F453426

General Info

Members Datasets Scaffolds Average Seq Length
487 269 974 265

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10118559|Ga0070717_101185594
Length 295
Sequence MSTQVATSNEGDNEHPKGHIAMKTPPIVSQQEWGAARQQLLAKEKALTRSRDALAAERRRMPWMAVEKKYEFDGPKGSVSLLDLFEGRRQLIVYRAFFEPGVFGWPEHACRCSLGADQVPHLAHLNARDTTLAYASRSPQMDIARLKARMGWEMPWYTMTDNFDTDFGVDQWHGHNAFIRDGDKVYRTYFINGRGDEAMGTTWSYLDMTALGRQETWEDSPEGYPQTPPYKWWNWHDNYDAEPAPHPLWVDILTDPEGAAIRRRDAEANEDRVLADAEKEEIAELQAGDPGNQGA

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
142 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
143 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
232 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
233 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
240 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
241 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
246 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
263 2643221557 Ensifer sp. Root558 Isolate Unclassified
264 2643221610 Ensifer sp. Root74 Isolate Unclassified
265 2643221668 Ensifer sp. Root423 Isolate Unclassified
266 2643221675 Ensifer sp. Root1298 Isolate Unclassified
267 2643221680 Ensifer sp. Root1312 Isolate Unclassified
268 2643221726 Ensifer sp. Root954 Isolate Unclassified
269 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0.21
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0.21
Rhizoplane 2.26
Rhizosphere 92.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10118559 3300006028 Bacteria 2265
2 SwRhRL2b_contig_978117 2162886007 Bacteria 1206
3 JGI24751J29686_10000232 3300002459 Bacteria 22923
4 Ga0065704_10000988 3300005289 Bacteria 17860
5 Ga0065707_10088817 3300005295 Bacteria 4528
6 Ga0070683_100226222 3300005329 Bacteria 1778
7 Ga0070670_100000095 3300005331 Bacteria 83302
8 Ga0070670_100029510 3300005331 Bacteria 4722
9 Ga0070670_100029824 3300005331 Bacteria 4698
10 Ga0070666_10102556 3300005335 Bacteria 1973
11 Ga0068868_100003217 3300005338 Bacteria 11366
12 Ga0068868_100206487 3300005338 Bacteria 1640
13 Ga0070660_100444608 3300005339 Bacteria 1075
14 Ga0070689_100000144 3300005340 Bacteria 41278
15 Ga0070661_100163499 3300005344 Bacteria 1687
16 Ga0070669_100009031 3300005353 Bacteria 7108
17 Ga0070675_100417889 3300005354 Bacteria 1199
18 Ga0070671_100041948 3300005355 Bacteria 3803
19 Ga0070673_100199926 3300005364 Bacteria 1721
20 Ga0070673_100542347 3300005364 Bacteria 1056
21 Ga0070667_100456813 3300005367 Bacteria 1167
22 Ga0070709_10421361 3300005434 Bacteria 1000
23 Ga0070714_100006677 3300005435 Bacteria 8932
24 Ga0070714_100680855 3300005435 Bacteria 991
25 Ga0070713_100003075 3300005436 Bacteria 10967
26 Ga0070713_100029355 3300005436 Bacteria 4355
27 Ga0070710_10206953 3300005437 Bacteria 1242
28 Ga0070711_100242535 3300005439 Bacteria 1410
29 Ga0070711_100253281 3300005439 Bacteria 1382
30 Ga0070700_100000347 3300005441 Bacteria 23908
31 Ga0070694_100000183 3300005444 Bacteria 32881
32 Ga0070694_100002798 3300005444 Bacteria 10358
33 Ga0070694_100004409 3300005444 Bacteria 8463
34 Ga0070708_100029805 3300005445 Bacteria 4709
35 Ga0070708_100054682 3300005445 Bacteria 3546
36 Ga0070678_100010898 3300005456 Bacteria 5578
37 Ga0070678_100102649 3300005456 Bacteria 2220
38 Ga0070678_100522025 3300005456 Bacteria 1051
39 Ga0070662_100053242 3300005457 Bacteria 2929
40 Ga0070681_10069312 3300005458 Bacteria 3493
41 Ga0070681_10108383 3300005458 Bacteria 2718
42 Ga0068867_100011860 3300005459 Bacteria 6157
43 Ga0070685_10000187 3300005466 Bacteria 41499
44 Ga0070706_100038767 3300005467 Bacteria 4397
45 Ga0070706_100140403 3300005467 Bacteria 2255
46 Ga0070706_100255612 3300005467 Bacteria 1636
47 Ga0070707_100041064 3300005468 Bacteria 4427
48 Ga0070707_100171293 3300005468 Bacteria 2115
49 Ga0070707_100187188 3300005468 Bacteria 2018
50 Ga0070698_100002203 3300005471 Bacteria 21614
51 Ga0070698_100012121 3300005471 Bacteria 9136
52 Ga0070698_100080856 3300005471 Bacteria 3244
53 Ga0070699_100009477 3300005518 Bacteria 8434
54 Ga0070699_100025173 3300005518 Bacteria 5132
55 Ga0070699_100072473 3300005518 Bacteria 2996
56 Ga0070679_100020736 3300005530 Bacteria 6411
57 Ga0070679_100315202 3300005530 Bacteria 1514
58 Ga0070684_100038112 3300005535 Bacteria 4128
59 Ga0070684_100038840 3300005535 Bacteria 4092
60 Ga0070697_100137230 3300005536 Bacteria 2054
61 Ga0070697_100251145 3300005536 Bacteria 1512
62 Ga0068853_100001592 3300005539 Bacteria 16535
63 Ga0068853_100003991 3300005539 Bacteria 11346
64 Ga0070693_100070911 3300005547 Bacteria 2051
65 Ga0070665_100003785 3300005548 Bacteria 16013
66 Ga0070665_100226023 3300005548 Bacteria 1872
67 Ga0068855_100001685 3300005563 Bacteria 27674
68 Ga0068855_100350988 3300005563 Bacteria 1625
69 Ga0068855_100397094 3300005563 Bacteria 1512
70 Ga0068855_100706240 3300005563 Bacteria 1079
71 Ga0070664_100005027 3300005564 Bacteria 10598
72 Ga0068857_100008470 3300005577 Bacteria 8889
73 Ga0068854_100006932 3300005578 Bacteria 7228
74 Ga0068856_100007631 3300005614 Bacteria 10556
75 Ga0068856_100021404 3300005614 Bacteria 6287
76 Ga0068852_100352152 3300005616 Bacteria 1438
77 Ga0068859_100000760 3300005617 Bacteria 32548
78 Ga0068859_100005861 3300005617 Bacteria 12470
79 Ga0068859_100013026 3300005617 Bacteria 8355
80 Ga0068859_100025196 3300005617 Bacteria 5969
81 Ga0068859_100115877 3300005617 Bacteria 2744
82 Ga0068864_100003760 3300005618 Bacteria 12524
83 Ga0068864_100007088 3300005618 Bacteria 9204
84 Ga0068864_100062038 3300005618 Bacteria 3238
85 Ga0068864_100124061 3300005618 Bacteria 2312
86 Ga0068870_10038984 3300005840 Bacteria 2456
87 Ga0068863_100020727 3300005841 Bacteria 6278
88 Ga0068863_100021542 3300005841 Bacteria 6150
89 Ga0068863_100105362 3300005841 Bacteria 2682
90 Ga0068863_100557312 3300005841 Bacteria 1132
91 Ga0068863_100606723 3300005841 Bacteria 1084
92 Ga0068858_100000119 3300005842 Bacteria 82628
93 Ga0068858_100003772 3300005842 Bacteria 14975
94 Ga0068858_100178208 3300005842 Bacteria 2006
95 Ga0068858_100529865 3300005842 Bacteria 1139
96 Ga0068860_100424864 3300005843 Bacteria 1318
97 Ga0068860_100739790 3300005843 Bacteria 995
98 Ga0081455_10033603 3300005937 Bacteria 4607
99 Ga0081540_1019451 3300005983 Bacteria 4123
100 Ga0081540_1029470 3300005983 Bacteria 3056
101 Ga0081539_10059606 3300005985 Bacteria 2100
102 Ga0070717_10002379 3300006028 Bacteria 13266
103 Ga0070717_10003063 3300006028 Bacteria 11920
104 Ga0070717_10047494 3300006028 Bacteria 3518
105 Ga0070717_10214618 3300006028 Bacteria 1690
106 Ga0070717_10445427 3300006028 Bacteria 1167
107 Ga0070716_100003395 3300006173 Bacteria 7487
108 Ga0070716_100395074 3300006173 Bacteria 993
109 Ga0070712_100011533 3300006175 Bacteria 5607
110 Ga0070712_100049950 3300006175 Bacteria 2907
111 Ga0070712_100146438 3300006175 Bacteria 1808
112 Ga0097621_100016256 3300006237 Bacteria 5620
113 Ga0097621_100155163 3300006237 Bacteria 1965
114 Ga0068871_100045304 3300006358 Bacteria 3540
115 Ga0068871_100053573 3300006358 Bacteria 3270
116 Ga0068871_100157274 3300006358 Bacteria 1942
117 Ga0068871_100189282 3300006358 Bacteria 1772
118 Ga0068871_100359870 3300006358 Bacteria 1289
119 Ga0075428_100127675 3300006844 Bacteria 2767
120 Ga0075428_100207533 3300006844 Bacteria 2117
121 Ga0075428_100408622 3300006844 Bacteria 1455
122 Ga0075430_100069328 3300006846 Bacteria 2958
123 Ga0075430_100075049 3300006846 Bacteria 2835
124 Ga0075431_100006859 3300006847 Bacteria 11316
125 Ga0075431_100037220 3300006847 Bacteria 5014
126 Ga0075431_100059999 3300006847 Bacteria 3925
127 Ga0075431_100146248 3300006847 Bacteria 2435
128 Ga0075433_10026054 3300006852 Bacteria 4947
129 Ga0075433_10036241 3300006852 Bacteria 4248
130 Ga0075433_10060584 3300006852 Bacteria 3314
131 Ga0075433_10071724 3300006852 Bacteria 3044
132 Ga0075433_10147220 3300006852 Bacteria 2094
133 Ga0075434_100005931 3300006871 Bacteria 11178
134 Ga0075434_100007913 3300006871 Bacteria 9851
135 Ga0075434_100030073 3300006871 Bacteria 5347
136 Ga0075434_100041130 3300006871 Bacteria 4578
137 Ga0075434_100120973 3300006871 Bacteria 2634
138 Ga0075436_100106416 3300006914 Bacteria 1956
139 Ga0097620_100000760 3300006931 Bacteria 32548
140 Ga0097620_100005861 3300006931 Bacteria 12470
141 Ga0097620_100013026 3300006931 Bacteria 8355
142 Ga0097620_100025198 3300006931 Bacteria 5969
143 Ga0097620_100115873 3300006931 Bacteria 2744
144 Ga0075435_100028124 3300007076 Bacteria 4407
145 Ga0099794_10010520 3300007265 Bacteria 3931
146 Ga0099794_10014406 3300007265 Bacteria 3465
147 Ga0099795_10054266 3300007788 Bacteria 1469
148 Ga0105240_10002229 3300009093 Bacteria 31523
149 Ga0105240_10004497 3300009093 Bacteria 21191
150 Ga0105240_10011651 3300009093 Bacteria 12224
151 Ga0105240_10169728 3300009093 Bacteria 2585
152 Ga0105240_10179370 3300009093 Bacteria 2501
153 Ga0111539_10026232 3300009094 Bacteria 7129
154 Ga0111539_10056110 3300009094 Bacteria 4682
155 Ga0111539_10099525 3300009094 Bacteria 3414
156 Ga0105245_10000480 3300009098 Bacteria 36564
157 Ga0114129_10002308 3300009147 Bacteria 26441
158 Ga0114129_10028183 3300009147 Bacteria 7957
159 Ga0114129_10036666 3300009147 Bacteria 6922
160 Ga0114129_10073693 3300009147 Bacteria 4757
161 Ga0114129_10189048 3300009147 Bacteria 2797
162 Ga0114129_10251407 3300009147 Bacteria 2373
163 Ga0114129_10787828 3300009147 Bacteria 1214
164 Ga0105242_10016393 3300009176 Bacteria 5759
165 Ga0105248_10033043 3300009177 Bacteria 5778
166 Ga0105248_10033433 3300009177 Bacteria 5745
167 Ga0105248_10241759 3300009177 Bacteria 2032
168 Ga0105237_10007099 3300009545 Bacteria 12308
169 Ga0105237_10010305 3300009545 Bacteria 9957
170 Ga0105237_10026668 3300009545 Bacteria 5905
171 Ga0123341_1030190 3300009765 Bacteria 4100
172 Ga0105239_10004563 3300010375 Bacteria 16512
173 Ga0105239_10009143 3300010375 Bacteria 11208
174 Ga0105239_10155556 3300010375 Bacteria 2553
175 Ga0105239_10542517 3300010375 Bacteria 1324
176 Ga0157373_10084933 3300013100 Bacteria 2231
177 Ga0157373_10181680 3300013100 Bacteria 1481
178 Ga0157371_10026889 3300013102 Bacteria 4177
179 Ga0157369_10002504 3300013105 Bacteria 21991
180 Ga0157369_10038999 3300013105 Bacteria 5192
181 Ga0157378_10000082 3300013297 Bacteria 88212
182 Ga0157378_10108159 3300013297 Bacteria 2546
183 Ga0157378_10659827 3300013297 Bacteria 1062
184 Ga0157372_10000145 3300013307 Bacteria 78146
185 Ga0157372_10136517 3300013307 Bacteria 2825
186 Ga0157372_10226866 3300013307 Bacteria 2165
187 Ga0157375_10009311 3300013308 Bacteria 8621
188 Ga0157375_10087131 3300013308 Bacteria 3174
189 Ga0157375_10484583 3300013308 Bacteria 1401
190 Ga0163163_10000026 3300014325 Bacteria 179198
191 Ga0163163_10001466 3300014325 Bacteria 19953
192 Ga0163163_10184830 3300014325 Bacteria 2132
193 Ga0163163_10258607 3300014325 Bacteria 1792
194 Ga0157379_10021993 3300014968 Bacteria 5651
195 Ga0157376_10031630 3300014969 Bacteria 4241
196 Ga0213874_10004358 3300021377 Bacteria 3222
197 Ga0213875_10000006 3300021388 Bacteria 579005
198 Ga0213875_10000780 3300021388 Bacteria 23789
199 Ga0228598_1015944 3300024227 Bacteria 1482
200 Ga0209256_1000509 3300025299 Bacteria 57170
201 Ga0207680_10028301 3300025903 Bacteria 3133
202 Ga0207680_10036514 3300025903 Bacteria 2830
203 Ga0207680_10086878 3300025903 Bacteria 1979
204 Ga0207699_10137825 3300025906 Bacteria 1600
205 Ga0207645_10081413 3300025907 Bacteria 2076
206 Ga0207643_10075568 3300025908 Bacteria 1944
207 Ga0207684_10000011 3300025910 Bacteria 502991
208 Ga0207684_10015963 3300025910 Bacteria 6454
209 Ga0207684_10033784 3300025910 Bacteria 4350
210 Ga0207684_10370646 3300025910 Bacteria 1232
211 Ga0207707_10155242 3300025912 Bacteria 2002
212 Ga0207695_10021714 3300025913 Bacteria 7317
213 Ga0207695_10023959 3300025913 Bacteria 6884
214 Ga0207695_10049119 3300025913 Bacteria 4450
215 Ga0207695_10085693 3300025913 Bacteria 3179
216 Ga0207695_10112174 3300025913 Bacteria 2705
217 Ga0207671_10100807 3300025914 Bacteria 2187
218 Ga0207671_10130503 3300025914 Bacteria 1928
219 Ga0207671_10161619 3300025914 Bacteria 1735
220 Ga0207693_10294506 3300025915 Bacteria 1271
221 Ga0207663_10233374 3300025916 Bacteria 1345
222 Ga0207662_10136800 3300025918 Bacteria 1549
223 Ga0207649_10131609 3300025920 Bacteria 1700
224 Ga0207649_10230834 3300025920 Bacteria 1323
225 Ga0207652_10029488 3300025921 Bacteria 4589
226 Ga0207652_10579683 3300025921 Bacteria 1007
227 Ga0207646_10013421 3300025922 Bacteria 7837
228 Ga0207646_10036806 3300025922 Bacteria 4416
229 Ga0207646_10056474 3300025922 Bacteria 3509
230 Ga0207646_10131669 3300025922 Bacteria 2251
231 Ga0207681_10003666 3300025923 Bacteria 9546
232 Ga0207694_10000025 3300025924 Bacteria 258871
233 Ga0207694_10103944 3300025924 Bacteria 2253
234 Ga0207694_10120695 3300025924 Bacteria 2093
235 Ga0207694_10316333 3300025924 Bacteria 1287
236 Ga0207650_10000006 3300025925 Bacteria 544730
237 Ga0207650_10047444 3300025925 Bacteria 3165
238 Ga0207650_10081509 3300025925 Bacteria 2455
239 Ga0207659_10200177 3300025926 Bacteria 1594
240 Ga0207659_10468964 3300025926 Bacteria 1062
241 Ga0207700_10024298 3300025928 Bacteria 4193
242 Ga0207700_10026494 3300025928 Bacteria 4043
243 Ga0207700_10217046 3300025928 Bacteria 1619
244 Ga0207700_10240332 3300025928 Bacteria 1543
245 Ga0207664_10214034 3300025929 Bacteria 1668
246 Ga0207664_10331093 3300025929 Bacteria 1345
247 Ga0207644_10233972 3300025931 Bacteria 1461
248 Ga0207690_10233166 3300025932 Bacteria 1414
249 Ga0207706_10001232 3300025933 Bacteria 25813
250 Ga0207706_10509644 3300025933 Bacteria 1038
251 Ga0207704_10632444 3300025938 Bacteria 880
252 Ga0207665_10117377 3300025939 Bacteria 1876
253 Ga0207711_10025933 3300025941 Bacteria 4916
254 Ga0207711_10179848 3300025941 Bacteria 1923
255 Ga0207711_10451127 3300025941 Bacteria 1197
256 Ga0207689_10069598 3300025942 Bacteria 2892
257 Ga0207661_10207342 3300025944 Bacteria 1726
258 Ga0207661_10267597 3300025944 Bacteria 1524
259 Ga0207679_10277741 3300025945 Bacteria 1435
260 Ga0207667_10005250 3300025949 Bacteria 15806
261 Ga0207667_10390891 3300025949 Bacteria 1416
262 Ga0207651_10249151 3300025960 Bacteria 1452
263 Ga0207712_10062526 3300025961 Bacteria 2647
264 Ga0207668_10551761 3300025972 Bacteria 998
265 Ga0207640_10042164 3300025981 Bacteria 2908
266 Ga0207640_10175140 3300025981 Bacteria 1603
267 Ga0207658_10349028 3300025986 Bacteria 1288
268 Ga0207677_10007160 3300026023 Bacteria 6144
269 Ga0207677_10031992 3300026023 Bacteria 3376
270 Ga0207703_10150073 3300026035 Bacteria 2031
271 Ga0207703_10397545 3300026035 Bacteria 1278
272 Ga0207639_10064927 3300026041 Bacteria 2832
273 Ga0207639_10086983 3300026041 Bacteria 2490
274 Ga0207678_10588789 3300026067 Bacteria 975
275 Ga0207708_10000790 3300026075 Bacteria 23866
276 Ga0207702_10008981 3300026078 Bacteria 8418
277 Ga0207702_10010781 3300026078 Bacteria 7629
278 Ga0207641_10005281 3300026088 Bacteria 11034
279 Ga0207641_10090108 3300026088 Bacteria 2681
280 Ga0207641_10141230 3300026088 Bacteria 2173
281 Ga0207641_10399447 3300026088 Bacteria 1319
282 Ga0207648_10058375 3300026089 Bacteria 3365
283 Ga0207648_10260967 3300026089 Bacteria 1546
284 Ga0207676_10024673 3300026095 Bacteria 4453
285 Ga0207676_10035777 3300026095 Bacteria 3772
286 Ga0207676_10089516 3300026095 Bacteria 2522
287 Ga0207676_10463923 3300026095 Bacteria 1196
288 Ga0207674_10000116 3300026116 Bacteria 93023
289 Ga0207674_10285461 3300026116 Bacteria 1599
290 Ga0207675_100265037 3300026118 Bacteria 1666
291 Ga0207683_10004371 3300026121 Bacteria 12208
292 Ga0207683_10051407 3300026121 Bacteria 3610
293 Ga0207683_10209248 3300026121 Bacteria 1775
294 Ga0209588_1012506 3300027671 Bacteria 2578
295 Ga0207428_10002076 3300027907 Bacteria 20182
296 Ga0207428_10010910 3300027907 Bacteria 8087
297 Ga0207428_10024861 3300027907 Bacteria 5023
298 Ga0265356_1000255 3300028017 Bacteria 10004
299 Ga0265356_1001816 3300028017 Bacteria 3013
300 Ga0265357_1000221 3300028023 Bacteria 2775
301 Ga0265355_1002622 3300028036 Bacteria 1268
302 Ga0268266_10013773 3300028379 Bacteria 6963
303 Ga0268266_10216311 3300028379 Bacteria 1759
304 Ga0268264_10184111 3300028381 Bacteria 1899
305 Ga0268264_10423674 3300028381 Bacteria 1284
306 Ga0268264_10857788 3300028381 Bacteria 910
307 Ga0265338_10085371 3300028800 Bacteria 2631
308 Ga0265338_10120247 3300028800 Bacteria 2095
309 Ga0307511_10002375 3300030521 Bacteria 19685
310 Ga0265760_10000164 3300031090 Bacteria 17436
311 Ga0265332_10032877 3300031238 Bacteria 2259
312 Ga0265328_10022814 3300031239 Bacteria 2378
313 Ga0265325_10043233 3300031241 Bacteria 2352
314 Ga0265329_10063611 3300031242 Bacteria 1167
315 Ga0265340_10026548 3300031247 Bacteria 2926
316 Ga0265331_10014878 3300031250 Bacteria 4126
317 Ga0265316_10094173 3300031344 Bacteria 2282
318 Ga0265316_10144131 3300031344 Bacteria 1787
319 Ga0307508_10000090 3300031616 Bacteria 106893
320 Ga0265342_10008073 3300031712 Bacteria 7609
321 Ga0307516_10007751 3300031730 Bacteria 12271
322 Ga0307410_10010263 3300031852 Bacteria 5294
323 Ga0307406_10004134 3300031901 Bacteria 7902
324 Ga0307412_10010658 3300031911 Bacteria 5299
325 Ga0307414_10025149 3300032004 Bacteria 3808
326 Ga0307414_10132243 3300032004 Bacteria 1939
327 Ga0307414_10207091 3300032004 Bacteria 1600
328 Ga0307411_10007970 3300032005 Bacteria 5449
329 Ga0307411_10114043 3300032005 Bacteria 1941
330 Ga0373934_0077158 3300035086 Bacteria 1336
331 Ga0373953_0097777 3300035117 Bacteria 1233
332 Ga0373954_0023627 3300035118 Bacteria 2797
333 Ga0373956_0033478 3300035119 Bacteria 2260
334 Ga0373946_0043658 3300035171 Bacteria 1848
335 Ga0373946_0044941 3300035171 Bacteria 1825
336 Ga0373955_0059208 3300035172 Bacteria 2109
337 Ga0373931_0046565 3300035691 Bacteria 2293
338 Ga0373935_0050929 3300035692 Bacteria 2629
339 Ga0373927_0032220 3300035695 Bacteria 3413
340 Ga0373933_0003210 3300035724 Bacteria 9125
341 Ga0373947_0191867 3300035725 Bacteria 1333
342 Ga0373937_0001938 3300036401 Bacteria 17317
343 Ga0373937_0055403 3300036401 Bacteria 3640
344 Ga0373937_0064160 3300036401 Bacteria 3379
345 Ga0373937_0177263 3300036401 Bacteria 2001
346 Ga0373925_0004756 3300037068 Bacteria 10228
347 Ga0373925_0019928 3300037068 Bacteria 4880
348 Ga0373925_0022804 3300037068 Bacteria 4569
349 Ga0373925_0233464 3300037068 Bacteria 1471
350 Ga0395898_0021580 3300037466 Bacteria 6527
351 Ga0395905_0082564 3300037471 Bacteria 3011
352 Ga0436364_0202263 3300037853 Bacteria 63132
353 Ga0436364_0365978 3300037853 Bacteria 975
354 Ga0436364_0478514 3300037853 Bacteria 578677
355 Ga0436364_1149767 3300037853 Bacteria 10193
356 Ga0436364_1168799 3300037853 Bacteria 1906
357 Ga0395901_0138918 3300038443 Bacteria 2554
358 Ga0395901_0447372 3300038443 Bacteria 1322
359 Ga0436365_1401176 3300039437 Bacteria 3379
360 Ga0436363_0994885 3300039450 Bacteria 5148
361 Ga0439448_0007196 3300042005 Bacteria 3218
362 Ga0439458_0002177 3300042157 Bacteria 4841
363 Ga0439435_0051171 3300042436 Bacteria 1183
364 Ga0453683_0246781 3300044673 Bacteria 1138
365 Ga0453684_0072169 3300044712 Bacteria 4360
366 Ga0466958_0044298 3300045836 Bacteria 2682
367 Ga0466967_0092885 3300045976 Bacteria 2745
368 Ga0495627_000319 3300046453 Bacteria 47093
369 Ga0495592_0003757 3300046454 Bacteria 10960
370 Ga0495629_0004595 3300046459 Bacteria 10333
371 Ga0495629_0055604 3300046459 Bacteria 2767
372 Ga0495651_0000210 3300046462 Bacteria 44718
373 Ga0495651_0142328 3300046462 Bacteria 1737
374 Ga0495653_0000528 3300046463 Bacteria 29299
375 Ga0495580_0003064 3300046472 Bacteria 14316
376 Ga0495580_0015841 3300046472 Bacteria 5675
377 Ga0495582_0057574 3300046473 Bacteria 2143
378 Ga0495639_0088672 3300046475 Bacteria 1449
379 Ga0495608_0002460 3300046511 Bacteria 13300
380 Ga0495618_0042365 3300046514 Bacteria 2869
381 Ga0495618_0101965 3300046514 Bacteria 1837
382 Ga0495628_0330458 3300046516 Bacteria 1123
383 Ga0495630_0182445 3300046517 Bacteria 1600
384 Ga0495648_0089999 3300046524 Bacteria 1721
385 Ga0495640_0043699 3300046533 Bacteria 3119
386 Ga0495587_0000572 3300046536 Bacteria 25284
387 Ga0495645_0039263 3300046543 Bacteria 3453
388 Ga0495645_0183473 3300046543 Bacteria 1432
389 Ga0495667_0004282 3300046559 Bacteria 9621
390 Ga0495635_0007676 3300046663 Bacteria 7527
391 Ga0495599_0040938 3300046678 Bacteria 2909
392 Ga0495623_0004968 3300046679 Bacteria 8723
393 Ga0495658_0009332 3300046683 Bacteria 4887
394 Ga0495669_0147974 3300046684 Bacteria 1111
395 Ga0495613_0104114 3300046689 Bacteria 2049
396 Ga0495589_0015883 3300046794 Bacteria 3871
397 Ga0495600_0001587 3300046809 Bacteria 12627
398 Ga0495600_0342845 3300046809 Bacteria 937
399 Ga0495604_0000186 3300047317 Bacteria 55450
400 Ga0495604_0176901 3300047317 Bacteria 1495
401 Ga0495636_0068511 3300047318 Bacteria 1511
402 Ga0495674_0011729 3300047319 Bacteria 8266
403 Ga0495674_0206843 3300047319 Bacteria 1627
404 Ga0495680_0000924 3300047322 Bacteria 32584
405 Ga0495675_0008418 3300047444 Bacteria 6389
406 Ga0495677_0062040 3300047445 Bacteria 1387
407 Ga0495673_0000102 3300047469 Bacteria 173343
408 Ga0495684_0024616 3300047471 Bacteria 4632
409 Ga0495602_0236779 3300048088 Bacteria 1368
410 Ga0495602_0296486 3300048088 Bacteria 1185
411 Ga0496104_0682824 3300048907 Bacteria 935
412 Ga0496109_0004341 3300048912 Bacteria 11848
413 Ga0496109_0020224 3300048912 Bacteria 5880
414 Ga0496111_0223499 3300048914 Bacteria 1399
415 Ga0496112_0014389 3300048915 Bacteria 7336
416 Ga0496112_0039226 3300048915 Bacteria 4627
417 Ga0496112_0289784 3300048915 Bacteria 1583
418 Ga0496113_0156872 3300048916 Bacteria 1798
419 Ga0496113_0409187 3300048916 Bacteria 1089
420 Ga0496115_0010043 3300048918 Bacteria 7055
421 Ga0496115_0028043 3300048918 Bacteria 4410
422 Ga0496121_0132121 3300048924 Bacteria 1866
423 Ga0501291_002053 3300049514 Bacteria 2379
424 Ga0501292_001594 3300049515 Bacteria 2814
425 Ga0501296_005532 3300049519 Bacteria 1413
426 Ga0501042_0011806 3300049578 Bacteria 5902
427 Ga0501069_0192677 3300049585 Bacteria 1180
428 Ga0501072_0071672 3300049588 Bacteria 2738
429 Ga0501076_0070966 3300049592 Bacteria 2786
430 Ga0501077_0098816 3300049593 Bacteria 1850
431 Ga0501198_009178 3300049649 Bacteria 1447
432 Ga0501223_025791 3300049663 Bacteria 1144
433 Ga0501233_023054 3300049668 Bacteria 1350
434 Ga0501079_0550900 3300049741 Bacteria 907
435 Ga0501081_0069429 3300049743 Bacteria 2455
436 Ga0501083_0087031 3300049744 Bacteria 2066
437 Ga0501273_013949 3300049770 Bacteria 1030
438 Ga0501204_008514 3300049850 Bacteria 1173
439 nmdc:mga05p37_108530_c1 3300050507 Bacteria 3414
440 nmdc:mga05p37_1657_c2 3300050507 Bacteria 25223
441 nmdc:mga05p37_22353_c1 3300050507 Bacteria 7672
442 nmdc:mga05p37_259247_c1 3300050507 Bacteria 2082
443 nmdc:mga05p37_360300_c1 3300050507 Bacteria 1710
444 nmdc:mga05p37_367_c1 3300050507 Bacteria 48570
445 nmdc:mga05p37_384588_c1 3300050507 Bacteria 1643
446 nmdc:mga05p37_483163_c1 3300050507 Bacteria 1426
447 nmdc:mga05p37_80666_c2 3300050507 Bacteria 3553
448 nmdc:mga05p37_89479_c1 3300050507 Bacteria 3794
449 nmdc:mga09592_20081_c1 3300050508 Bacteria 5490
450 nmdc:mga0qj67_25109_c1 3300050509 Bacteria 4601
451 nmdc:mga0qj67_84405_c1 3300050509 Bacteria 2547
452 nmdc:mga06r32_350032_c1 3300050510 Bacteria 1462
453 nmdc:mga08y16_130326_c1 3300050511 Bacteria 2616
454 nmdc:mga08y16_24824_c1 3300050511 Bacteria 6324
455 nmdc:mga08y16_51774_c1 3300050511 Bacteria 4296
456 nmdc:mga08y16_606_c1 3300050511 Bacteria 33436
457 nmdc:mga0n895_116811_c1 3300050512 Bacteria 2687
458 nmdc:mga0n895_19269_c1 3300050512 Bacteria 6337
459 nmdc:mga0n895_198485_c1 3300050512 Bacteria 2038
460 nmdc:mga0n895_3510_c1 3300050512 Bacteria 12666
461 nmdc:mga0n895_388030_c1 3300050512 Bacteria 1413
462 nmdc:mga0n895_57714_c1 3300050512 Bacteria 3827
463 nmdc:mga0rr50_183250_c1 3300050513 Bacteria 1713
464 nmdc:mga08x19_102189_c1 3300050514 Bacteria 1903
465 nmdc:mga0a205_11639_c1 3300050515 Bacteria 8110
466 nmdc:mga0a205_11860_c1 3300050515 Bacteria 8043
467 nmdc:mga0a205_120643_c1 3300050515 Bacteria 2521
468 nmdc:mga0a205_176829_c1 3300050515 Bacteria 2030
469 nmdc:mga0a205_26934_c1 3300050515 Bacteria 5487
470 Ga0495601_0059943 3300053077 Bacteria 2414
471 Ga0495601_0080178 3300053077 Bacteria 2094
472 Ga0495612_0000178 3300053078 Bacteria 26879
473 Ga0495595_0000871 3300053084 Bacteria 11574
474 Ga0495619_0000480 3300053085 Bacteria 26747
475 Ga0495619_0033430 3300053085 Bacteria 3340
476 Ga0495619_0135519 3300053085 Bacteria 1694
477 Ga0500588_0003849 3300053146 Bacteria 3207
478 Ga0500661_010510 3300055283 Bacteria 1685
479 Ga0530510_0112326 3300061734 Bacteria 1996
480 Ga0530510_0158319 3300061734 Bacteria 1674
481 2643806404 2643221557 Bacteria 7184309
482 2644067301 2643221610 Bacteria 7480339
483 2644380072 2643221668 Bacteria 7306521
484 2644418389 2643221675 Bacteria 7473456
485 2644451756 2643221680 Bacteria 7473610
486 2644687183 2643221726 Bacteria 7455827
487 2881930566 2881927736 Bacteria 3993927
488 Ga0070717_10118559
489 SwRhRL2b_contig_978117
490 JGI24751J29686_10000232
491 Ga0065704_10000988
492 Ga0065707_10088817
493 Ga0070683_100226222
494 Ga0070670_100000095
495 Ga0070670_100029510
496 Ga0070670_100029824
497 Ga0070666_10102556
498 Ga0068868_100003217
499 Ga0068868_100206487
500 Ga0070660_100444608
501 Ga0070689_100000144
502 Ga0070661_100163499
503 Ga0070669_100009031
504 Ga0070675_100417889
505 Ga0070671_100041948
506 Ga0070673_100199926
507 Ga0070673_100542347
508 Ga0070667_100456813
509 Ga0070709_10421361
510 Ga0070714_100006677
511 Ga0070714_100680855
512 Ga0070713_100003075
513 Ga0070713_100029355
514 Ga0070710_10206953
515 Ga0070711_100242535
516 Ga0070711_100253281
517 Ga0070700_100000347
518 Ga0070694_100000183
519 Ga0070694_100002798
520 Ga0070694_100004409
521 Ga0070708_100029805
522 Ga0070708_100054682
523 Ga0070678_100010898
524 Ga0070678_100102649
525 Ga0070678_100522025
526 Ga0070662_100053242
527 Ga0070681_10069312
528 Ga0070681_10108383
529 Ga0068867_100011860
530 Ga0070685_10000187
531 Ga0070706_100038767
532 Ga0070706_100140403
533 Ga0070706_100255612
534 Ga0070707_100041064
535 Ga0070707_100171293
536 Ga0070707_100187188
537 Ga0070698_100002203
538 Ga0070698_100012121
539 Ga0070698_100080856
540 Ga0070699_100009477
541 Ga0070699_100025173
542 Ga0070699_100072473
543 Ga0070679_100020736
544 Ga0070679_100315202
545 Ga0070684_100038112
546 Ga0070684_100038840
547 Ga0070697_100137230
548 Ga0070697_100251145
549 Ga0068853_100001592
550 Ga0068853_100003991
551 Ga0070693_100070911
552 Ga0070665_100003785
553 Ga0070665_100226023
554 Ga0068855_100001685
555 Ga0068855_100350988
556 Ga0068855_100397094
557 Ga0068855_100706240
558 Ga0070664_100005027
559 Ga0068857_100008470
560 Ga0068854_100006932
561 Ga0068856_100007631
562 Ga0068856_100021404
563 Ga0068852_100352152
564 Ga0068859_100000760
565 Ga0068859_100005861
566 Ga0068859_100013026
567 Ga0068859_100025196
568 Ga0068859_100115877
569 Ga0068864_100003760
570 Ga0068864_100007088
571 Ga0068864_100062038
572 Ga0068864_100124061
573 Ga0068870_10038984
574 Ga0068863_100020727
575 Ga0068863_100021542
576 Ga0068863_100105362
577 Ga0068863_100557312
578 Ga0068863_100606723
579 Ga0068858_100000119
580 Ga0068858_100003772
581 Ga0068858_100178208
582 Ga0068858_100529865
583 Ga0068860_100424864
584 Ga0068860_100739790
585 Ga0081455_10033603
586 Ga0081540_1019451
587 Ga0081540_1029470
588 Ga0081539_10059606
589 Ga0070717_10002379
590 Ga0070717_10003063
591 Ga0070717_10047494
592 Ga0070717_10214618
593 Ga0070717_10445427
594 Ga0070716_100003395
595 Ga0070716_100395074
596 Ga0070712_100011533
597 Ga0070712_100049950
598 Ga0070712_100146438
599 Ga0097621_100016256
600 Ga0097621_100155163
601 Ga0068871_100045304
602 Ga0068871_100053573
603 Ga0068871_100157274
604 Ga0068871_100189282
605 Ga0068871_100359870
606 Ga0075428_100127675
607 Ga0075428_100207533
608 Ga0075428_100408622
609 Ga0075430_100069328
610 Ga0075430_100075049
611 Ga0075431_100006859
612 Ga0075431_100037220
613 Ga0075431_100059999
614 Ga0075431_100146248
615 Ga0075433_10026054
616 Ga0075433_10036241
617 Ga0075433_10060584
618 Ga0075433_10071724
619 Ga0075433_10147220
620 Ga0075434_100005931
621 Ga0075434_100007913
622 Ga0075434_100030073
623 Ga0075434_100041130
624 Ga0075434_100120973
625 Ga0075436_100106416
626 Ga0097620_100000760
627 Ga0097620_100005861
628 Ga0097620_100013026
629 Ga0097620_100025198
630 Ga0097620_100115873
631 Ga0075435_100028124
632 Ga0099794_10010520
633 Ga0099794_10014406
634 Ga0099795_10054266
635 Ga0105240_10002229
636 Ga0105240_10004497
637 Ga0105240_10011651
638 Ga0105240_10169728
639 Ga0105240_10179370
640 Ga0111539_10026232
641 Ga0111539_10056110
642 Ga0111539_10099525
643 Ga0105245_10000480
644 Ga0114129_10002308
645 Ga0114129_10028183
646 Ga0114129_10036666
647 Ga0114129_10073693
648 Ga0114129_10189048
649 Ga0114129_10251407
650 Ga0114129_10787828
651 Ga0105242_10016393
652 Ga0105248_10033043
653 Ga0105248_10033433
654 Ga0105248_10241759
655 Ga0105237_10007099
656 Ga0105237_10010305
657 Ga0105237_10026668
658 Ga0123341_1030190
659 Ga0105239_10004563
660 Ga0105239_10009143
661 Ga0105239_10155556
662 Ga0105239_10542517
663 Ga0157373_10084933
664 Ga0157373_10181680
665 Ga0157371_10026889
666 Ga0157369_10002504
667 Ga0157369_10038999
668 Ga0157378_10000082
669 Ga0157378_10108159
670 Ga0157378_10659827
671 Ga0157372_10000145
672 Ga0157372_10136517
673 Ga0157372_10226866
674 Ga0157375_10009311
675 Ga0157375_10087131
676 Ga0157375_10484583
677 Ga0163163_10000026
678 Ga0163163_10001466
679 Ga0163163_10184830
680 Ga0163163_10258607
681 Ga0157379_10021993
682 Ga0157376_10031630
683 Ga0213874_10004358
684 Ga0213875_10000006
685 Ga0213875_10000780
686 Ga0228598_1015944
687 Ga0209256_1000509
688 Ga0207680_10028301
689 Ga0207680_10036514
690 Ga0207680_10086878
691 Ga0207699_10137825
692 Ga0207645_10081413
693 Ga0207643_10075568
694 Ga0207684_10000011
695 Ga0207684_10015963
696 Ga0207684_10033784
697 Ga0207684_10370646
698 Ga0207707_10155242
699 Ga0207695_10021714
700 Ga0207695_10023959
701 Ga0207695_10049119
702 Ga0207695_10085693
703 Ga0207695_10112174
704 Ga0207671_10100807
705 Ga0207671_10130503
706 Ga0207671_10161619
707 Ga0207693_10294506
708 Ga0207663_10233374
709 Ga0207662_10136800
710 Ga0207649_10131609
711 Ga0207649_10230834
712 Ga0207652_10029488
713 Ga0207652_10579683
714 Ga0207646_10013421
715 Ga0207646_10036806
716 Ga0207646_10056474
717 Ga0207646_10131669
718 Ga0207681_10003666
719 Ga0207694_10000025
720 Ga0207694_10103944
721 Ga0207694_10120695
722 Ga0207694_10316333
723 Ga0207650_10000006
724 Ga0207650_10047444
725 Ga0207650_10081509
726 Ga0207659_10200177
727 Ga0207659_10468964
728 Ga0207700_10024298
729 Ga0207700_10026494
730 Ga0207700_10217046
731 Ga0207700_10240332
732 Ga0207664_10214034
733 Ga0207664_10331093
734 Ga0207644_10233972
735 Ga0207690_10233166
736 Ga0207706_10001232
737 Ga0207706_10509644
738 Ga0207704_10632444
739 Ga0207665_10117377
740 Ga0207711_10025933
741 Ga0207711_10179848
742 Ga0207711_10451127
743 Ga0207689_10069598
744 Ga0207661_10207342
745 Ga0207661_10267597
746 Ga0207679_10277741
747 Ga0207667_10005250
748 Ga0207667_10390891
749 Ga0207651_10249151
750 Ga0207712_10062526
751 Ga0207668_10551761
752 Ga0207640_10042164
753 Ga0207640_10175140
754 Ga0207658_10349028
755 Ga0207677_10007160
756 Ga0207677_10031992
757 Ga0207703_10150073
758 Ga0207703_10397545
759 Ga0207639_10064927
760 Ga0207639_10086983
761 Ga0207678_10588789
762 Ga0207708_10000790
763 Ga0207702_10008981
764 Ga0207702_10010781
765 Ga0207641_10005281
766 Ga0207641_10090108
767 Ga0207641_10141230
768 Ga0207641_10399447
769 Ga0207648_10058375
770 Ga0207648_10260967
771 Ga0207676_10024673
772 Ga0207676_10035777
773 Ga0207676_10089516
774 Ga0207676_10463923
775 Ga0207674_10000116
776 Ga0207674_10285461
777 Ga0207675_100265037
778 Ga0207683_10004371
779 Ga0207683_10051407
780 Ga0207683_10209248
781 Ga0209588_1012506
782 Ga0207428_10002076
783 Ga0207428_10010910
784 Ga0207428_10024861
785 Ga0265356_1000255
786 Ga0265356_1001816
787 Ga0265357_1000221
788 Ga0265355_1002622
789 Ga0268266_10013773
790 Ga0268266_10216311
791 Ga0268264_10184111
792 Ga0268264_10423674
793 Ga0268264_10857788
794 Ga0265338_10085371
795 Ga0265338_10120247
796 Ga0307511_10002375
797 Ga0265760_10000164
798 Ga0265332_10032877
799 Ga0265328_10022814
800 Ga0265325_10043233
801 Ga0265329_10063611
802 Ga0265340_10026548
803 Ga0265331_10014878
804 Ga0265316_10094173
805 Ga0265316_10144131
806 Ga0307508_10000090
807 Ga0265342_10008073
808 Ga0307516_10007751
809 Ga0307410_10010263
810 Ga0307406_10004134
811 Ga0307412_10010658
812 Ga0307414_10025149
813 Ga0307414_10132243
814 Ga0307414_10207091
815 Ga0307411_10007970
816 Ga0307411_10114043
817 Ga0373934_0077158
818 Ga0373953_0097777
819 Ga0373954_0023627
820 Ga0373956_0033478
821 Ga0373946_0043658
822 Ga0373946_0044941
823 Ga0373955_0059208
824 Ga0373931_0046565
825 Ga0373935_0050929
826 Ga0373927_0032220
827 Ga0373933_0003210
828 Ga0373947_0191867
829 Ga0373937_0001938
830 Ga0373937_0055403
831 Ga0373937_0064160
832 Ga0373937_0177263
833 Ga0373925_0004756
834 Ga0373925_0019928
835 Ga0373925_0022804
836 Ga0373925_0233464
837 Ga0395898_0021580
838 Ga0395905_0082564
839 Ga0436364_0202263
840 Ga0436364_0365978
841 Ga0436364_0478514
842 Ga0436364_1149767
843 Ga0436364_1168799
844 Ga0395901_0138918
845 Ga0395901_0447372
846 Ga0436365_1401176
847 Ga0436363_0994885
848 Ga0439448_0007196
849 Ga0439458_0002177
850 Ga0439435_0051171
851 Ga0453683_0246781
852 Ga0453684_0072169
853 Ga0466958_0044298
854 Ga0466967_0092885
855 Ga0495627_000319
856 Ga0495592_0003757
857 Ga0495629_0004595
858 Ga0495629_0055604
859 Ga0495651_0000210
860 Ga0495651_0142328
861 Ga0495653_0000528
862 Ga0495580_0003064
863 Ga0495580_0015841
864 Ga0495582_0057574
865 Ga0495639_0088672
866 Ga0495608_0002460
867 Ga0495618_0042365
868 Ga0495618_0101965
869 Ga0495628_0330458
870 Ga0495630_0182445
871 Ga0495648_0089999
872 Ga0495640_0043699
873 Ga0495587_0000572
874 Ga0495645_0039263
875 Ga0495645_0183473
876 Ga0495667_0004282
877 Ga0495635_0007676
878 Ga0495599_0040938
879 Ga0495623_0004968
880 Ga0495658_0009332
881 Ga0495669_0147974
882 Ga0495613_0104114
883 Ga0495589_0015883
884 Ga0495600_0001587
885 Ga0495600_0342845
886 Ga0495604_0000186
887 Ga0495604_0176901
888 Ga0495636_0068511
889 Ga0495674_0011729
890 Ga0495674_0206843
891 Ga0495680_0000924
892 Ga0495675_0008418
893 Ga0495677_0062040
894 Ga0495673_0000102
895 Ga0495684_0024616
896 Ga0495602_0236779
897 Ga0495602_0296486
898 Ga0496104_0682824
899 Ga0496109_0004341
900 Ga0496109_0020224
901 Ga0496111_0223499
902 Ga0496112_0014389
903 Ga0496112_0039226
904 Ga0496112_0289784
905 Ga0496113_0156872
906 Ga0496113_0409187
907 Ga0496115_0010043
908 Ga0496115_0028043
909 Ga0496121_0132121
910 Ga0501291_002053
911 Ga0501292_001594
912 Ga0501296_005532
913 Ga0501042_0011806
914 Ga0501069_0192677
915 Ga0501072_0071672
916 Ga0501076_0070966
917 Ga0501077_0098816
918 Ga0501198_009178
919 Ga0501223_025791
920 Ga0501233_023054
921 Ga0501079_0550900
922 Ga0501081_0069429
923 Ga0501083_0087031
924 Ga0501273_013949
925 Ga0501204_008514
926 nmdc:mga05p37_108530_c1
927 nmdc:mga05p37_1657_c2
928 nmdc:mga05p37_22353_c1
929 nmdc:mga05p37_259247_c1
930 nmdc:mga05p37_360300_c1
931 nmdc:mga05p37_367_c1
932 nmdc:mga05p37_384588_c1
933 nmdc:mga05p37_483163_c1
934 nmdc:mga05p37_80666_c2
935 nmdc:mga05p37_89479_c1
936 nmdc:mga09592_20081_c1
937 nmdc:mga0qj67_25109_c1
938 nmdc:mga0qj67_84405_c1
939 nmdc:mga06r32_350032_c1
940 nmdc:mga08y16_130326_c1
941 nmdc:mga08y16_24824_c1
942 nmdc:mga08y16_51774_c1
943 nmdc:mga08y16_606_c1
944 nmdc:mga0n895_116811_c1
945 nmdc:mga0n895_19269_c1
946 nmdc:mga0n895_198485_c1
947 nmdc:mga0n895_3510_c1
948 nmdc:mga0n895_388030_c1
949 nmdc:mga0n895_57714_c1
950 nmdc:mga0rr50_183250_c1
951 nmdc:mga08x19_102189_c1
952 nmdc:mga0a205_11639_c1
953 nmdc:mga0a205_11860_c1
954 nmdc:mga0a205_120643_c1
955 nmdc:mga0a205_176829_c1
956 nmdc:mga0a205_26934_c1
957 Ga0495601_0059943
958 Ga0495601_0080178
959 Ga0495612_0000178
960 Ga0495595_0000871
961 Ga0495619_0000480
962 Ga0495619_0033430
963 Ga0495619_0135519
964 Ga0500588_0003849
965 Ga0500661_010510
966 Ga0530510_0112326
967 Ga0530510_0158319
968 2643806404
969 2644067301
970 2644380072
971 2644418389
972 2644451756
973 2644687183
974 2881930566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

22

239

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cv4-assembly1.cif.gz_B crystal structure of an archaeal peroxiredoxin from the aerobic hyperthermophilic crenarchaeon aeropyrum pernix k1 0.6431 54 191
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.6412 54 205
4yod-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein (baccac_02376) from bacteroides caccae atcc 43185 at 1.90 a resolution 0.6383 61 173
5c5k-assembly2.cif.gz_D structure of the pfr form of a canonical phytochrome 0.6379 165 182
2lrn-assembly1.cif.gz_A solution structure of a thiol:disulfide interchange protein from bacteroides sp. 0.6372 58 190
ID Description Score Start End Superfamily
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6825 61 185 3.40.30.10
af_O94561_50_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6331 59 173 3.40.30.10
af_A4I174_5_200_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6318 116 146 3.40.50.1000
af_Q9VGV0_159_276_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6279 75 200 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6235 61 185 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.8597 65 180
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.8399 65 180
AF-A0A439UPE5-F1-model_v4 DUF899 domain-containing protein 0.8348 72 156
AF-A0A7V8YKR5-F1-model_v4 DUF899 family protein 0.8347 57 183
AF-A0A845HT60-F1-model_v4 DUF899 domain-containing protein 0.8084 42 183

Map