metagRoot

F453070

General Info

Members	Datasets	Scaffolds	Average Seq Length
485	289	471	220

Family's Representative Sequence

Representative Sequence	3300005841\|Ga0068863_101092862\|Ga0068863_1010928621
Length	215
Sequence	MPDPDPNDLLARNRAWAARIKSEEPGFFEELARAQSPQYLWIGCADSRVPANEILGLIPGEIFVHRNVANVVVHTDLNCLSVLQFAVDLLKVKHVLVVGHYGCAGVAAALLNRRLGLVDNWLRHIQDIRLKHAVYLEAQPEEKRAERLVELNVIEQVVNVCQTTIVQDAWERGQDLTVHGWTYALQDGLMRDLKMSVVSNTELTRCYQSALENLP

Samples

	Sample ID	Description	Type	Environment
1	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
2	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
3	2643221603	Noviherbaspirillum sp. Root189	Isolate	Unclassified
4	2643221645	Massilia sp. Root351	Isolate	Unclassified
5	2643221664	Massilia sp. Root418	Isolate	Unclassified
6	2738541280	Massilia sp. GV090	Isolate	Unclassified
7	2738541300	Massilia sp. GV016	Isolate	Unclassified
8	2738543018	Massilia sp. GV045	Isolate	Unclassified
9	2738543030	Massilia sp. GV097	Isolate	Unclassified
10	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
11	2858688981	Cupriavidus sp. UYMMa02A	Isolate	Unclassified
12	3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
13	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
14	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
15	3300003544	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
16	3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
17	3300003575	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
18	3300003577	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
19	3300003611	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
20	3300003693	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
21	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
22	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
23	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
24	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
25	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
26	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
27	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
28	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
29	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
30	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
31	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
32	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
33	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
34	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
35	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
36	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
37	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
38	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
39	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
40	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
41	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
42	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
45	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
46	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
47	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
48	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
49	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
50	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
51	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
52	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
53	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
54	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
55	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
56	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
57	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
58	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
59	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
60	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
61	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
62	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
63	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
64	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
65	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
66	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
67	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
68	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
69	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
70	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
71	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
72	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
73	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
74	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
75	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
76	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
82	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
85	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
86	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
88	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
89	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
95	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
98	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
99	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
100	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
101	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
102	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
103	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
104	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
105	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
106	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
107	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
108	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
109	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
111	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
112	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
114	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
116	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
158	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
162	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
163	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
164	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
165	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
166	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
167	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
168	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
169	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
170	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
171	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
172	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
173	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
174	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
175	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
176	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
177	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
178	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
179	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
180	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
181	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
182	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
183	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
184	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
185	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
186	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
187	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
188	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
189	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
190	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
191	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
192	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
193	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
194	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
195	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
196	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
197	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
198	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
199	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
200	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
201	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
202	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
203	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
204	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
205	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
206	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
207	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
208	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
209	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
210	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
211	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
212	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
213	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
214	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
215	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
216	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
217	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
218	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
219	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
220	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
221	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
222	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
223	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
224	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
225	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
226	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
227	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
228	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
229	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
230	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
231	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
232	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
233	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
234	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
235	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
236	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
237	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
238	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
239	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
240	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
241	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
242	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
243	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
244	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
245	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
246	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
247	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
248	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
249	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
250	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
251	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
252	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
253	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
254	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
255	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
258	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
262	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
263	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
265	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
266	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
269	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
270	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
271	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
272	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
273	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
274	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
275	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
276	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
277	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
278	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
279	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
280	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
281	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
282	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
283	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
284	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
285	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
286	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
287	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
288	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
289	8055225921	Achromobacter panacis KCTC 42751	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.46
Metatranscriptomes	1.65
Isolates	2.89

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.74
Nodule	1.03
Rhizoplane	1.86
Rhizosphere	88.04
Stem	0
Stem Tuber	0
Unclassified	4.33

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0006759J45824_1087121	3300003163	Bacteria	898
2	JGI25151J46595_10003398	3300003187	Bacteria	8810
3	JGI25151J46595_10028396	3300003187	Bacteria	2229
4	rootL2_10067533	3300003322	Bacteria	2927
5	Ga0007417J51691_1021079	3300003544	Bacteria	1024
6	Ga0007410J51695_1038954	3300003574	Bacteria	1101
7	Ga0007409J51694_1014616	3300003575	Bacteria	1208
8	Ga0007416J51690_1011811	3300003577	Bacteria	1460
9	Ga0007411J51799_111718	3300003611	Bacteria	802
10	Ga0032354_1010298	3300003693	Bacteria	1213
11	Ga0055537_1003050	3300003773	Bacteria	5286
12	Ga0055524_1000629	3300003775	Bacteria	25247
13	Ga0055536_1000324	3300003781	Bacteria	35248
14	Ga0055534_1001753	3300003784	Bacteria	8178
15	JGI25405J52794_10049490	3300003911	Bacteria	899
16	Ga0065712_10280249	3300005290	Bacteria	897
17	Ga0065715_10242516	3300005293	Bacteria	1194
18	Ga0070658_10001403	3300005327	Bacteria	20571
19	Ga0070676_10471038	3300005328	Bacteria	887
20	Ga0070683_100066700	3300005329	Bacteria	3353
21	Ga0070670_100013450	3300005331	Bacteria	7010
22	Ga0070677_10025556	3300005333	Bacteria	2205
23	Ga0068869_100089543	3300005334	Bacteria	2311
24	Ga0070666_10055423	3300005335	Bacteria	2676
25	Ga0070682_100007448	3300005337	Bacteria	6172
26	Ga0070682_100019929	3300005337	Bacteria	3940
27	Ga0070682_100178434	3300005337	Bacteria	1481
28	Ga0070689_100003825	3300005340	Bacteria	10084
29	Ga0070661_100010090	3300005344	Bacteria	6558
30	Ga0070668_100363050	3300005347	Bacteria	1228
31	Ga0070668_101124958	3300005347	Bacteria	709
32	Ga0070669_100000846	3300005353	Bacteria	22205
33	Ga0070669_100151503	3300005353	Bacteria	1795
34	Ga0070669_100221547	3300005353	Bacteria	1496
35	Ga0070669_100684168	3300005353	Bacteria	865
36	Ga0070675_100128540	3300005354	Bacteria	2157
37	Ga0070675_100140166	3300005354	Bacteria	2066
38	Ga0070675_100603425	3300005354	Bacteria	996
39	Ga0070671_100003846	3300005355	Bacteria	11797
40	Ga0070674_100009526	3300005356	Bacteria	5817
41	Ga0070674_100061009	3300005356	Bacteria	2630
42	Ga0070674_100115224	3300005356	Bacteria	1981
43	Ga0070673_100271358	3300005364	Bacteria	1485
44	Ga0070673_100351244	3300005364	Bacteria	1309
45	Ga0070688_100371500	3300005365	Bacteria	1052
46	Ga0070659_100218878	3300005366	Bacteria	1571
47	Ga0070667_100039333	3300005367	Bacteria	3963
48	Ga0070667_100495394	3300005367	Bacteria	1120
49	Ga0070709_10536761	3300005434	Bacteria	893
50	Ga0070714_100463764	3300005435	Bacteria	1205
51	Ga0070705_100021935	3300005440	Bacteria	3404
52	Ga0070700_100248436	3300005441	Bacteria	1275
53	Ga0070694_100120594	3300005444	Bacteria	1881
54	Ga0070663_100202372	3300005455	Bacteria	1550
55	Ga0070663_100385317	3300005455	Bacteria	1143
56	Ga0070678_100039466	3300005456	Bacteria	3331
57	Ga0070678_100053036	3300005456	Bacteria	2947
58	Ga0070678_100395552	3300005456	Bacteria	1199
59	Ga0070662_100339887	3300005457	Bacteria	1228
60	Ga0070662_100343334	3300005457	Bacteria	1222
61	Ga0070662_100751038	3300005457	Bacteria	827
62	Ga0068867_100032821	3300005459	Bacteria	3756
63	Ga0068867_100089988	3300005459	Bacteria	2328
64	Ga0068867_100129812	3300005459	Bacteria	1957
65	Ga0070684_100639655	3300005535	Bacteria	990
66	Ga0068853_100300343	3300005539	Bacteria	1484
67	Ga0070672_100010864	3300005543	Bacteria	6332
68	Ga0070672_100160410	3300005543	Bacteria	1865
69	Ga0070672_100524526	3300005543	Bacteria	1026
70	Ga0070686_100141416	3300005544	Bacteria	1676
71	Ga0070695_100131378	3300005545	Bacteria	1726
72	Ga0070695_100372092	3300005545	Bacteria	1076
73	Ga0070693_100252218	3300005547	Bacteria	1170
74	Ga0070665_100007562	3300005548	Bacteria	11045
75	Ga0070665_100031299	3300005548	Bacteria	5355
76	Ga0070665_100182760	3300005548	Bacteria	2097
77	Ga0070665_100306347	3300005548	Bacteria	1592
78	Ga0070665_100425269	3300005548	Bacteria	1337
79	Ga0070665_100545975	3300005548	Bacteria	1171
80	Ga0070664_100007750	3300005564	Bacteria	8669
81	Ga0070664_100107464	3300005564	Bacteria	2433
82	Ga0070664_100251308	3300005564	Bacteria	1589
83	Ga0068857_100309528	3300005577	Bacteria	1457
84	Ga0068854_100393277	3300005578	Bacteria	1145
85	Ga0068852_100023289	3300005616	Bacteria	4982
86	Ga0068852_100673774	3300005616	Bacteria	1043
87	Ga0068859_100018585	3300005617	Bacteria	6988
88	Ga0068859_100063637	3300005617	Bacteria	3720
89	Ga0068859_100185140	3300005617	Bacteria	2166
90	Ga0068859_100809875	3300005617	Bacteria	1024
91	Ga0068864_100090085	3300005618	Bacteria	2704
92	Ga0068864_100459358	3300005618	Bacteria	1219
93	Ga0068861_100003428	3300005719	Bacteria	10524
94	Ga0068861_100028203	3300005719	Bacteria	4096
95	Ga0068861_100077136	3300005719	Bacteria	2598
96	Ga0068861_100154437	3300005719	Bacteria	1886
97	Ga0068861_100459566	3300005719	Bacteria	1142
98	Ga0068861_100742697	3300005719	Bacteria	916
99	Ga0068851_10016592	3300005834	Bacteria	3526
100	Ga0068863_100449569	3300005841	Bacteria	1264
101	Ga0068863_101092862	3300005841	Bacteria	802
102	Ga0068858_100063412	3300005842	Bacteria	3420
103	Ga0068860_101059722	3300005843	Bacteria	829
104	Ga0068862_100041341	3300005844	Bacteria	3921
105	Ga0068862_100116490	3300005844	Bacteria	2350
106	Ga0068862_100216066	3300005844	Bacteria	1734
107	Ga0068862_100267076	3300005844	Unclassified	1564
108	Ga0081455_10004105	3300005937	Bacteria	16479
109	Ga0070712_100009789	3300006175	Bacteria	6039
110	Ga0097621_100041214	3300006237	Bacteria	3716
111	Ga0097621_100098034	3300006237	Bacteria	2462
112	Ga0097621_100129672	3300006237	Bacteria	2145
113	Ga0068871_100115148	3300006358	Bacteria	2266
114	Ga0068871_100125803	3300006358	Bacteria	2169
115	Ga0068871_100235313	3300006358	Bacteria	1591
116	Ga0068871_100408909	3300006358	Bacteria	1210
117	Ga0068871_100545482	3300006358	Bacteria	1050
118	Ga0075428_100317960	3300006844	Bacteria	1673
119	Ga0075428_100679995	3300006844	Bacteria	1097
120	Ga0075430_100082854	3300006846	Unclassified	2688
121	Ga0075430_100412350	3300006846	Bacteria	1115
122	Ga0075431_100200842	3300006847	Bacteria	2040
123	Ga0068865_100117522	3300006881	Bacteria	1971
124	Ga0068865_100370581	3300006881	Bacteria	1165
125	Ga0068865_100873162	3300006881	Bacteria	781
126	Ga0097620_100018585	3300006931	Bacteria	6988
127	Ga0097620_100063637	3300006931	Bacteria	3720
128	Ga0097620_100185132	3300006931	Bacteria	2166
129	Ga0097620_100809774	3300006931	Bacteria	1024
130	Ga0099826_10000007	3300006948	Bacteria	393518
131	Ga0105251_10030584	3300009011	Bacteria	2702
132	Ga0111539_10251426	3300009094	Bacteria	2058
133	Ga0105245_10161711	3300009098	Bacteria	2125
134	Ga0105247_10477165	3300009101	Unclassified	904
135	Ga0114129_11445614	3300009147	Bacteria	847
136	Ga0105243_10041073	3300009148	Bacteria	3617
137	Ga0105243_10525084	3300009148	Bacteria	1126
138	Ga0105242_10060214	3300009176	Bacteria	3118
139	Ga0105248_10251911	3300009177	Bacteria	1987
140	Ga0105248_10748404	3300009177	Bacteria	1103
141	Ga0105248_11098741	3300009177	Bacteria	899
142	Ga0105237_10006330	3300009545	Bacteria	13156
143	Ga0105237_10242854	3300009545	Bacteria	1802
144	Ga0105238_10459045	3300009551	Bacteria	1271
145	Ga0105249_10593450	3300009553	Bacteria	1162
146	Ga0105249_10779368	3300009553	Bacteria	1019
147	Ga0105239_10094466	3300010375	Bacteria	3303
148	Ga0157369_10446181	3300013105	Bacteria	1340
149	Ga0157374_10128725	3300013296	Bacteria	2449
150	Ga0157374_10193293	3300013296	Bacteria	1990
151	Ga0157374_10732385	3300013296	Bacteria	1003
152	Ga0157378_10315068	3300013297	Bacteria	1518
153	Ga0163162_10611216	3300013306	Bacteria	1216
154	Ga0157372_10236499	3300013307	Bacteria	2119
155	Ga0157375_10011098	3300013308	Bacteria	7944
156	Ga0157375_10061692	3300013308	Bacteria	3723
157	Ga0157375_10073615	3300013308	Bacteria	3436
158	Ga0157375_10161396	3300013308	Bacteria	2383
159	Ga0157375_10278146	3300013308	Bacteria	1837
160	Ga0157375_10647674	3300013308	Bacteria	1213
161	Ga0163163_10091864	3300014325	Bacteria	3050
162	Ga0163163_11272761	3300014325	Bacteria	798
163	Ga0157380_10119502	3300014326	Bacteria	2229
164	Ga0157380_10174113	3300014326	Bacteria	1884
165	Ga0157380_10334069	3300014326	Bacteria	1410
166	Ga0157376_10112504	3300014969	Bacteria	2399
167	Ga0157376_10147153	3300014969	Bacteria	2120
168	Ga0182007_10040408	3300015262	Bacteria	1558
169	Ga0163161_10164163	3300017792	Bacteria	1695
170	Ga0213872_10000063	3300021361	Bacteria	97755
171	Ga0209565_1000106	3300025263	Bacteria	122574
172	Ga0209565_1009493	3300025263	Bacteria	2466
173	Ga0209675_1000168	3300025291	Bacteria	79360
174	Ga0209675_1001444	3300025291	Bacteria	13729
175	Ga0209675_1017926	3300025291	Bacteria	2000
176	Ga0209676_1000036	3300025292	Bacteria	457623
177	Ga0209025_1000462	3300025294	Bacteria	79379
178	Ga0209025_1001905	3300025294	Bacteria	24311
179	Ga0209025_1002261	3300025294	Bacteria	21104
180	Ga0209564_1000573	3300025295	Bacteria	58351
181	Ga0209564_1000957	3300025295	Bacteria	36712
182	Ga0209564_1001001	3300025295	Bacteria	35190
183	Ga0209758_1033047	3300025297	Bacteria	2086
184	Ga0209256_1000220	3300025299	Bacteria	106021
185	Ga0209256_1000554	3300025299	Bacteria	53681
186	Ga0209051_1017060	3300025303	Bacteria	3257
187	Ga0209051_1018808	3300025303	Bacteria	3041
188	Ga0207682_10002327	3300025893	Bacteria	8564
189	Ga0207682_10137094	3300025893	Bacteria	1096
190	Ga0207710_10309172	3300025900	Bacteria	800
191	Ga0207680_10007444	3300025903	Bacteria	5337
192	Ga0207699_10466428	3300025906	Bacteria	908
193	Ga0207643_10074191	3300025908	Bacteria	1962
194	Ga0207705_10021526	3300025909	Bacteria	4602
195	Ga0207671_10009133	3300025914	Bacteria	8322
196	Ga0207671_10208138	3300025914	Bacteria	1529
197	Ga0207693_10021314	3300025915	Bacteria	5150
198	Ga0207662_10103113	3300025918	Bacteria	1770
199	Ga0207657_10016101	3300025919	Bacteria	7218
200	Ga0207657_10722079	3300025919	Bacteria	773
201	Ga0207681_10095140	3300025923	Bacteria	2136
202	Ga0207681_10539010	3300025923	Bacteria	959
203	Ga0207650_10008345	3300025925	Bacteria	7072
204	Ga0207650_10028981	3300025925	Bacteria	3975
205	Ga0207650_10081203	3300025925	Bacteria	2459
206	Ga0207650_10258106	3300025925	Bacteria	1413
207	Ga0207650_10317100	3300025925	Bacteria	1276
208	Ga0207650_10783368	3300025925	Bacteria	808
209	Ga0207659_10119129	3300025926	Bacteria	2020
210	Ga0207659_10332780	3300025926	Bacteria	1256
211	Ga0207687_10201388	3300025927	Bacteria	1556
212	Ga0207687_10679387	3300025927	Bacteria	873
213	Ga0207644_10719709	3300025931	Bacteria	833
214	Ga0207690_10077321	3300025932	Bacteria	2313
215	Ga0207706_10096145	3300025933	Bacteria	2605
216	Ga0207706_10382389	3300025933	Bacteria	1221
217	Ga0207706_10546935	3300025933	Bacteria	997
218	Ga0207709_10198992	3300025935	Bacteria	1429
219	Ga0207709_10614358	3300025935	Unclassified	862
220	Ga0207670_10014583	3300025936	Bacteria	4671
221	Ga0207670_10033116	3300025936	Bacteria	3328
222	Ga0207669_10038557	3300025937	Bacteria	2752
223	Ga0207704_10134107	3300025938	Bacteria	1720
224	Ga0207704_10146611	3300025938	Bacteria	1659
225	Ga0207704_10387943	3300025938	Bacteria	1098
226	Ga0207691_10059721	3300025940	Bacteria	3466
227	Ga0207691_10411617	3300025940	Bacteria	1153
228	Ga0207711_10082662	3300025941	Bacteria	2808
229	Ga0207689_10034670	3300025942	Bacteria	4191
230	Ga0207661_10108798	3300025944	Bacteria	2341
231	Ga0207679_10108351	3300025945	Bacteria	2187
232	Ga0207679_10153480	3300025945	Bacteria	1877
233	Ga0207651_10218837	3300025960	Bacteria	1538
234	Ga0207651_10897624	3300025960	Bacteria	789
235	Ga0207712_10359877	3300025961	Bacteria	1212
236	Ga0207640_10282723	3300025981	Bacteria	1304
237	Ga0207640_10401053	3300025981	Bacteria	1117
238	Ga0207658_10027850	3300025986	Bacteria	3975
239	Ga0207703_10059131	3300026035	Bacteria	3131
240	Ga0207703_10071748	3300026035	Bacteria	2861
241	Ga0207703_10253922	3300026035	Bacteria	1586
242	Ga0207678_10198641	3300026067	Bacteria	1714
243	Ga0207678_10293104	3300026067	Bacteria	1398
244	Ga0207708_10102696	3300026075	Bacteria	2214
245	Ga0207708_10165706	3300026075	Bacteria	1747
246	Ga0207708_10189126	3300026075	Bacteria	1638
247	Ga0207708_10477560	3300026075	Bacteria	1042
248	Ga0207702_10229947	3300026078	Bacteria	1732
249	Ga0207641_10052285	3300026088	Bacteria	3459
250	Ga0207641_10080854	3300026088	Bacteria	2820
251	Ga0207641_10553201	3300026088	Bacteria	1122
252	Ga0207648_10034642	3300026089	Bacteria	4450
253	Ga0207648_10071550	3300026089	Bacteria	3022
254	Ga0207648_10548768	3300026089	Bacteria	1061
255	Ga0207676_10058089	3300026095	Bacteria	3050
256	Ga0207676_10793297	3300026095	Bacteria	924
257	Ga0207674_10606203	3300026116	Bacteria	1058
258	Ga0207675_100005763	3300026118	Bacteria	11848
259	Ga0207675_100130609	3300026118	Bacteria	2382
260	Ga0207675_100194476	3300026118	Bacteria	1947
261	Ga0207675_100658658	3300026118	Bacteria	1054
262	Ga0207683_10459393	3300026121	Bacteria	1174
263	Ga0209282_1000061	3300027666	Bacteria	96444
264	Ga0268266_10024376	3300028379	Bacteria	5145
265	Ga0268266_10159486	3300028379	Bacteria	2040
266	Ga0268265_10028239	3300028380	Bacteria	4015
267	Ga0268265_10296454	3300028380	Unclassified	1454
268	Ga0268265_10391009	3300028380	Bacteria	1282
269	Ga0268264_10124100	3300028381	Bacteria	2280
270	Ga0268264_10454475	3300028381	Bacteria	1242
271	Ga0265328_10111453	3300031239	Bacteria	1017
272	Ga0265320_10088526	3300031240	Bacteria	1436
273	Ga0307513_10110864	3300031456	Bacteria	2738
274	Ga0307513_10470176	3300031456	Bacteria	979
275	Ga0307408_100050296	3300031548	Bacteria	2997
276	Ga0265314_10046650	3300031711	Bacteria	3055
277	Ga0307405_10339946	3300031731	Bacteria	1154
278	Ga0307406_10007898	3300031901	Bacteria	5925
279	Ga0307407_10182544	3300031903	Bacteria	1392
280	Ga0307409_100021207	3300031995	Bacteria	4449
281	Ga0307409_100214491	3300031995	Bacteria	1733
282	Ga0307416_100021110	3300032002	Bacteria	4667
283	Ga0307416_101047861	3300032002	Bacteria	919
284	Ga0307411_10005352	3300032005	Bacteria	6291
285	Ga0307415_100554058	3300032126	Bacteria	1015
286	Ga0316593_10048206	3300032168	Unclassified	1434
287	Ga0373932_0101597	3300035112	Bacteria	936
288	Ga0373943_0320058	3300035170	Bacteria	884
289	Ga0373955_0316235	3300035172	Bacteria	943
290	Ga0373931_0095698	3300035691	Bacteria	1662
291	Ga0373931_0156886	3300035691	Bacteria	1331
292	Ga0373933_0161078	3300035724	Bacteria	1425
293	Ga0373937_0118525	3300036401	Bacteria	2466
294	Ga0373925_0009800	3300037068	Bacteria	6956
295	Ga0373925_0746021	3300037068	Bacteria	807
296	Ga0395899_0003696	3300037312	Bacteria	12107
297	Ga0395899_0020212	3300037312	Bacteria	5052
298	Ga0395900_0001354	3300037418	Bacteria	29502
299	Ga0395900_0159549	3300037418	Bacteria	2301
300	Ga0395900_0711261	3300037418	Bacteria	937
301	Ga0395898_0008292	3300037466	Bacteria	10987
302	Ga0395898_0015300	3300037466	Bacteria	7874
303	Ga0395898_0036893	3300037466	Bacteria	4851
304	Ga0395905_0000137	3300037471	Bacteria	120800
305	Ga0395905_0209465	3300037471	Bacteria	1826
306	Ga0395905_0487015	3300037471	Bacteria	1133
307	Ga0395905_0803130	3300037471	Bacteria	844
308	Ga0395901_0006191	3300038443	Bacteria	12125
309	Ga0395901_0172986	3300038443	Bacteria	2266
310	Ga0436361_0655175	3300039447	Bacteria	3151
311	Ga0436361_0811061	3300039447	Bacteria	135576
312	Ga0451841_0114343	3300041498	Bacteria	1016
313	Ga0451853_1268857	3300041512	Bacteria	1640
314	Ga0439444_0027466	3300042437	Bacteria	1048
315	Ga0466972_0000029	3300044658	Bacteria	165236
316	Ga0453683_0204860	3300044673	Bacteria	1253
317	Ga0466966_0011936	3300044684	Bacteria	5758
318	Ga0466964_0003634	3300044706	Bacteria	5637
319	Ga0453684_0000014	3300044712	Bacteria	993311
320	Ga0453684_0000682	3300044712	Bacteria	121090
321	Ga0453684_0000975	3300044712	Bacteria	94109
322	Ga0453684_0005513	3300044712	Bacteria	24982
323	Ga0453684_1113468	3300044712	Bacteria	833
324	Ga0466959_0080505	3300045049	Bacteria	2348
325	Ga0466959_0495206	3300045049	Bacteria	826
326	Ga0495617_037474	3300046452	Bacteria	1623
327	Ga0495617_096273	3300046452	Bacteria	963
328	Ga0495590_0039794	3300046457	Bacteria	1640
329	Ga0495638_0004277	3300046460	Bacteria	10843
330	Ga0495638_0028011	3300046460	Bacteria	3642
331	Ga0495638_0045273	3300046460	Bacteria	2768
332	Ga0495650_0000519	3300046471	Bacteria	57139
333	Ga0495650_0008211	3300046471	Bacteria	6133
334	Ga0495605_0001123	3300046474	Bacteria	17811
335	Ga0495605_0002642	3300046474	Bacteria	10980
336	Ga0495584_0002965	3300046491	Bacteria	9434
337	Ga0495584_0077713	3300046491	Bacteria	1669
338	Ga0495585_0014959	3300046492	Bacteria	4512
339	Ga0495585_0095971	3300046492	Bacteria	1591
340	Ga0495585_0130420	3300046492	Bacteria	1323
341	Ga0495596_0000577	3300046500	Bacteria	22883
342	Ga0495607_0044134	3300046501	Bacteria	2630
343	Ga0495607_0058357	3300046501	Bacteria	2206
344	Ga0495607_0098771	3300046501	Bacteria	1567
345	Ga0495583_0000004	3300046506	Bacteria	655287
346	Ga0495606_0006173	3300046507	Bacteria	11151
347	Ga0495606_0010926	3300046507	Bacteria	7469
348	Ga0495610_0005593	3300046512	Bacteria	8872
349	Ga0495610_0030322	3300046512	Bacteria	2836
350	Ga0495616_0001603	3300046513	Bacteria	15497
351	Ga0495616_0004162	3300046513	Bacteria	9168
352	Ga0495616_0005090	3300046513	Bacteria	8174
353	Ga0495616_0061734	3300046513	Bacteria	1837
354	Ga0495628_0585146	3300046516	Bacteria	798
355	Ga0495632_0018045	3300046519	Bacteria	3880
356	Ga0495644_0002672	3300046523	Bacteria	7092
357	Ga0495644_0003781	3300046523	Bacteria	5960
358	Ga0495648_0003940	3300046524	Bacteria	12854
359	Ga0495654_0099858	3300046530	Bacteria	1337
360	Ga0495586_0180774	3300046535	Bacteria	1193
361	Ga0495609_0002923	3300046538	Bacteria	10163
362	Ga0495609_0005238	3300046538	Bacteria	6898
363	Ga0495609_0008840	3300046538	Bacteria	4902
364	Ga0495609_0014916	3300046538	Bacteria	3645
365	Ga0495597_0011477	3300046542	Bacteria	4295
366	Ga0495597_0069577	3300046542	Bacteria	1518
367	Ga0495622_0000053	3300046557	Bacteria	102938
368	Ga0495622_0020711	3300046557	Bacteria	3062
369	Ga0495633_0004349	3300046558	Bacteria	9045
370	Ga0495633_0023113	3300046558	Bacteria	3081
371	Ga0495656_0085731	3300046615	Bacteria	1431
372	Ga0495668_0105047	3300046616	Bacteria	1545
373	Ga0495668_0148837	3300046616	Bacteria	1282
374	Ga0495611_0043100	3300046648	Bacteria	2016
375	Ga0495625_0007453	3300046660	Bacteria	9517
376	Ga0495625_0012345	3300046660	Bacteria	6926
377	Ga0495625_0031163	3300046660	Bacteria	3969
378	Ga0495625_0274781	3300046660	Bacteria	1086
379	Ga0495625_0303237	3300046660	Bacteria	1021
380	Ga0495659_0000118	3300046664	Bacteria	34962
381	Ga0495659_0003772	3300046664	Bacteria	4815
382	Ga0495661_0019790	3300046665	Bacteria	4405
383	Ga0495661_0054448	3300046665	Bacteria	2402
384	Ga0495658_0256204	3300046683	Bacteria	1101
385	Ga0495669_0249322	3300046684	Bacteria	853
386	Ga0495670_0003657	3300046691	Bacteria	7558
387	Ga0495670_0003990	3300046691	Bacteria	7240
388	Ga0495671_0001545	3300046692	Bacteria	15327
389	Ga0495671_0006506	3300046692	Bacteria	6746
390	Ga0495671_0025209	3300046692	Bacteria	3092
391	Ga0495649_0125923	3300046694	Bacteria	1353
392	Ga0495649_0206773	3300046694	Bacteria	1018
393	Ga0495589_0032506	3300046794	Bacteria	2623
394	Ga0495660_0001533	3300046810	Bacteria	15568
395	Ga0495660_0136330	3300046810	Bacteria	1226
396	Ga0495636_0011427	3300047318	Bacteria	3513
397	Ga0495672_0000035	3300047320	Bacteria	290329
398	Ga0495672_0061607	3300047320	Bacteria	2162
399	Ga0495683_0003291	3300047323	Bacteria	9449
400	Ga0495687_000536	3300047443	Bacteria	45378
401	Ga0495677_0003648	3300047445	Bacteria	5960
402	Ga0495685_000004	3300047447	Bacteria	115775
403	Ga0495673_0070009	3300047469	Bacteria	1478
404	Ga0495686_0021119	3300047472	Bacteria	4330
405	Ga0495686_0097047	3300047472	Bacteria	1783
406	Ga0495686_0324999	3300047472	Bacteria	842
407	Ga0495615_0060498	3300048090	Bacteria	998
408	Ga0496101_0037883	3300048904	Bacteria	3423
409	Ga0496102_0215104	3300048905	Bacteria	1811
410	Ga0496102_0233419	3300048905	Bacteria	1734
411	Ga0496106_0025589	3300048909	Bacteria	4393
412	Ga0496108_0101812	3300048911	Bacteria	2450
413	Ga0496109_0264694	3300048912	Bacteria	1620
414	Ga0496109_0654306	3300048912	Bacteria	988
415	Ga0496114_0015484	3300048917	Bacteria	6132
416	Ga0496114_0065944	3300048917	Bacteria	3034
417	Ga0496116_0037219	3300048919	Bacteria	3396
418	Ga0496121_0054326	3300048924	Bacteria	3348
419	Ga0496122_0022300	3300048925	Bacteria	5634
420	Ga0496123_0055155	3300048926	Bacteria	2609
421	Ga0496125_0000897	3300048928	Bacteria	47149
422	Ga0496125_0189893	3300048928	Bacteria	1358
423	Ga0496126_0381831	3300048929	Bacteria	1147
424	Ga0495678_068978	3300049459	Bacteria	1302
425	Ga0495682_0000343	3300049460	Bacteria	34418
426	Ga0495682_0003835	3300049460	Bacteria	6591
427	Ga0501033_0039293	3300049570	Bacteria	3534
428	Ga0501034_0012934	3300049571	Bacteria	8602
429	Ga0501034_0281434	3300049571	Bacteria	1602
430	Ga0501034_0440441	3300049571	Bacteria	1222
431	Ga0501036_0111417	3300049572	Bacteria	2312
432	Ga0501037_0078321	3300049573	Bacteria	2398
433	Ga0501038_0317561	3300049574	Bacteria	1219
434	Ga0501039_0094773	3300049575	Bacteria	2327
435	Ga0501039_0538478	3300049575	Bacteria	916
436	Ga0501042_0072136	3300049578	Bacteria	2471
437	Ga0501042_0393176	3300049578	Bacteria	1004
438	Ga0501043_0133857	3300049579	Bacteria	1942
439	Ga0501043_0273368	3300049579	Bacteria	1296
440	Ga0501046_0093272	3300049580	Bacteria	2314
441	Ga0501047_0441378	3300049581	Bacteria	1131
442	Ga0501048_0286948	3300049582	Bacteria	1170
443	Ga0501068_0000460	3300049584	Bacteria	20604
444	Ga0501068_0057309	3300049584	Bacteria	2362
445	Ga0501069_0148647	3300049585	Bacteria	1346
446	Ga0501070_0043641	3300049586	Bacteria	3731
447	Ga0501070_0159305	3300049586	Bacteria	1861
448	Ga0501071_0163765	3300049587	Bacteria	1663
449	Ga0501072_0160354	3300049588	Bacteria	1794
450	Ga0501072_0271695	3300049588	Bacteria	1348
451	Ga0501073_0058273	3300049589	Bacteria	2699
452	Ga0501073_0203090	3300049589	Bacteria	1370
453	Ga0501076_0314623	3300049592	Bacteria	1284
454	Ga0501076_0332514	3300049592	Bacteria	1246
455	Ga0501077_0002168	3300049593	Bacteria	11867
456	Ga0501079_0001221	3300049741	Bacteria	17991
457	Ga0501080_0000981	3300049742	Bacteria	23366
458	Ga0501080_0013226	3300049742	Bacteria	7582
459	Ga0501083_0001400	3300049744	Bacteria	16403
460	Ga0501035_0121417	3300049822	Bacteria	2283
461	Ga0501044_0077322	3300049823	Bacteria	3375
462	Ga0501044_0084892	3300049823	Bacteria	3199
463	Ga0501045_0586036	3300049824	Bacteria	826
464	nmdc:mga06r32_358325_c1	3300050510	Bacteria	1443
465	nmdc:mga08y16_237076_c1	3300050511	Bacteria	1886
466	nmdc:mga0n895_822116_c1	3300050512	Bacteria	918
467	nmdc:mga0a205_570942_c1	3300050515	Bacteria	985
468	Ga0495655_0068454	3300053083	Unclassified	987
469	Ga0501084_0045940	3300054114	Bacteria	3656
470	Ga0501084_0065185	3300054114	Bacteria	3047
471	Ga0501082_0173926	3300060353	Bacteria	1872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025925	Ga0207650_10258106	Ga0207650_102581061	202
2	3300028381	Ga0268264_10124100	Ga0268264_101241001	204
3	3300039447	Ga0436361_0655175	Ga0436361_0655175_2031_2702	204
4	3300053083	Ga0495655_0068454	Ga0495655_0068454_131_760	209
5	3300046542	Ga0495597_0011477	Ga0495597_0011477_3259_3903	211
6	3300046810	Ga0495660_0136330	Ga0495660_0136330_135_779	211
7	iso_pu_bacteria	2513237150	2513956184	211
8	iso_pu_bacteria	2513237165	2514042494	211
9	iso_pu_bacteria	2834641062	2834644133	211
10	iso_pu_bacteria	2858688981	2858698360	211
11	iso_pu_bacteria	644736347	644746445	211
12	iso_pu_bacteria	8003400568	8003403947	211
13	3300005457	Ga0070662_100343334	Ga0070662_1003433342	212
14	3300005564	Ga0070664_100107464	Ga0070664_1001074642	212
15	3300005577	Ga0068857_100309528	Ga0068857_1003095282	212
16	3300005616	Ga0068852_100673774	Ga0068852_1006737742	212
17	3300005617	Ga0068859_100185140	Ga0068859_1001851401	212
18	3300006931	Ga0097620_100185132	Ga0097620_1001851321	212
19	3300009098	Ga0105245_10161711	Ga0105245_101617114	212
20	3300009545	Ga0105237_10242854	Ga0105237_102428542	212
21	3300010375	Ga0105239_10094466	Ga0105239_100944662	212
22	3300013296	Ga0157374_10732385	Ga0157374_107323851	212
23	3300013308	Ga0157375_10073615	Ga0157375_100736155	212
24	3300025914	Ga0207671_10208138	Ga0207671_102081381	212
25	3300025927	Ga0207687_10201388	Ga0207687_102013883	212
26	3300025933	Ga0207706_10546935	Ga0207706_105469351	212
27	3300025942	Ga0207689_10034670	Ga0207689_100346704	212
28	3300025945	Ga0207679_10153480	Ga0207679_101534802	212
29	3300026116	Ga0207674_10606203	Ga0207674_106062032	212
30	3300044712	Ga0453684_0000975	Ga0453684_0000975_73313_73969	212
31	3300048912	Ga0496109_0264694	Ga0496109_0264694_807_1445	212
32	3300050512	nmdc:mga0n895_822116_c1	nmdc:mga0n895_822116_c1_216_854	212
33	3300005327	Ga0070658_10001403	Ga0070658_1000140314	213
34	3300005340	Ga0070689_100003825	Ga0070689_1000038253	213
35	3300005353	Ga0070669_100000846	Ga0070669_10000084616	213
36	3300005353	Ga0070669_100684168	Ga0070669_1006841682	213
37	3300005364	Ga0070673_100271358	Ga0070673_1002713582	213
38	3300005365	Ga0070688_100371500	Ga0070688_1003715002	213
39	3300005535	Ga0070684_100639655	Ga0070684_1006396552	213
40	3300005548	Ga0070665_100306347	Ga0070665_1003063472	213
41	3300005548	Ga0070665_100545975	Ga0070665_1005459752	213
42	3300005617	Ga0068859_100063637	Ga0068859_1000636373	213
43	3300005719	Ga0068861_100742697	Ga0068861_1007426971	213
44	3300005842	Ga0068858_100063412	Ga0068858_1000634122	213
45	3300005843	Ga0068860_101059722	Ga0068860_1010597221	213
46	3300005844	Ga0068862_100267076	Ga0068862_1002670762	213
47	3300006358	Ga0068871_100115148	Ga0068871_1001151482	213
48	3300006931	Ga0097620_100063637	Ga0097620_1000636373	213
49	3300009101	Ga0105247_10477165	Ga0105247_104771651	213
50	3300009148	Ga0105243_10041073	Ga0105243_100410732	213
51	3300009177	Ga0105248_10748404	Ga0105248_107484042	213
52	3300009177	Ga0105248_11098741	Ga0105248_110987412	213
53	3300009545	Ga0105237_10006330	Ga0105237_1000633013	213
54	3300009553	Ga0105249_10593450	Ga0105249_105934502	213
55	3300025909	Ga0207705_10021526	Ga0207705_100215263	213
56	3300025914	Ga0207671_10009133	Ga0207671_100091332	213
57	3300025919	Ga0207657_10722079	Ga0207657_107220791	213
58	3300025925	Ga0207650_10008345	Ga0207650_100083452	213
59	3300025926	Ga0207659_10332780	Ga0207659_103327802	213
60	3300025931	Ga0207644_10719709	Ga0207644_107197091	213
61	3300025935	Ga0207709_10198992	Ga0207709_101989922	213
62	3300025935	Ga0207709_10614358	Ga0207709_106143582	213
63	3300025936	Ga0207670_10014583	Ga0207670_100145832	213
64	3300025938	Ga0207704_10134107	Ga0207704_101341071	213
65	3300025938	Ga0207704_10387943	Ga0207704_103879432	213
66	3300025960	Ga0207651_10218837	Ga0207651_102188372	213
67	3300025961	Ga0207712_10359877	Ga0207712_103598772	213
68	3300026035	Ga0207703_10059131	Ga0207703_100591313	213
69	3300026035	Ga0207703_10253922	Ga0207703_102539222	213
70	3300026075	Ga0207708_10477560	Ga0207708_104775602	213
71	3300026088	Ga0207641_10080854	Ga0207641_100808542	213
72	3300026118	Ga0207675_100658658	Ga0207675_1006586582	213
73	3300028380	Ga0268265_10296454	Ga0268265_102964542	213
74	3300031731	Ga0307405_10339946	Ga0307405_103399462	213
75	3300035691	Ga0373931_0156886	Ga0373931_0156886_304_945	213
76	3300035724	Ga0373933_0161078	Ga0373933_0161078_498_1139	213
77	3300037068	Ga0373925_0009800	Ga0373925_0009800_31_672	213
78	3300037418	Ga0395900_0001354	Ga0395900_0001354_22523_23164	213
79	3300037466	Ga0395898_0008292	Ga0395898_0008292_7454_8095	213
80	3300038443	Ga0395901_0172986	Ga0395901_0172986_221_862	213
81	3300041498	Ga0451841_0114343	Ga0451841_0114343_314_970	213
82	3300044673	Ga0453683_0204860	Ga0453683_0204860_367_1008	213
83	3300046516	Ga0495628_0585146	Ga0495628_0585146_98_739	213
84	3300046683	Ga0495658_0256204	Ga0495658_0256204_233_895	213
85	3300048090	Ga0495615_0060498	Ga0495615_0060498_187_828	213
86	3300050515	nmdc:mga0a205_570942_c1	nmdc:mga0a205_570942_c1_303_959	213
87	3300003322	rootL2_10067533	rootL2_100675333	214
88	3300003911	JGI25405J52794_10049490	JGI25405J52794_100494901	214
89	3300005290	Ga0065712_10280249	Ga0065712_102802491	214
90	3300005293	Ga0065715_10242516	Ga0065715_102425161	214
91	3300005328	Ga0070676_10471038	Ga0070676_104710381	214
92	3300005329	Ga0070683_100066700	Ga0070683_1000667002	214
93	3300005331	Ga0070670_100013450	Ga0070670_1000134502	214
94	3300005333	Ga0070677_10025556	Ga0070677_100255561	214
95	3300005334	Ga0068869_100089543	Ga0068869_1000895431	214
96	3300005335	Ga0070666_10055423	Ga0070666_100554232	214
97	3300005337	Ga0070682_100019929	Ga0070682_1000199293	214
98	3300005337	Ga0070682_100178434	Ga0070682_1001784341	214
99	3300005344	Ga0070661_100010090	Ga0070661_1000100908	214
100	3300005347	Ga0070668_100363050	Ga0070668_1003630502	214
101	3300005347	Ga0070668_101124958	Ga0070668_1011249581	214
102	3300005353	Ga0070669_100151503	Ga0070669_1001515031	214
103	3300005353	Ga0070669_100221547	Ga0070669_1002215472	214
104	3300005354	Ga0070675_100128540	Ga0070675_1001285401	214
105	3300005354	Ga0070675_100140166	Ga0070675_1001401661	214
106	3300005354	Ga0070675_100603425	Ga0070675_1006034251	214
107	3300005355	Ga0070671_100003846	Ga0070671_1000038468	214
108	3300005356	Ga0070674_100009526	Ga0070674_1000095264	214
109	3300005356	Ga0070674_100061009	Ga0070674_1000610092	214
110	3300005356	Ga0070674_100115224	Ga0070674_1001152243	214
111	3300005364	Ga0070673_100351244	Ga0070673_1003512441	214
112	3300005366	Ga0070659_100218878	Ga0070659_1002188782	214
113	3300005367	Ga0070667_100039333	Ga0070667_1000393333	214
114	3300005367	Ga0070667_100495394	Ga0070667_1004953942	214
115	3300005434	Ga0070709_10536761	Ga0070709_105367611	214
116	3300005435	Ga0070714_100463764	Ga0070714_1004637641	214
117	3300005440	Ga0070705_100021935	Ga0070705_1000219351	214
118	3300005441	Ga0070700_100248436	Ga0070700_1002484362	214
119	3300005444	Ga0070694_100120594	Ga0070694_1001205943	214
120	3300005455	Ga0070663_100202372	Ga0070663_1002023722	214
121	3300005455	Ga0070663_100385317	Ga0070663_1003853172	214
122	3300005456	Ga0070678_100039466	Ga0070678_1000394664	214
123	3300005456	Ga0070678_100053036	Ga0070678_1000530364	214
124	3300005456	Ga0070678_100395552	Ga0070678_1003955522	214
125	3300005457	Ga0070662_100339887	Ga0070662_1003398872	214
126	3300005457	Ga0070662_100751038	Ga0070662_1007510381	214
127	3300005459	Ga0068867_100032821	Ga0068867_1000328216	214
128	3300005459	Ga0068867_100089988	Ga0068867_1000899882	214
129	3300005459	Ga0068867_100129812	Ga0068867_1001298123	214
130	3300005539	Ga0068853_100300343	Ga0068853_1003003432	214
131	3300005543	Ga0070672_100010864	Ga0070672_1000108648	214
132	3300005543	Ga0070672_100160410	Ga0070672_1001604101	214
133	3300005543	Ga0070672_100524526	Ga0070672_1005245261	214
134	3300005544	Ga0070686_100141416	Ga0070686_1001414163	214
135	3300005545	Ga0070695_100131378	Ga0070695_1001313783	214
136	3300005545	Ga0070695_100372092	Ga0070695_1003720921	214
137	3300005547	Ga0070693_100252218	Ga0070693_1002522182	214
138	3300005548	Ga0070665_100007562	Ga0070665_10000756210	214
139	3300005548	Ga0070665_100031299	Ga0070665_1000312992	214
140	3300005548	Ga0070665_100182760	Ga0070665_1001827604	214
141	3300005548	Ga0070665_100425269	Ga0070665_1004252692	214
142	3300005564	Ga0070664_100251308	Ga0070664_1002513082	214
143	3300005578	Ga0068854_100393277	Ga0068854_1003932772	214
144	3300005616	Ga0068852_100023289	Ga0068852_1000232893	214
145	3300005617	Ga0068859_100018585	Ga0068859_1000185854	214
146	3300005617	Ga0068859_100809875	Ga0068859_1008098751	214
147	3300005618	Ga0068864_100090085	Ga0068864_1000900853	214
148	3300005618	Ga0068864_100459358	Ga0068864_1004593582	214
149	3300005719	Ga0068861_100003428	Ga0068861_10000342810	214
150	3300005719	Ga0068861_100028203	Ga0068861_1000282032	214
151	3300005719	Ga0068861_100077136	Ga0068861_1000771362	214
152	3300005719	Ga0068861_100154437	Ga0068861_1001544371	214
153	3300005719	Ga0068861_100459566	Ga0068861_1004595662	214
154	3300005834	Ga0068851_10016592	Ga0068851_100165924	214
155	3300005841	Ga0068863_100449569	Ga0068863_1004495691	214
156	3300005841	Ga0068863_101092862	Ga0068863_1010928621	214
157	3300005844	Ga0068862_100041341	Ga0068862_1000413416	214
158	3300005844	Ga0068862_100116490	Ga0068862_1001164901	214
159	3300005844	Ga0068862_100216066	Ga0068862_1002160661	214
160	3300005937	Ga0081455_10004105	Ga0081455_1000410510	214
161	3300006237	Ga0097621_100041214	Ga0097621_1000412141	214
162	3300006237	Ga0097621_100098034	Ga0097621_1000980342	214
163	3300006237	Ga0097621_100129672	Ga0097621_1001296721	214
164	3300006358	Ga0068871_100125803	Ga0068871_1001258031	214
165	3300006358	Ga0068871_100235313	Ga0068871_1002353131	214
166	3300006358	Ga0068871_100408909	Ga0068871_1004089091	214
167	3300006358	Ga0068871_100545482	Ga0068871_1005454821	214
168	3300006844	Ga0075428_100317960	Ga0075428_1003179602	214
169	3300006844	Ga0075428_100679995	Ga0075428_1006799951	214
170	3300006846	Ga0075430_100082854	Ga0075430_1000828542	214
171	3300006846	Ga0075430_100412350	Ga0075430_1004123502	214
172	3300006847	Ga0075431_100200842	Ga0075431_1002008422	214
173	3300006881	Ga0068865_100117522	Ga0068865_1001175221	214
174	3300006881	Ga0068865_100370581	Ga0068865_1003705811	214
175	3300006881	Ga0068865_100873162	Ga0068865_1008731621	214
176	3300006931	Ga0097620_100018585	Ga0097620_1000185854	214
177	3300006931	Ga0097620_100809774	Ga0097620_1008097741	214
178	3300009094	Ga0111539_10251426	Ga0111539_102514262	214
179	3300009147	Ga0114129_11445614	Ga0114129_114456142	214
180	3300009148	Ga0105243_10525084	Ga0105243_105250842	214
181	3300009176	Ga0105242_10060214	Ga0105242_100602141	214
182	3300009177	Ga0105248_10251911	Ga0105248_102519113	214
183	3300009551	Ga0105238_10459045	Ga0105238_104590452	214
184	3300009553	Ga0105249_10779368	Ga0105249_107793682	214
185	3300013105	Ga0157369_10446181	Ga0157369_104461812	214
186	3300013296	Ga0157374_10128725	Ga0157374_101287252	214
187	3300013296	Ga0157374_10193293	Ga0157374_101932931	214
188	3300013297	Ga0157378_10315068	Ga0157378_103150681	214
189	3300013306	Ga0163162_10611216	Ga0163162_106112161	214
190	3300013307	Ga0157372_10236499	Ga0157372_102364994	214
191	3300013308	Ga0157375_10011098	Ga0157375_100110982	214
192	3300013308	Ga0157375_10061692	Ga0157375_100616923	214
193	3300013308	Ga0157375_10161396	Ga0157375_101613961	214
194	3300013308	Ga0157375_10278146	Ga0157375_102781461	214
195	3300013308	Ga0157375_10647674	Ga0157375_106476741	214
196	3300014325	Ga0163163_10091864	Ga0163163_100918642	214
197	3300014325	Ga0163163_11272761	Ga0163163_112727611	214
198	3300014326	Ga0157380_10119502	Ga0157380_101195021	214
199	3300014326	Ga0157380_10174113	Ga0157380_101741132	214
200	3300014326	Ga0157380_10334069	Ga0157380_103340692	214
201	3300014969	Ga0157376_10112504	Ga0157376_101125044	214
202	3300014969	Ga0157376_10147153	Ga0157376_101471531	214
203	3300015262	Ga0182007_10040408	Ga0182007_100404082	214
204	3300017792	Ga0163161_10164163	Ga0163161_101641631	214
205	3300025893	Ga0207682_10002327	Ga0207682_100023273	214
206	3300025893	Ga0207682_10137094	Ga0207682_101370942	214
207	3300025900	Ga0207710_10309172	Ga0207710_103091722	214
208	3300025903	Ga0207680_10007444	Ga0207680_100074446	214
209	3300025906	Ga0207699_10466428	Ga0207699_104664281	214
210	3300025908	Ga0207643_10074191	Ga0207643_100741913	214
211	3300025918	Ga0207662_10103113	Ga0207662_101031132	214
212	3300025923	Ga0207681_10095140	Ga0207681_100951402	214
213	3300025923	Ga0207681_10539010	Ga0207681_105390101	214
214	3300025925	Ga0207650_10028981	Ga0207650_100289814	214
215	3300025925	Ga0207650_10081203	Ga0207650_100812034	214
216	3300025925	Ga0207650_10317100	Ga0207650_103171002	214
217	3300025925	Ga0207650_10783368	Ga0207650_107833681	214
218	3300025926	Ga0207659_10119129	Ga0207659_101191294	214
219	3300025927	Ga0207687_10679387	Ga0207687_106793872	214
220	3300025932	Ga0207690_10077321	Ga0207690_100773214	214
221	3300025933	Ga0207706_10382389	Ga0207706_103823893	214
222	3300025936	Ga0207670_10033116	Ga0207670_100331161	214
223	3300025937	Ga0207669_10038557	Ga0207669_100385573	214
224	3300025938	Ga0207704_10146611	Ga0207704_101466111	214
225	3300025940	Ga0207691_10059721	Ga0207691_100597213	214
226	3300025940	Ga0207691_10411617	Ga0207691_104116172	214
227	3300025941	Ga0207711_10082662	Ga0207711_100826621	214
228	3300025944	Ga0207661_10108798	Ga0207661_101087984	214
229	3300025945	Ga0207679_10108351	Ga0207679_101083514	214
230	3300025960	Ga0207651_10897624	Ga0207651_108976241	214
231	3300025981	Ga0207640_10282723	Ga0207640_102827231	214
232	3300025981	Ga0207640_10401053	Ga0207640_104010532	214
233	3300025986	Ga0207658_10027850	Ga0207658_100278503	214
234	3300026035	Ga0207703_10071748	Ga0207703_100717481	214
235	3300026067	Ga0207678_10198641	Ga0207678_101986413	214
236	3300026067	Ga0207678_10293104	Ga0207678_102931042	214
237	3300026075	Ga0207708_10102696	Ga0207708_101026961	214
238	3300026075	Ga0207708_10165706	Ga0207708_101657062	214
239	3300026075	Ga0207708_10189126	Ga0207708_101891263	214
240	3300026078	Ga0207702_10229947	Ga0207702_102299472	214
241	3300026088	Ga0207641_10052285	Ga0207641_100522851	214
242	3300026088	Ga0207641_10553201	Ga0207641_105532012	214
243	3300026089	Ga0207648_10034642	Ga0207648_100346422	214
244	3300026089	Ga0207648_10071550	Ga0207648_100715501	214
245	3300026089	Ga0207648_10548768	Ga0207648_105487681	214
246	3300026095	Ga0207676_10058089	Ga0207676_100580891	214
247	3300026095	Ga0207676_10793297	Ga0207676_107932971	214
248	3300026118	Ga0207675_100005763	Ga0207675_1000057634	214
249	3300026118	Ga0207675_100130609	Ga0207675_1001306092	214
250	3300026118	Ga0207675_100194476	Ga0207675_1001944763	214
251	3300026121	Ga0207683_10459393	Ga0207683_104593932	214
252	3300028379	Ga0268266_10024376	Ga0268266_100243763	214
253	3300028379	Ga0268266_10159486	Ga0268266_101594863	214
254	3300028380	Ga0268265_10028239	Ga0268265_100282396	214
255	3300028380	Ga0268265_10391009	Ga0268265_103910091	214
256	3300028381	Ga0268264_10454475	Ga0268264_104544752	214
257	3300031239	Ga0265328_10111453	Ga0265328_101114531	214
258	3300031240	Ga0265320_10088526	Ga0265320_100885262	214
259	3300031456	Ga0307513_10110864	Ga0307513_101108645	214
260	3300031456	Ga0307513_10470176	Ga0307513_104701762	214
261	3300031548	Ga0307408_100050296	Ga0307408_1000502962	214
262	3300031901	Ga0307406_10007898	Ga0307406_100078987	214
263	3300031903	Ga0307407_10182544	Ga0307407_101825443	214
264	3300031995	Ga0307409_100021207	Ga0307409_1000212075	214
265	3300031995	Ga0307409_100214491	Ga0307409_1002144913	214
266	3300032002	Ga0307416_100021110	Ga0307416_1000211102	214
267	3300032002	Ga0307416_101047861	Ga0307416_1010478612	214
268	3300032005	Ga0307411_10005352	Ga0307411_100053522	214
269	3300032126	Ga0307415_100554058	Ga0307415_1005540582	214
270	3300032168	Ga0316593_10048206	Ga0316593_100482061	214
271	3300035112	Ga0373932_0101597	Ga0373932_0101597_10_657	214
272	3300035170	Ga0373943_0320058	Ga0373943_0320058_156_824	214
273	3300035172	Ga0373955_0316235	Ga0373955_0316235_109_777	214
274	3300035691	Ga0373931_0095698	Ga0373931_0095698_812_1459	214
275	3300036401	Ga0373937_0118525	Ga0373937_0118525_906_1550	214
276	3300037068	Ga0373925_0746021	Ga0373925_0746021_63_710	214
277	3300037418	Ga0395900_0711261	Ga0395900_0711261_229_873	214
278	3300037466	Ga0395898_0015300	Ga0395898_0015300_4767_5411	214
279	3300037471	Ga0395905_0487015	Ga0395905_0487015_426_1070	214
280	3300037471	Ga0395905_0803130	Ga0395905_0803130_146_805	214
281	3300041512	Ga0451853_1268857	Ga0451853_1268857_707_1366	214
282	3300042437	Ga0439444_0027466	Ga0439444_0027466_337_987	214
283	3300044712	Ga0453684_0000014	Ga0453684_0000014_609847_610521	214
284	3300044712	Ga0453684_0000682	Ga0453684_0000682_68180_68851	214
285	3300044712	Ga0453684_0005513	Ga0453684_0005513_14822_15466	214
286	3300044712	Ga0453684_1113468	Ga0453684_1113468_131_793	214
287	3300045049	Ga0466959_0495206	Ga0466959_0495206_85_729	214
288	3300046460	Ga0495638_0004277	Ga0495638_0004277_7456_8115	214
289	3300046460	Ga0495638_0028011	Ga0495638_0028011_1495_2163	214
290	3300046513	Ga0495616_0001603	Ga0495616_0001603_7041_7709	214
291	3300046519	Ga0495632_0018045	Ga0495632_0018045_2845_3504	214
292	3300046535	Ga0495586_0180774	Ga0495586_0180774_421_1065	214
293	3300046616	Ga0495668_0105047	Ga0495668_0105047_61_720	214
294	3300046660	Ga0495625_0031163	Ga0495625_0031163_3102_3770	214
295	3300046660	Ga0495625_0303237	Ga0495625_0303237_291_941	214
296	3300046684	Ga0495669_0249322	Ga0495669_0249322_37_684	214
297	3300047472	Ga0495686_0097047	Ga0495686_0097047_789_1436	214
298	3300047472	Ga0495686_0324999	Ga0495686_0324999_11_670	214
299	3300048905	Ga0496102_0233419	Ga0496102_0233419_706_1353	214
300	3300048909	Ga0496106_0025589	Ga0496106_0025589_3189_3833	214
301	3300048911	Ga0496108_0101812	Ga0496108_0101812_1151_1798	214
302	3300048912	Ga0496109_0654306	Ga0496109_0654306_333_977	214
303	3300048917	Ga0496114_0015484	Ga0496114_0015484_1175_1834	214
304	3300048917	Ga0496114_0065944	Ga0496114_0065944_672_1328	214
305	3300048928	Ga0496125_0000897	Ga0496125_0000897_13254_13913	214
306	3300049570	Ga0501033_0039293	Ga0501033_0039293_488_1132	214
307	3300049571	Ga0501034_0281434	Ga0501034_0281434_632_1276	214
308	3300049571	Ga0501034_0440441	Ga0501034_0440441_44_703	214
309	3300049572	Ga0501036_0111417	Ga0501036_0111417_243_887	214
310	3300049573	Ga0501037_0078321	Ga0501037_0078321_1150_1794	214
311	3300049574	Ga0501038_0317561	Ga0501038_0317561_165_809	214
312	3300049575	Ga0501039_0094773	Ga0501039_0094773_286_930	214
313	3300049575	Ga0501039_0538478	Ga0501039_0538478_190_858	214
314	3300049578	Ga0501042_0072136	Ga0501042_0072136_1335_2003	214
315	3300049578	Ga0501042_0393176	Ga0501042_0393176_153_821	214
316	3300049579	Ga0501043_0133857	Ga0501043_0133857_304_948	214
317	3300049579	Ga0501043_0273368	Ga0501043_0273368_439_1083	214
318	3300049580	Ga0501046_0093272	Ga0501046_0093272_646_1290	214
319	3300049581	Ga0501047_0441378	Ga0501047_0441378_90_734	214
320	3300049582	Ga0501048_0286948	Ga0501048_0286948_364_1008	214
321	3300049584	Ga0501068_0000460	Ga0501068_0000460_74_742	214
322	3300049584	Ga0501068_0057309	Ga0501068_0057309_790_1434	214
323	3300049585	Ga0501069_0148647	Ga0501069_0148647_501_1160	214
324	3300049586	Ga0501070_0043641	Ga0501070_0043641_2959_3627	214
325	3300049586	Ga0501070_0159305	Ga0501070_0159305_891_1535	214
326	3300049587	Ga0501071_0163765	Ga0501071_0163765_915_1583	214
327	3300049588	Ga0501072_0160354	Ga0501072_0160354_102_770	214
328	3300049588	Ga0501072_0271695	Ga0501072_0271695_381_1025	214
329	3300049589	Ga0501073_0058273	Ga0501073_0058273_208_876	214
330	3300049589	Ga0501073_0203090	Ga0501073_0203090_313_957	214
331	3300049592	Ga0501076_0314623	Ga0501076_0314623_80_724	214
332	3300049592	Ga0501076_0332514	Ga0501076_0332514_375_1043	214
333	3300049593	Ga0501077_0002168	Ga0501077_0002168_11083_11751	214
334	3300049741	Ga0501079_0001221	Ga0501079_0001221_291_959	214
335	3300049742	Ga0501080_0000981	Ga0501080_0000981_125_793	214
336	3300049742	Ga0501080_0013226	Ga0501080_0013226_4754_5398	214
337	3300049744	Ga0501083_0001400	Ga0501083_0001400_15690_16358	214
338	3300049822	Ga0501035_0121417	Ga0501035_0121417_1239_1883	214
339	3300049823	Ga0501044_0077322	Ga0501044_0077322_647_1291	214
340	3300049823	Ga0501044_0084892	Ga0501044_0084892_471_1115	214
341	3300049824	Ga0501045_0586036	Ga0501045_0586036_130_774	214
342	3300050510	nmdc:mga06r32_358325_c1	nmdc:mga06r32_358325_c1_471_1118	214
343	3300050511	nmdc:mga08y16_237076_c1	nmdc:mga08y16_237076_c1_525_1184	214
344	3300054114	Ga0501084_0045940	Ga0501084_0045940_2906_3574	214
345	3300054114	Ga0501084_0065185	Ga0501084_0065185_1338_1982	214
346	3300060353	Ga0501082_0173926	Ga0501082_0173926_1094_1762	214
347	3300003187	JGI25151J46595_10003398	JGI25151J46595_100033982	215
348	3300003187	JGI25151J46595_10028396	JGI25151J46595_100283962	215
349	3300003773	Ga0055537_1003050	Ga0055537_10030501	215
350	3300003775	Ga0055524_1000629	Ga0055524_100062918	215
351	3300003781	Ga0055536_1000324	Ga0055536_100032429	215
352	3300003784	Ga0055534_1001753	Ga0055534_10017532	215
353	3300006948	Ga0099826_10000007	Ga0099826_10000007141	215
354	3300009011	Ga0105251_10030584	Ga0105251_100305841	215
355	3300025263	Ga0209565_1000106	Ga0209565_100010684	215
356	3300025263	Ga0209565_1009493	Ga0209565_10094932	215
357	3300025291	Ga0209675_1000168	Ga0209675_100016857	215
358	3300025291	Ga0209675_1001444	Ga0209675_10014447	215
359	3300025291	Ga0209675_1017926	Ga0209675_10179262	215
360	3300025292	Ga0209676_1000036	Ga0209676_1000036221	215
361	3300025294	Ga0209025_1000462	Ga0209025_100046256	215
362	3300025294	Ga0209025_1001905	Ga0209025_100190516	215
363	3300025294	Ga0209025_1002261	Ga0209025_100226120	215
364	3300025295	Ga0209564_1000573	Ga0209564_100057334	215
365	3300025295	Ga0209564_1000957	Ga0209564_100095713	215
366	3300025295	Ga0209564_1001001	Ga0209564_100100125	215
367	3300025297	Ga0209758_1033047	Ga0209758_10330472	215
368	3300025299	Ga0209256_1000220	Ga0209256_100022015	215
369	3300025299	Ga0209256_1000554	Ga0209256_10005543	215
370	3300025303	Ga0209051_1017060	Ga0209051_10170602	215
371	3300025303	Ga0209051_1018808	Ga0209051_10188082	215
372	3300027666	Ga0209282_1000061	Ga0209282_100006142	215
373	3300046474	Ga0495605_0002642	Ga0495605_0002642_4650_5321	215
374	3300046500	Ga0495596_0000577	Ga0495596_0000577_16209_16880	215
375	3300046501	Ga0495607_0098771	Ga0495607_0098771_324_995	215
376	3300046512	Ga0495610_0005593	Ga0495610_0005593_5969_6640	215
377	3300046513	Ga0495616_0061734	Ga0495616_0061734_635_1306	215
378	3300046538	Ga0495609_0005238	Ga0495609_0005238_5159_5830	215
379	3300046615	Ga0495656_0085731	Ga0495656_0085731_208_879	215
380	3300046665	Ga0495661_0054448	Ga0495661_0054448_634_1305	215
381	3300046692	Ga0495671_0025209	Ga0495671_0025209_944_1615	215
382	3300046694	Ga0495649_0125923	Ga0495649_0125923_403_1074	215
383	3300047320	Ga0495672_0061607	Ga0495672_0061607_1132_1803	215
384	3300048919	Ga0496116_0037219	Ga0496116_0037219_2335_3006	215
385	3300048924	Ga0496121_0054326	Ga0496121_0054326_146_817	215
386	3300048925	Ga0496122_0022300	Ga0496122_0022300_2420_3091	215
387	3300048926	Ga0496123_0055155	Ga0496123_0055155_850_1521	215
388	3300048928	Ga0496125_0189893	Ga0496125_0189893_245_916	215
389	3300048929	Ga0496126_0381831	Ga0496126_0381831_167_838	215
390	3300049571	Ga0501034_0012934	Ga0501034_0012934_2249_2920	215
391	iso_pu_bacteria	2643221603	2644029251	217
392	iso_pu_bacteria	2643221645	2644249371	217
393	iso_pu_bacteria	2643221664	2644359474	217
394	iso_pu_bacteria	2738541280	2738740799	217
395	iso_pu_bacteria	2738541300	2738845113	217
396	iso_pu_bacteria	2738543018	2739274698	217
397	iso_pu_bacteria	2738543030	2739343742	217
398	3300044658	Ga0466972_0000029	Ga0466972_0000029_56866_57534	218
399	3300044706	Ga0466964_0003634	Ga0466964_0003634_790_1449	218
400	3300005564	Ga0070664_100007750	Ga0070664_1000077507	219
401	3300025919	Ga0207657_10016101	Ga0207657_100161012	219
402	3300025933	Ga0207706_10096145	Ga0207706_100961452	219
403	3300044684	Ga0466966_0011936	Ga0466966_0011936_2811_3479	219
404	3300045049	Ga0466959_0080505	Ga0466959_0080505_1389_2057	219
405	3300046471	Ga0495650_0008211	Ga0495650_0008211_4271_4978	220
406	3300003163	Ga0006759J45824_1087121	Ga0006759J45824_10871211	221
407	3300003544	Ga0007417J51691_1021079	Ga0007417J51691_10210791	221
408	3300003574	Ga0007410J51695_1038954	Ga0007410J51695_10389541	221
409	3300003575	Ga0007409J51694_1014616	Ga0007409J51694_10146161	221
410	3300003577	Ga0007416J51690_1011811	Ga0007416J51690_10118111	221
411	3300003611	Ga0007411J51799_111718	Ga0007411J51799_1117181	221
412	3300003693	Ga0032354_1010298	Ga0032354_10102981	221
413	3300005337	Ga0070682_100007448	Ga0070682_1000074483	221
414	3300006175	Ga0070712_100009789	Ga0070712_1000097895	221
415	3300021361	Ga0213872_10000063	Ga0213872_1000006345	221
416	3300025915	Ga0207693_10021314	Ga0207693_100213144	221
417	3300031711	Ga0265314_10046650	Ga0265314_100466503	221
418	3300037312	Ga0395899_0003696	Ga0395899_0003696_955_1674	221
419	3300037312	Ga0395899_0020212	Ga0395899_0020212_953_1723	221
420	3300037418	Ga0395900_0159549	Ga0395900_0159549_118_786	221
421	3300037466	Ga0395898_0036893	Ga0395898_0036893_3258_3977	221
422	3300037471	Ga0395905_0000137	Ga0395905_0000137_35412_36092	221
423	3300037471	Ga0395905_0209465	Ga0395905_0209465_106_774	221
424	3300038443	Ga0395901_0006191	Ga0395901_0006191_4547_5218	221
425	3300039447	Ga0436361_0811061	Ga0436361_0811061_111781_112452	221
426	3300046452	Ga0495617_037474	Ga0495617_037474_72_749	221
427	3300046452	Ga0495617_096273	Ga0495617_096273_168_845	221
428	3300046457	Ga0495590_0039794	Ga0495590_0039794_575_1252	221
429	3300046460	Ga0495638_0045273	Ga0495638_0045273_1650_2327	221
430	3300046471	Ga0495650_0000519	Ga0495650_0000519_35162_35842	221
431	3300046474	Ga0495605_0001123	Ga0495605_0001123_413_1090	221
432	3300046491	Ga0495584_0002965	Ga0495584_0002965_695_1372	221
433	3300046491	Ga0495584_0077713	Ga0495584_0077713_875_1552	221
434	3300046492	Ga0495585_0014959	Ga0495585_0014959_3775_4452	221
435	3300046492	Ga0495585_0095971	Ga0495585_0095971_287_964	221
436	3300046492	Ga0495585_0130420	Ga0495585_0130420_406_1083	221
437	3300046501	Ga0495607_0044134	Ga0495607_0044134_821_1498	221
438	3300046501	Ga0495607_0058357	Ga0495607_0058357_1413_2090	221
439	3300046506	Ga0495583_0000004	Ga0495583_0000004_400448_401125	221
440	3300046507	Ga0495606_0006173	Ga0495606_0006173_8751_9422	221
441	3300046507	Ga0495606_0010926	Ga0495606_0010926_1997_2677	221
442	3300046512	Ga0495610_0030322	Ga0495610_0030322_530_1207	221
443	3300046513	Ga0495616_0004162	Ga0495616_0004162_460_1137	221
444	3300046513	Ga0495616_0005090	Ga0495616_0005090_6746_7423	221
445	3300046523	Ga0495644_0002672	Ga0495644_0002672_1654_2331	221
446	3300046523	Ga0495644_0003781	Ga0495644_0003781_1089_1766	221
447	3300046524	Ga0495648_0003940	Ga0495648_0003940_526_1203	221
448	3300046530	Ga0495654_0099858	Ga0495654_0099858_469_1143	221
449	3300046538	Ga0495609_0002923	Ga0495609_0002923_2209_2886	221
450	3300046538	Ga0495609_0008840	Ga0495609_0008840_3947_4624	221
451	3300046538	Ga0495609_0014916	Ga0495609_0014916_2745_3431	221
452	3300046542	Ga0495597_0069577	Ga0495597_0069577_603_1277	221
453	3300046557	Ga0495622_0000053	Ga0495622_0000053_81049_81747	221
454	3300046557	Ga0495622_0020711	Ga0495622_0020711_80_757	221
455	3300046558	Ga0495633_0004349	Ga0495633_0004349_319_996	221
456	3300046558	Ga0495633_0023113	Ga0495633_0023113_1752_2429	221
457	3300046616	Ga0495668_0148837	Ga0495668_0148837_438_1112	221
458	3300046648	Ga0495611_0043100	Ga0495611_0043100_158_835	221
459	3300046660	Ga0495625_0007453	Ga0495625_0007453_6469_7143	221
460	3300046660	Ga0495625_0012345	Ga0495625_0012345_1268_1945	221
461	3300046660	Ga0495625_0274781	Ga0495625_0274781_289_975	221
462	3300046664	Ga0495659_0000118	Ga0495659_0000118_512_1186	221
463	3300046664	Ga0495659_0003772	Ga0495659_0003772_3655_4332	221
464	3300046665	Ga0495661_0019790	Ga0495661_0019790_3485_4162	221
465	3300046691	Ga0495670_0003657	Ga0495670_0003657_6188_6865	221
466	3300046691	Ga0495670_0003990	Ga0495670_0003990_436_1113	221
467	3300046692	Ga0495671_0001545	Ga0495671_0001545_1832_2506	221
468	3300046692	Ga0495671_0006506	Ga0495671_0006506_2099_2776	221
469	3300046694	Ga0495649_0206773	Ga0495649_0206773_104_784	221
470	3300046794	Ga0495589_0032506	Ga0495589_0032506_497_1174	221
471	3300046810	Ga0495660_0001533	Ga0495660_0001533_12881_13567	221
472	3300047318	Ga0495636_0011427	Ga0495636_0011427_628_1305	221
473	3300047320	Ga0495672_0000035	Ga0495672_0000035_123077_123751	221
474	3300047323	Ga0495683_0003291	Ga0495683_0003291_700_1377	221
475	3300047443	Ga0495687_000536	Ga0495687_000536_18556_19233	221
476	3300047445	Ga0495677_0003648	Ga0495677_0003648_535_1212	221
477	3300047447	Ga0495685_000004	Ga0495685_000004_89413_90090	221
478	3300047469	Ga0495673_0070009	Ga0495673_0070009_342_1019	221
479	3300047472	Ga0495686_0021119	Ga0495686_0021119_3148_3834	221
480	3300048904	Ga0496101_0037883	Ga0496101_0037883_2304_2978	221
481	3300048905	Ga0496102_0215104	Ga0496102_0215104_971_1636	221
482	3300049459	Ga0495678_068978	Ga0495678_068978_551_1261	221
483	3300049460	Ga0495682_0000343	Ga0495682_0000343_32396_33073	221
484	3300049460	Ga0495682_0003835	Ga0495682_0003835_1346_2023	221
485	iso_pu_bacteria	8055225921	8055225952	221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

39

190

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4waj-assembly1.cif.gz_A-2	h. influenzae beta-carbonic anhydase variant p48s/a49p	0.97	40	220
3e24-assembly1.cif.gz_A	h. influenzae beta-carbonic anhydrase, variant w39f	0.9669	42	220
3e2x-assembly1.cif.gz_B-2	h. influenzae beta-carbonic anhydrase, variant v47a	0.9657	41	220
4znz-assembly1.cif.gz_A	crystal structure of escherichia coli carbonic anhydrase (yadf) in complex with zn - artifact of purification	0.9655	11	220
4wam-assembly1.cif.gz_B-2	h. influenzae beta-carbonic anhydrase variant w39v/g41a/p48s/a49p	0.9643	41	220

ID	Description	Score	Start	End	Superfamily
4wamA00	Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase	0.9622	41	220	3.40.1050.10
2a8cA00	Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase	0.9517	11	220	3.40.1050.10
1ddzB02	Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase	0.9462	40	218	3.40.1050.10
3ucnB00	Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase	0.9311	11	211	3.40.1050.10
4wamA00	Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase	0.9098	41	220	3.40.1050.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y0DKE0-F1-model_v4	carbonic anhydrase (EC 4.2.1.1)	0.9885	12	220	GO:0004089 GO:0008270 GO:0015976
AF-A0A2S9GTI7-F1-model_v4	carbonic anhydrase (EC 4.2.1.1)	0.985	12	220	GO:0004089 GO:0008270 GO:0015976
AF-A0A345D803-F1-model_v4	Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase)	0.9842	11	220	GO:0004089 GO:0008270 GO:0015976
AF-A0A0N0JW07-F1-model_v4	carbonic anhydrase (EC 4.2.1.1)	0.9834	13	221	GO:0004089 GO:0008270 GO:0015976
AF-A0A0N1AUK7-F1-model_v4	carbonic anhydrase (EC 4.2.1.1)	0.983	11	221	GO:0004089 GO:0008270 GO:0015976

Feature Viewer

pLDDT	pTM	Quality
90.41	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F453070

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00484

Pro_CA

Carbonic anhydrase

39

190

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map