0211034_28_240 67
380 3300042436 Ga0439435_0295808 Ga0439435_0295808_300_506 67
381 3300042876 Ga0451577_0027189 Ga0451577_0027189_2970_3191 67
382 3300044673 Ga0453683_0014159 Ga0453683_0014159_2774_2995 67
383 3300044673 Ga0453683_0110988 Ga0453683_0110988_350_556 67
384 3300044673 Ga0453683_0125685 Ga0453683_0125685_1278_1484 67
385 3300044673 Ga0453683_0170085 Ga0453683_0170085_471_677 67
386 3300044673 Ga0453683_0298323 Ga0453683_0298323_632_838 67
387 3300044673 Ga0453683_1234888 Ga0453683_1234888_23_241 67
388 3300044712 Ga0453684_0162077 Ga0453684_0162077_279_500 67
389 3300045051 Ga0451576_1170844 Ga0451576_1170844_24_236 67
390 3300046472 Ga0495580_0002331 Ga0495580_0002331_15627_15830 67
391 3300046528 Ga0495642_0077397 Ga0495642_0077397_28_231 67
392 3300046664 Ga0495659_0186809 Ga0495659_0186809_301_504 67
393 3300046684 Ga0495669_0149870 Ga0495669_0149870_705_908 67
394 3300046691 Ga0495670_0454343 Ga0495670_0454343_156_359 67
395 3300048905 Ga0496102_0684866 Ga0496102_0684866_500_706 67
396 3300048906 Ga0496103_0043481 Ga0496103_0043481_2511_2717 67
397 3300048918 Ga0496115_1213246 Ga0496115_1213246_233_436 67
398 3300049522 Ga0501299_051333 Ga0501299_051333_271_477 67
399 3300049572 Ga0501036_1034331 Ga0501036_1034331_340_546 67
400 3300049574 Ga0501038_0249654 Ga0501038_0249654_1126_1332 67
401 3300049575 Ga0501039_0195497 Ga0501039_0195497_533_739 67
402 3300049576 Ga0501040_0011893 Ga0501040_0011893_1022_1228 67
403 3300049576 Ga0501040_0886846 Ga0501040_0886846_305_508 67
404 3300049578 Ga0501042_0432847 Ga0501042_0432847_168_374 67
405 3300049578 Ga0501042_0546663 Ga0501042_0546663_626_832 67
406 3300049579 Ga0501043_0348875 Ga0501043_0348875_598_804 67
407 3300049582 Ga0501048_0196295 Ga0501048_0196295_123_326 67
408 3300049587 Ga0501071_0389570 Ga0501071_0389570_250_456 67
409 3300049587 Ga0501071_1360526 Ga0501071_1360526_299_505 67
410 3300049588 Ga0501072_0016727 Ga0501072_0016727_3088_3294 67
411 3300049588 Ga0501072_0188986 Ga0501072_0188986_720_926 67
412 3300049588 Ga0501072_0272863 Ga0501072_0272863_171_377 67
413 3300049588 Ga0501072_0619601 Ga0501072_0619601_451_657 67
414 3300049591 Ga0501075_0033504 Ga0501075_0033504_296_502 67
415 3300049591 Ga0501075_0100208 Ga0501075_0100208_1603_1806 67
416 3300049591 Ga0501075_0148505 Ga0501075_0148505_223_429 67
417 3300049591 Ga0501075_0912893 Ga0501075_0912893_434_640 67
418 3300049591 Ga0501075_1179155 Ga0501075_1179155_91_294 67
419 3300049592 Ga0501076_0201575 Ga0501076_0201575_1010_1216 67
420 3300049592 Ga0501076_1271396 Ga0501076_1271396_64_270 67
421 3300049593 Ga0501077_0058715 Ga0501077_0058715_657_863 67
422 3300049593 Ga0501077_0197658 Ga0501077_0197658_667_873 67
423 3300049593 Ga0501077_0207893 Ga0501077_0207893_487_690 67
424 3300049741 Ga0501079_0856565 Ga0501079_0856565_447_653 67
425 3300049741 Ga0501079_1546784 Ga0501079_1546784_91_297 67
426 3300049742 Ga0501080_0557443 Ga0501080_0557443_351_557 67
427 3300049742 Ga0501080_1693207 Ga0501080_1693207_138_341 67
428 3300049743 Ga0501081_0016853 Ga0501081_0016853_1147_1350 67
429 3300049743 Ga0501081_0044069 Ga0501081_0044069_1243_1449 67
430 3300049743 Ga0501081_0196431 Ga0501081_0196431_480_683 67
431 3300049744 Ga0501083_0665694 Ga0501083_0665694_256_462 67
432 3300049822 Ga0501035_0709494 Ga0501035_0709494_438_644 67
433 3300049822 Ga0501035_0740325 Ga0501035_0740325_244_450 67
434 3300049822 Ga0501035_0849480 Ga0501035_0849480_429_635 67
435 3300049824 Ga0501045_0206262 Ga0501045_0206262_768_974 67
436 3300050507 nmdc:mga05p37_113447_c1 nmdc:mga05p37_113447_c1_3118_3321 67
437 3300050507 nmdc:mga05p37_117942_c1 nmdc:mga05p37_117942_c1_779_982 67
438 3300050507 nmdc:mga05p37_1222_c1 nmdc:mga05p37_1222_c1_7333_7539 67
439 3300050507 nmdc:mga05p37_13279_c1 nmdc:mga05p37_13279_c1_1642_1845 67
440 3300050507 nmdc:mga05p37_1445378_c1 nmdc:mga05p37_1445378_c1_275_481 67
441 3300050507 nmdc:mga05p37_1606057_c1 nmdc:mga05p37_1606057_c1_10_213 67
442 3300050507 nmdc:mga05p37_309364_c1 nmdc:mga05p37_309364_c1_245_451 67
443 3300050507 nmdc:mga05p37_35190_c1 nmdc:mga05p37_35190_c1_3607_3822 67
444 3300050507 nmdc:mga05p37_521791_c1 nmdc:mga05p37_521791_c1_518_724 67
445 3300050507 nmdc:mga05p37_66520_c1 nmdc:mga05p37_66520_c1_508_714 67
446 3300050508 nmdc:mga09592_1052076_c1 nmdc:mga09592_1052076_c1_202_408 67
447 3300050508 nmdc:mga09592_1307603_c1 nmdc:mga09592_1307603_c1_45_260 67
448 3300050508 nmdc:mga09592_1719522_c1 nmdc:mga09592_1719522_c1_157_363 67
449 3300050508 nmdc:mga09592_289932_c1 nmdc:mga09592_289932_c1_1028_1231 67
450 3300050508 nmdc:mga09592_80268_c1 nmdc:mga09592_80268_c1_1698_1904 67
451 3300050509 nmdc:mga0qj67_1099_c1 nmdc:mga0qj67_1099_c1_2468_2674 67
452 3300050509 nmdc:mga0qj67_1545366_c1 nmdc:mga0qj67_1545366_c1_258_464 67
453 3300050509 nmdc:mga0qj67_258978_c1 nmdc:mga0qj67_258978_c1_631_846 67
454 3300050509 nmdc:mga0qj67_451476_c1 nmdc:mga0qj67_451476_c1_130_336 67
455 3300050510 nmdc:mga06r32_1774962_c1 nmdc:mga06r32_1774962_c1_327_530 67
456 3300050510 nmdc:mga06r32_268980_c1 nmdc:mga06r32_268980_c1_528_731 67
457 3300050510 nmdc:mga06r32_277835_c1 nmdc:mga06r32_277835_c1_432_638 67
458 3300050510 nmdc:mga06r32_2918_c1 nmdc:mga06r32_2918_c1_2816_3022 67
459 3300050510 nmdc:mga06r32_460336_c1 nmdc:mga06r32_460336_c1_937_1143 67
460 3300050510 nmdc:mga06r32_78250_c1 nmdc:mga06r32_78250_c1_2668_2883 67
461 3300050510 nmdc:mga06r32_801669_c1 nmdc:mga06r32_801669_c1_444_647 67
462 3300050512 nmdc:mga0n895_28975_c1 nmdc:mga0n895_28975_c1_2531_2734 67
463 3300050512 nmdc:mga0n895_324038_c1 nmdc:mga0n895_324038_c1_951_1166 67
464 3300050512 nmdc:mga0n895_657075_c1 nmdc:mga0n895_657075_c1_58_264 67
465 3300050512 nmdc:mga0n895_723795_c1 nmdc:mga0n895_723795_c1_51_260 67
466 3300050513 nmdc:mga0rr50_127767_c1 nmdc:mga0rr50_127767_c1_893_1099 67
467 3300050513 nmdc:mga0rr50_139894_c1 nmdc:mga0rr50_139894_c1_1729_1932 67
468 3300050513 nmdc:mga0rr50_1492448_c1 nmdc:mga0rr50_1492448_c1_248_451 67
469 3300050513 nmdc:mga0rr50_230856_c1 nmdc:mga0rr50_230856_c1_18_266 67
470 3300050513 nmdc:mga0rr50_422956_c1 nmdc:mga0rr50_422956_c1_10_213 67
471 3300050513 nmdc:mga0rr50_91000_c1 nmdc:mga0rr50_91000_c1_2036_2245 67
472 3300050514 nmdc:mga08x19_454921_c1 nmdc:mga08x19_454921_c1_471_674 67
473 3300050514 nmdc:mga08x19_595476_c1 nmdc:mga08x19_595476_c1_334_537 67
474 3300050515 nmdc:mga0a205_177370_c1 nmdc:mga0a205_177370_c1_213_422 67
475 3300050515 nmdc:mga0a205_691786_c1 nmdc:mga0a205_691786_c1_64_267 67
476 3300050515 nmdc:mga0a205_8521_c1 nmdc:mga0a205_8521_c1_1269_1472 67
477 3300054114 Ga0501084_0147660 Ga0501084_0147660_1511_1717 67
478 3300054114 Ga0501084_0150910 Ga0501084_0150910_394_600 67
479 3300054114 Ga0501084_0540947 Ga0501084_0540947_323_526 67
480 3300054114 Ga0501084_0625302 Ga0501084_0625302_251_457 67
481 3300054114 Ga0501084_1695756 Ga0501084_1695756_57_263 67
482 3300059421 Ga0590071_018947 Ga0590071_018947_414_620 67
483 3300059423 Ga0590074_025359 Ga0590074_025359_17_223 67
484 3300060353 Ga0501082_0055193 Ga0501082_0055193_1829_2035 67
485 3300060353 Ga0501082_1518198 Ga0501082_1518198_54_260 67
486 3300061734 Ga0530510_0161027 Ga0530510_0161027_911_1117 67
487 3300061734 Ga0530510_1389055 Ga0530510_1389055_292_495 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04384

Fe-S_assembly

Iron-sulphur cluster assembly

17

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.9995 2 63
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.9628 2 64
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.9115 2 63
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.9076 2 64
8r57-assembly1.cif.gz_h cryoem structure of wheat 40s ribosomal subunit, head domain 0.6504 5 66
ID Description Score Start End Superfamily
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9995 2 63 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9628 2 64 1.10.10.600
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9115 2 63 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9076 2 64 1.10.10.600
af_O74503_1_54_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5958 8 60 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2V6U3E9-F1-model_v4 Fe-S assembly protein IscX 1.009 2 67 GO:0005829
GO:0008198
GO:0016226
AF-A0A2V9YC42-F1-model_v4 Fe-S assembly protein IscX 1.008 2 66 GO:0005829
GO:0008198
GO:0016226
AF-A0A1F2R3X3-F1-model_v4 Fe-S assembly protein IscX 1.007 2 66 GO:0005829
GO:0008198
GO:0016226
AF-B6ALM1-F1-model_v4 FeS assembly protein IscX 1.006 2 66 GO:0005829
GO:0008198
GO:0016226
AF-A0A1F7LNY1-F1-model_v4 Fe-S assembly protein IscX 1.005 2 67 GO:0005829
GO:0008198
GO:0016226

Feature Viewer

pLDDT pTM Quality
97.63 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map