F452906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 255 | 458 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10088431|Ga0075366_100884312 |
| Length | 335 |
| Sequence | MSGLLLRTLRGENASERPIWLMRQAGRYLPEYRALRAEKGGFLALVYDTDAAAEITLQPIRRFGFDGAILFSDILIVPYAMGQDLEFLVGEGPRLSPRLVDSALDGLRAVPERLEPIYVTVAKVKAGLGSGRTLLGFAGSPWTVATYMVAGEGSRDQHVTRAMAYRDPQGFQAIIDAYLAGQVRAGAEAVQLFDSWAGSLAPAEFERWVIAPNAAIVARLKARFPELPVIGFPKGAGEKLPAYARETGVDALGLDETIDPLWAAKALPEGMPVQGNFDPLLIEAGGPEIDRQARRILDAFADRPHVFNLGHGIGQHTPIAHVEQLLAVVRGWRRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 6 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 7 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 8 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 9 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 10 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 11 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 12 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 13 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 14 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 15 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 16 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 17 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 18 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 19 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 20 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 21 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 22 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 23 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 24 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 25 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 26 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 27 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 28 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 141 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 165 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 166 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 167 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 207 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 208 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 209 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 210 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 211 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 224 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 225 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 226 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 231 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 238 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 240 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 241 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 242 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 243 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 244 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 245 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 246 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 247 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 248 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 249 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 250 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 251 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 252 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 253 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 254 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 255 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.63 |
| Metatranscriptomes | 0 |
| Isolates | 5.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.12 |
| Nodule | 0.41 |
| Rhizoplane | 5.17 |
| Rhizosphere | 67.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2859790 | 2162886007 | Bacteria | 5733 |
| 2 | SwRhRL2b_contig_780398 | 2162886007 | Bacteria | 36690 |
| 3 | JGI24736J21556_1001522 | 3300001904 | Bacteria | 4223 |
| 4 | JGI24737J22298_10000792 | 3300001990 | Bacteria | 11199 |
| 5 | JGI24735J21928_10000784 | 3300002067 | Bacteria | 11304 |
| 6 | JGI24748J21848_1000910 | 3300002074 | Bacteria | 3207 |
| 7 | JGI24738J21930_10004957 | 3300002075 | Bacteria | 3221 |
| 8 | JGI24738J21930_10021438 | 3300002075 | Bacteria | 1340 |
| 9 | JGI24751J29686_10000270 | 3300002459 | Bacteria | 20156 |
| 10 | Ga0055536_1002684 | 3300003781 | Bacteria | 9870 |
| 11 | Ga0055530_10005156 | 3300003791 | Bacteria | 6368 |
| 12 | Ga0055530_10012841 | 3300003791 | Bacteria | 2896 |
| 13 | Ga0055531_10000492 | 3300003794 | Bacteria | 36203 |
| 14 | Ga0055531_10009125 | 3300003794 | Bacteria | 5112 |
| 15 | Ga0065704_10003765 | 3300005289 | Bacteria | 7897 |
| 16 | Ga0065704_10009113 | 3300005289 | Bacteria | 3984 |
| 17 | Ga0065704_10070157 | 3300005289 | Bacteria | 211668 |
| 18 | Ga0065704_10070610 | 3300005289 | Bacteria | 19142 |
| 19 | Ga0065704_10075725 | 3300005289 | Bacteria | 5446 |
| 20 | Ga0065707_10087470 | 3300005295 | Bacteria | 5011 |
| 21 | Ga0065707_10093677 | 3300005295 | Bacteria | 3593 |
| 22 | Ga0065707_10144281 | 3300005295 | Bacteria | 1732 |
| 23 | Ga0070658_10000811 | 3300005327 | Bacteria | 26743 |
| 24 | Ga0070658_10121692 | 3300005327 | Bacteria | 2169 |
| 25 | Ga0070658_10130414 | 3300005327 | Bacteria | 2095 |
| 26 | Ga0070658_10133606 | 3300005327 | Bacteria | 2069 |
| 27 | Ga0070683_100026685 | 3300005329 | Bacteria | 5205 |
| 28 | Ga0070670_100166174 | 3300005331 | Bacteria | 1913 |
| 29 | Ga0070666_10011761 | 3300005335 | Bacteria | 5503 |
| 30 | Ga0070666_10044153 | 3300005335 | Bacteria | 2985 |
| 31 | Ga0070680_100006749 | 3300005336 | Bacteria | 8745 |
| 32 | Ga0070682_100055656 | 3300005337 | Bacteria | 2485 |
| 33 | Ga0070660_100029871 | 3300005339 | Bacteria | 4086 |
| 34 | Ga0070660_100112385 | 3300005339 | Bacteria | 2168 |
| 35 | Ga0070661_100011548 | 3300005344 | Bacteria | 6154 |
| 36 | Ga0070661_100040788 | 3300005344 | Bacteria | 3387 |
| 37 | Ga0070668_100001596 | 3300005347 | Bacteria | 16399 |
| 38 | Ga0070668_100003911 | 3300005347 | Bacteria | 11002 |
| 39 | Ga0070668_100115461 | 3300005347 | Bacteria | 2140 |
| 40 | Ga0070668_100173312 | 3300005347 | Bacteria | 1758 |
| 41 | Ga0070668_100190402 | 3300005347 | Bacteria | 1680 |
| 42 | Ga0070669_100000056 | 3300005353 | Bacteria | 111413 |
| 43 | Ga0070669_100000291 | 3300005353 | Bacteria | 39339 |
| 44 | Ga0070669_100013132 | 3300005353 | Bacteria | 5886 |
| 45 | Ga0070669_100057741 | 3300005353 | Bacteria | 2848 |
| 46 | Ga0070669_100211468 | 3300005353 | Bacteria | 1530 |
| 47 | Ga0070671_100000005 | 3300005355 | Bacteria | 256547 |
| 48 | Ga0070671_100008960 | 3300005355 | Bacteria | 8029 |
| 49 | Ga0070671_100012272 | 3300005355 | Bacteria | 6896 |
| 50 | Ga0070671_100016614 | 3300005355 | Bacteria | 5949 |
| 51 | Ga0070671_100042748 | 3300005355 | Bacteria | 3767 |
| 52 | Ga0070671_100122127 | 3300005355 | Bacteria | 2192 |
| 53 | Ga0070659_100024854 | 3300005366 | Bacteria | 4595 |
| 54 | Ga0070667_100000160 | 3300005367 | Bacteria | 83754 |
| 55 | Ga0070667_100002172 | 3300005367 | Bacteria | 17269 |
| 56 | Ga0070667_100032565 | 3300005367 | Bacteria | 4348 |
| 57 | Ga0070667_100043636 | 3300005367 | Bacteria | 3764 |
| 58 | Ga0070663_100001281 | 3300005455 | Bacteria | 13770 |
| 59 | Ga0070663_100050582 | 3300005455 | Bacteria | 2956 |
| 60 | Ga0070663_100060112 | 3300005455 | Bacteria | 2732 |
| 61 | Ga0070662_100138316 | 3300005457 | Bacteria | 1885 |
| 62 | Ga0070681_10029381 | 3300005458 | Bacteria | 5520 |
| 63 | Ga0070679_100011790 | 3300005530 | Bacteria | 8336 |
| 64 | Ga0068853_100000627 | 3300005539 | Bacteria | 24278 |
| 65 | Ga0070665_100000101 | 3300005548 | Bacteria | 159353 |
| 66 | Ga0070665_100002164 | 3300005548 | Bacteria | 21915 |
| 67 | Ga0070665_100079499 | 3300005548 | Bacteria | 3285 |
| 68 | Ga0068855_100006162 | 3300005563 | Bacteria | 14623 |
| 69 | Ga0068855_100036684 | 3300005563 | Bacteria | 5832 |
| 70 | Ga0068855_100076452 | 3300005563 | Bacteria | 3886 |
| 71 | Ga0068855_100084549 | 3300005563 | Bacteria | 3673 |
| 72 | Ga0068855_100103441 | 3300005563 | Bacteria | 3276 |
| 73 | Ga0070664_100024807 | 3300005564 | Bacteria | 4965 |
| 74 | Ga0070664_100102832 | 3300005564 | Bacteria | 2486 |
| 75 | Ga0068857_100043993 | 3300005577 | Bacteria | 3960 |
| 76 | Ga0068856_100013169 | 3300005614 | Bacteria | 8011 |
| 77 | Ga0068856_100172821 | 3300005614 | Bacteria | 2173 |
| 78 | Ga0068852_100000259 | 3300005616 | Bacteria | 35916 |
| 79 | Ga0068852_100420319 | 3300005616 | Bacteria | 1318 |
| 80 | Ga0068859_100012366 | 3300005617 | Bacteria | 8584 |
| 81 | Ga0068859_100097647 | 3300005617 | Bacteria | 2991 |
| 82 | Ga0068864_100000145 | 3300005618 | Bacteria | 68040 |
| 83 | Ga0068864_100026543 | 3300005618 | Bacteria | 4884 |
| 84 | Ga0068864_100114553 | 3300005618 | Bacteria | 2404 |
| 85 | Ga0068864_100159787 | 3300005618 | Bacteria | 2048 |
| 86 | Ga0068851_10039174 | 3300005834 | Bacteria | 2380 |
| 87 | Ga0068863_100002604 | 3300005841 | Bacteria | 17894 |
| 88 | Ga0068863_100009722 | 3300005841 | Bacteria | 9382 |
| 89 | Ga0068858_100000268 | 3300005842 | Bacteria | 55747 |
| 90 | Ga0068858_100010173 | 3300005842 | Bacteria | 8928 |
| 91 | Ga0068858_100022546 | 3300005842 | Bacteria | 5875 |
| 92 | Ga0068858_100044087 | 3300005842 | Bacteria | 4136 |
| 93 | Ga0068860_100005319 | 3300005843 | Bacteria | 13065 |
| 94 | Ga0068860_100005374 | 3300005843 | Bacteria | 12996 |
| 95 | Ga0068860_100026953 | 3300005843 | Bacteria | 5538 |
| 96 | Ga0068862_100003464 | 3300005844 | Bacteria | 13574 |
| 97 | Ga0068862_100016320 | 3300005844 | Bacteria | 6180 |
| 98 | Ga0075365_10028501 | 3300006038 | Bacteria | 3562 |
| 99 | Ga0075363_100129347 | 3300006048 | Bacteria | 1415 |
| 100 | Ga0075364_10000854 | 3300006051 | Bacteria | 16048 |
| 101 | Ga0075364_10017718 | 3300006051 | Bacteria | 4454 |
| 102 | Ga0075432_10010630 | 3300006058 | Bacteria | 3127 |
| 103 | Ga0075362_10000110 | 3300006177 | Bacteria | 22774 |
| 104 | Ga0075367_10010578 | 3300006178 | Bacteria | 4851 |
| 105 | Ga0075367_10019591 | 3300006178 | Bacteria | 3754 |
| 106 | Ga0075369_10001156 | 3300006186 | Bacteria | 8910 |
| 107 | Ga0075369_10007540 | 3300006186 | Bacteria | 4151 |
| 108 | Ga0075369_10010778 | 3300006186 | Bacteria | 3581 |
| 109 | Ga0075366_10000262 | 3300006195 | Bacteria | 23232 |
| 110 | Ga0075366_10010488 | 3300006195 | Bacteria | 5202 |
| 111 | Ga0075366_10025434 | 3300006195 | Bacteria | 3458 |
| 112 | Ga0075366_10088431 | 3300006195 | Bacteria | 1855 |
| 113 | Ga0075370_10000195 | 3300006353 | Bacteria | 21283 |
| 114 | Ga0075370_10004142 | 3300006353 | Bacteria | 6988 |
| 115 | Ga0075370_10017288 | 3300006353 | Bacteria | 3896 |
| 116 | Ga0097620_100012366 | 3300006931 | Bacteria | 8584 |
| 117 | Ga0097620_100097649 | 3300006931 | Bacteria | 2991 |
| 118 | Ga0079104_1030865 | 3300006946 | Bacteria | 1333 |
| 119 | Ga0105251_10002929 | 3300009011 | Bacteria | 12791 |
| 120 | Ga0105240_10007612 | 3300009093 | Bacteria | 15687 |
| 121 | Ga0105247_10044657 | 3300009101 | Bacteria | 2718 |
| 122 | Ga0105247_10098687 | 3300009101 | Bacteria | 1865 |
| 123 | Ga0105241_10005155 | 3300009174 | Bacteria | 9640 |
| 124 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 125 | Ga0105248_10008523 | 3300009177 | Bacteria | 11256 |
| 126 | Ga0105248_10031331 | 3300009177 | Bacteria | 5943 |
| 127 | Ga0105248_10047898 | 3300009177 | Bacteria | 4794 |
| 128 | Ga0105248_10058985 | 3300009177 | Bacteria | 4310 |
| 129 | Ga0105248_10129371 | 3300009177 | Bacteria | 2848 |
| 130 | Ga0105248_10155032 | 3300009177 | Bacteria | 2585 |
| 131 | Ga0105248_10312391 | 3300009177 | Bacteria | 1770 |
| 132 | Ga0105237_10074642 | 3300009545 | Bacteria | 3383 |
| 133 | Ga0105238_10075828 | 3300009551 | Bacteria | 3355 |
| 134 | Ga0105249_10000123 | 3300009553 | Bacteria | 104747 |
| 135 | Ga0105249_10097244 | 3300009553 | Bacteria | 2763 |
| 136 | Ga0105148_100032 | 3300009978 | Bacteria | 20199 |
| 137 | Ga0105239_10304064 | 3300010375 | Bacteria | 1796 |
| 138 | Ga0105246_10000074 | 3300011119 | Bacteria | 41753 |
| 139 | Ga0157373_10048756 | 3300013100 | Bacteria | 3020 |
| 140 | Ga0157371_10001651 | 3300013102 | Bacteria | 22752 |
| 141 | Ga0157371_10030900 | 3300013102 | Bacteria | 3860 |
| 142 | Ga0157370_10096838 | 3300013104 | Bacteria | 2768 |
| 143 | Ga0157370_10151128 | 3300013104 | Bacteria | 2160 |
| 144 | Ga0157369_10000384 | 3300013105 | Bacteria | 58625 |
| 145 | Ga0163162_10009714 | 3300013306 | Bacteria | 9363 |
| 146 | Ga0163162_10010851 | 3300013306 | Bacteria | 8866 |
| 147 | Ga0163162_10062635 | 3300013306 | Bacteria | 3760 |
| 148 | Ga0163162_10079146 | 3300013306 | Bacteria | 3353 |
| 149 | Ga0157372_10004422 | 3300013307 | Bacteria | 14988 |
| 150 | Ga0157372_10181667 | 3300013307 | Bacteria | 2435 |
| 151 | Ga0157380_10028296 | 3300014326 | Bacteria | 4271 |
| 152 | Ga0163161_10000412 | 3300017792 | Bacteria | 35877 |
| 153 | Ga0163161_10014323 | 3300017792 | Bacteria | 5521 |
| 154 | Ga0163161_10039436 | 3300017792 | Bacteria | 3391 |
| 155 | Ga0209675_1000638 | 3300025291 | Bacteria | 24903 |
| 156 | Ga0209676_1000897 | 3300025292 | Bacteria | 37715 |
| 157 | Ga0209676_1001537 | 3300025292 | Bacteria | 20872 |
| 158 | Ga0209025_1005555 | 3300025294 | Bacteria | 10219 |
| 159 | Ga0209050_1000113 | 3300025298 | Bacteria | 209222 |
| 160 | Ga0209050_1000474 | 3300025298 | Bacteria | 71192 |
| 161 | Ga0209257_1000083 | 3300025304 | Bacteria | 296207 |
| 162 | Ga0209257_1000330 | 3300025304 | Bacteria | 99167 |
| 163 | Ga0209257_1001563 | 3300025304 | Bacteria | 26461 |
| 164 | Ga0207697_10003663 | 3300025315 | Bacteria | 7527 |
| 165 | Ga0207696_1003632 | 3300025711 | Bacteria | 6942 |
| 166 | Ga0207713_1002253 | 3300025735 | Bacteria | 14260 |
| 167 | Ga0207710_10050140 | 3300025900 | Bacteria | 1872 |
| 168 | Ga0207680_10026602 | 3300025903 | Bacteria | 3209 |
| 169 | Ga0207680_10080705 | 3300025903 | Bacteria | 2043 |
| 170 | Ga0207647_10004980 | 3300025904 | Bacteria | 9792 |
| 171 | Ga0207647_10029637 | 3300025904 | Bacteria | 3538 |
| 172 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 173 | Ga0207705_10026471 | 3300025909 | Bacteria | 4136 |
| 174 | Ga0207705_10029817 | 3300025909 | Bacteria | 3890 |
| 175 | Ga0207705_10165046 | 3300025909 | Bacteria | 1665 |
| 176 | Ga0207705_10198877 | 3300025909 | Bacteria | 1518 |
| 177 | Ga0207707_10120012 | 3300025912 | Bacteria | 2298 |
| 178 | Ga0207695_10004641 | 3300025913 | Bacteria | 18616 |
| 179 | Ga0207671_10000924 | 3300025914 | Bacteria | 36861 |
| 180 | Ga0207660_10020186 | 3300025917 | Bacteria | 4469 |
| 181 | Ga0207657_10000156 | 3300025919 | Bacteria | 69892 |
| 182 | Ga0207657_10008855 | 3300025919 | Bacteria | 10178 |
| 183 | Ga0207657_10014245 | 3300025919 | Bacteria | 7773 |
| 184 | Ga0207657_10152713 | 3300025919 | Bacteria | 1880 |
| 185 | Ga0207649_10013083 | 3300025920 | Bacteria | 4627 |
| 186 | Ga0207652_10003649 | 3300025921 | Bacteria | 12670 |
| 187 | Ga0207652_10017465 | 3300025921 | Bacteria | 5872 |
| 188 | Ga0207681_10000019 | 3300025923 | Bacteria | 243902 |
| 189 | Ga0207681_10000224 | 3300025923 | Bacteria | 44695 |
| 190 | Ga0207681_10000288 | 3300025923 | Bacteria | 37371 |
| 191 | Ga0207681_10067232 | 3300025923 | Bacteria | 2484 |
| 192 | Ga0207694_10244236 | 3300025924 | Bacteria | 1468 |
| 193 | Ga0207650_10210022 | 3300025925 | Bacteria | 1563 |
| 194 | Ga0207644_10000008 | 3300025931 | Bacteria | 354219 |
| 195 | Ga0207644_10000446 | 3300025931 | Bacteria | 26672 |
| 196 | Ga0207644_10001440 | 3300025931 | Bacteria | 15329 |
| 197 | Ga0207644_10006347 | 3300025931 | Bacteria | 7699 |
| 198 | Ga0207644_10089486 | 3300025931 | Bacteria | 2291 |
| 199 | Ga0207690_10014927 | 3300025932 | Bacteria | 4702 |
| 200 | Ga0207690_10031407 | 3300025932 | Bacteria | 3397 |
| 201 | Ga0207706_10001346 | 3300025933 | Bacteria | 24541 |
| 202 | Ga0207706_10055156 | 3300025933 | Bacteria | 3505 |
| 203 | Ga0207711_10003775 | 3300025941 | Bacteria | 13046 |
| 204 | Ga0207711_10004284 | 3300025941 | Bacteria | 12191 |
| 205 | Ga0207711_10035500 | 3300025941 | Bacteria | 4226 |
| 206 | Ga0207661_10066915 | 3300025944 | Bacteria | 2920 |
| 207 | Ga0207679_10066538 | 3300025945 | Bacteria | 2700 |
| 208 | Ga0207667_10003313 | 3300025949 | Bacteria | 19874 |
| 209 | Ga0207667_10013321 | 3300025949 | Bacteria | 9419 |
| 210 | Ga0207667_10021208 | 3300025949 | Bacteria | 7202 |
| 211 | Ga0207667_10035280 | 3300025949 | Bacteria | 5366 |
| 212 | Ga0207667_10088309 | 3300025949 | Bacteria | 3207 |
| 213 | Ga0207667_10094048 | 3300025949 | Bacteria | 3095 |
| 214 | Ga0207712_10000102 | 3300025961 | Bacteria | 96444 |
| 215 | Ga0207668_10000618 | 3300025972 | Bacteria | 22100 |
| 216 | Ga0207668_10072863 | 3300025972 | Bacteria | 2459 |
| 217 | Ga0207668_10209789 | 3300025972 | Bacteria | 1557 |
| 218 | Ga0207640_10063240 | 3300025981 | Bacteria | 2458 |
| 219 | Ga0207658_10001615 | 3300025986 | Bacteria | 17298 |
| 220 | Ga0207658_10019519 | 3300025986 | Bacteria | 4688 |
| 221 | Ga0207658_10032599 | 3300025986 | Bacteria | 3709 |
| 222 | Ga0207658_10058050 | 3300025986 | Bacteria | 2878 |
| 223 | Ga0207703_10000139 | 3300026035 | Bacteria | 86495 |
| 224 | Ga0207703_10005939 | 3300026035 | Bacteria | 9782 |
| 225 | Ga0207703_10015133 | 3300026035 | Bacteria | 6021 |
| 226 | Ga0207703_10056187 | 3300026035 | Bacteria | 3205 |
| 227 | Ga0207639_10000995 | 3300026041 | Bacteria | 19317 |
| 228 | Ga0207639_10035941 | 3300026041 | Bacteria | 3668 |
| 229 | Ga0207678_10000025 | 3300026067 | Bacteria | 119139 |
| 230 | Ga0207678_10029457 | 3300026067 | Bacteria | 4791 |
| 231 | Ga0207702_10000369 | 3300026078 | Bacteria | 51295 |
| 232 | Ga0207702_10001204 | 3300026078 | Bacteria | 26266 |
| 233 | Ga0207702_10148746 | 3300026078 | Bacteria | 2128 |
| 234 | Ga0207641_10002819 | 3300026088 | Bacteria | 15805 |
| 235 | Ga0207641_10013915 | 3300026088 | Bacteria | 6598 |
| 236 | Ga0207676_10000072 | 3300026095 | Bacteria | 101978 |
| 237 | Ga0207676_10045755 | 3300026095 | Bacteria | 3383 |
| 238 | Ga0207674_10027894 | 3300026116 | Bacteria | 5965 |
| 239 | Ga0207674_10127701 | 3300026116 | Bacteria | 2507 |
| 240 | Ga0207674_10180863 | 3300026116 | Bacteria | 2060 |
| 241 | Ga0207674_10358601 | 3300026116 | Bacteria | 1409 |
| 242 | Ga0207674_10365333 | 3300026116 | Bacteria | 1395 |
| 243 | Ga0207698_10000036 | 3300026142 | Bacteria | 105391 |
| 244 | Ga0207698_10084866 | 3300026142 | Bacteria | 2569 |
| 245 | Ga0207698_10225109 | 3300026142 | Bacteria | 1698 |
| 246 | Ga0209281_1007404 | 3300027111 | Bacteria | 2758 |
| 247 | Ga0209813_10000027 | 3300027866 | Bacteria | 69637 |
| 248 | Ga0209974_10003827 | 3300027876 | Bacteria | 5391 |
| 249 | Ga0209974_10003959 | 3300027876 | Bacteria | 5304 |
| 250 | Ga0268266_10001320 | 3300028379 | Bacteria | 30084 |
| 251 | Ga0268266_10002061 | 3300028379 | Bacteria | 22273 |
| 252 | Ga0268266_10085384 | 3300028379 | Bacteria | 2758 |
| 253 | Ga0268266_10103441 | 3300028379 | Bacteria | 2513 |
| 254 | Ga0268265_10029687 | 3300028380 | Bacteria | 3928 |
| 255 | Ga0268265_10049324 | 3300028380 | Bacteria | 3165 |
| 256 | Ga0268264_10011006 | 3300028381 | Bacteria | 7469 |
| 257 | Ga0268264_10015563 | 3300028381 | Bacteria | 6235 |
| 258 | Ga0268264_10021472 | 3300028381 | Bacteria | 5272 |
| 259 | Ga0316177_1112568 | 3300030731 | Bacteria | 1263 |
| 260 | Ga0265327_10036809 | 3300031251 | Bacteria | 2686 |
| 261 | Ga0307513_10020089 | 3300031456 | Bacteria | 7931 |
| 262 | Ga0307513_10297252 | 3300031456 | Bacteria | 1383 |
| 263 | Ga0307408_100059804 | 3300031548 | Bacteria | 2774 |
| 264 | Ga0307408_100338121 | 3300031548 | Bacteria | 1273 |
| 265 | Ga0307508_10010338 | 3300031616 | Bacteria | 8539 |
| 266 | Ga0307405_10001457 | 3300031731 | Bacteria | 9965 |
| 267 | Ga0307413_10043785 | 3300031824 | Bacteria | 2640 |
| 268 | Ga0307413_10058025 | 3300031824 | Bacteria | 2370 |
| 269 | Ga0307410_10013400 | 3300031852 | Bacteria | 4782 |
| 270 | Ga0307410_10033994 | 3300031852 | Bacteria | 3297 |
| 271 | Ga0307410_10096743 | 3300031852 | Bacteria | 2108 |
| 272 | Ga0307407_10024624 | 3300031903 | Bacteria | 3159 |
| 273 | Ga0307412_10004837 | 3300031911 | Bacteria | 7515 |
| 274 | Ga0307412_10024687 | 3300031911 | Bacteria | 3713 |
| 275 | Ga0307412_10037132 | 3300031911 | Bacteria | 3128 |
| 276 | Ga0307409_100118205 | 3300031995 | Bacteria | 2238 |
| 277 | Ga0307409_100262187 | 3300031995 | Bacteria | 1587 |
| 278 | Ga0307416_100008298 | 3300032002 | Bacteria | 6687 |
| 279 | Ga0307416_100060687 | 3300032002 | Bacteria | 3081 |
| 280 | Ga0307416_100073403 | 3300032002 | Bacteria | 2852 |
| 281 | Ga0307416_100077340 | 3300032002 | Bacteria | 2794 |
| 282 | Ga0307414_10026241 | 3300032004 | Bacteria | 3747 |
| 283 | Ga0307414_10029300 | 3300032004 | Bacteria | 3581 |
| 284 | Ga0307414_10040269 | 3300032004 | Bacteria | 3154 |
| 285 | Ga0307414_10090510 | 3300032004 | Bacteria | 2271 |
| 286 | Ga0307414_10121763 | 3300032004 | Bacteria | 2007 |
| 287 | Ga0307414_10128413 | 3300032004 | Bacteria | 1963 |
| 288 | Ga0307411_10021405 | 3300032005 | Bacteria | 3783 |
| 289 | Ga0307411_10054774 | 3300032005 | Bacteria | 2621 |
| 290 | Ga0307411_10078747 | 3300032005 | Bacteria | 2260 |
| 291 | Ga0307411_10414222 | 3300032005 | Bacteria | 1117 |
| 292 | Ga0307415_100053359 | 3300032126 | Bacteria | 2754 |
| 293 | Ga0307415_100128122 | 3300032126 | Bacteria | 1916 |
| 294 | Ga0307510_10000369 | 3300033180 | Bacteria | 42647 |
| 295 | Ga0395905_0047981 | 3300037471 | Bacteria | 4002 |
| 296 | Ga0395901_0034194 | 3300038443 | Bacteria | 5249 |
| 297 | Ga0439462_0001498 | 3300042015 | Bacteria | 5214 |
| 298 | Ga0451576_0181423 | 3300045051 | Bacteria | 2198 |
| 299 | Ga0466958_0192557 | 3300045836 | Bacteria | 1296 |
| 300 | Ga0495627_000198 | 3300046453 | Bacteria | 65997 |
| 301 | Ga0495650_0000995 | 3300046471 | Bacteria | 32148 |
| 302 | Ga0495650_0003812 | 3300046471 | Bacteria | 10726 |
| 303 | Ga0495585_0165050 | 3300046492 | Bacteria | 1147 |
| 304 | Ga0495596_0000119 | 3300046500 | Bacteria | 54166 |
| 305 | Ga0495596_0001077 | 3300046500 | Bacteria | 16192 |
| 306 | Ga0495607_0007039 | 3300046501 | Bacteria | 7821 |
| 307 | Ga0495583_0001362 | 3300046506 | Bacteria | 25203 |
| 308 | Ga0495583_0014773 | 3300046506 | Bacteria | 4283 |
| 309 | Ga0495583_0039881 | 3300046506 | Bacteria | 2209 |
| 310 | Ga0495606_0024329 | 3300046507 | Bacteria | 4367 |
| 311 | Ga0495606_0073295 | 3300046507 | Bacteria | 2149 |
| 312 | Ga0495610_0000050 | 3300046512 | Bacteria | 143781 |
| 313 | Ga0495610_0000352 | 3300046512 | Bacteria | 48332 |
| 314 | Ga0495610_0008942 | 3300046512 | Bacteria | 6408 |
| 315 | Ga0495632_0003354 | 3300046519 | Bacteria | 11413 |
| 316 | Ga0495643_0000036 | 3300046522 | Bacteria | 238374 |
| 317 | Ga0495643_0011737 | 3300046522 | Bacteria | 5316 |
| 318 | Ga0495643_0022436 | 3300046522 | Bacteria | 3602 |
| 319 | Ga0495643_0028242 | 3300046522 | Bacteria | 3147 |
| 320 | Ga0495643_0033021 | 3300046522 | Bacteria | 2867 |
| 321 | Ga0495643_0083313 | 3300046522 | Bacteria | 1660 |
| 322 | Ga0495648_0025497 | 3300046524 | Bacteria | 4001 |
| 323 | Ga0495654_0030697 | 3300046530 | Bacteria | 2733 |
| 324 | Ga0495598_0009027 | 3300046537 | Bacteria | 2342 |
| 325 | Ga0495633_0051995 | 3300046558 | Bacteria | 1930 |
| 326 | Ga0495668_0000234 | 3300046616 | Bacteria | 79147 |
| 327 | Ga0495625_0000195 | 3300046660 | Bacteria | 96493 |
| 328 | Ga0495625_0014033 | 3300046660 | Bacteria | 6413 |
| 329 | Ga0495625_0018549 | 3300046660 | Bacteria | 5426 |
| 330 | Ga0495671_0064128 | 3300046692 | Bacteria | 1809 |
| 331 | Ga0495673_0099421 | 3300047469 | Bacteria | 1178 |
| 332 | Ga0495681_0000095 | 3300047470 | Bacteria | 76975 |
| 333 | Ga0495615_0000158 | 3300048090 | Bacteria | 17114 |
| 334 | Ga0495626_0001951 | 3300048091 | Bacteria | 15322 |
| 335 | Ga0496100_0033018 | 3300048903 | Bacteria | 3234 |
| 336 | Ga0496101_0009605 | 3300048904 | Bacteria | 6363 |
| 337 | Ga0496102_0000768 | 3300048905 | Bacteria | 31216 |
| 338 | Ga0496103_0001148 | 3300048906 | Bacteria | 18311 |
| 339 | Ga0496103_0017222 | 3300048906 | Bacteria | 4322 |
| 340 | Ga0496103_0058475 | 3300048906 | Bacteria | 2395 |
| 341 | Ga0496104_0001773 | 3300048907 | Bacteria | 18662 |
| 342 | Ga0496104_0102688 | 3300048907 | Bacteria | 2738 |
| 343 | Ga0496105_0006834 | 3300048908 | Bacteria | 8774 |
| 344 | Ga0496105_0079844 | 3300048908 | Bacteria | 2701 |
| 345 | Ga0496106_0004278 | 3300048909 | Bacteria | 10617 |
| 346 | Ga0496106_0124046 | 3300048909 | Bacteria | 2021 |
| 347 | Ga0496107_0001239 | 3300048910 | Bacteria | 15597 |
| 348 | Ga0496107_0046768 | 3300048910 | Bacteria | 3115 |
| 349 | Ga0496108_0012158 | 3300048911 | Bacteria | 7000 |
| 350 | Ga0496109_0022253 | 3300048912 | Bacteria | 5614 |
| 351 | Ga0496109_0130154 | 3300048912 | Bacteria | 2348 |
| 352 | Ga0496110_0035256 | 3300048913 | Bacteria | 4340 |
| 353 | Ga0496110_0044717 | 3300048913 | Bacteria | 3868 |
| 354 | Ga0496111_0084557 | 3300048914 | Bacteria | 2319 |
| 355 | Ga0496112_0023353 | 3300048915 | Bacteria | 5908 |
| 356 | Ga0496113_0003272 | 3300048916 | Bacteria | 9668 |
| 357 | Ga0496113_0028190 | 3300048916 | Bacteria | 4036 |
| 358 | Ga0496113_0090086 | 3300048916 | Bacteria | 2362 |
| 359 | Ga0496114_0014507 | 3300048917 | Bacteria | 6329 |
| 360 | Ga0496116_0000149 | 3300048919 | Bacteria | 141841 |
| 361 | Ga0496116_0043247 | 3300048919 | Bacteria | 3071 |
| 362 | Ga0496117_0001020 | 3300048920 | Bacteria | 42763 |
| 363 | Ga0496117_0032449 | 3300048920 | Bacteria | 3967 |
| 364 | Ga0496117_0216112 | 3300048920 | Bacteria | 1071 |
| 365 | Ga0496118_0067248 | 3300048921 | Bacteria | 2610 |
| 366 | Ga0496118_0098872 | 3300048921 | Bacteria | 1980 |
| 367 | Ga0496119_0078041 | 3300048922 | Bacteria | 1916 |
| 368 | Ga0496120_0010787 | 3300048923 | Bacteria | 6330 |
| 369 | Ga0496120_0047121 | 3300048923 | Bacteria | 2487 |
| 370 | Ga0496121_0000024 | 3300048924 | Bacteria | 462959 |
| 371 | Ga0496121_0001791 | 3300048924 | Bacteria | 34731 |
| 372 | Ga0496121_0026615 | 3300048924 | Bacteria | 5440 |
| 373 | Ga0496121_0041460 | 3300048924 | Bacteria | 4021 |
| 374 | Ga0496122_0008900 | 3300048925 | Bacteria | 10694 |
| 375 | Ga0496122_0022271 | 3300048925 | Bacteria | 5638 |
| 376 | Ga0496122_0026553 | 3300048925 | Bacteria | 4986 |
| 377 | Ga0496122_0099811 | 3300048925 | Bacteria | 1945 |
| 378 | Ga0496123_0000830 | 3300048926 | Bacteria | 49505 |
| 379 | Ga0496123_0004529 | 3300048926 | Bacteria | 14518 |
| 380 | Ga0496123_0085588 | 3300048926 | Bacteria | 1895 |
| 381 | Ga0496123_0086223 | 3300048926 | Bacteria | 1885 |
| 382 | Ga0496124_0003326 | 3300048927 | Bacteria | 19799 |
| 383 | Ga0496124_0004393 | 3300048927 | Bacteria | 16474 |
| 384 | Ga0496124_0027409 | 3300048927 | Bacteria | 5114 |
| 385 | Ga0496125_0005390 | 3300048928 | Bacteria | 14262 |
| 386 | Ga0496126_0000051 | 3300048929 | Bacteria | 313169 |
| 387 | Ga0496126_0000261 | 3300048929 | Bacteria | 112027 |
| 388 | Ga0496126_0003215 | 3300048929 | Bacteria | 20931 |
| 389 | Ga0496126_0031715 | 3300048929 | Bacteria | 4987 |
| 390 | Ga0496126_0052165 | 3300048929 | Bacteria | 3719 |
| 391 | Ga0496126_0204859 | 3300048929 | Bacteria | 1664 |
| 392 | Ga0501033_0088852 | 3300049570 | Bacteria | 2260 |
| 393 | Ga0501033_0298694 | 3300049570 | Bacteria | 1134 |
| 394 | Ga0501034_0028784 | 3300049571 | Bacteria | 5652 |
| 395 | Ga0501037_0021339 | 3300049573 | Bacteria | 4784 |
| 396 | Ga0501038_0041175 | 3300049574 | Bacteria | 4029 |
| 397 | Ga0501038_0125105 | 3300049574 | Bacteria | 2117 |
| 398 | Ga0501039_0034162 | 3300049575 | Bacteria | 3924 |
| 399 | Ga0501043_0203801 | 3300049579 | Bacteria | 1534 |
| 400 | Ga0501047_0166362 | 3300049581 | Bacteria | 2075 |
| 401 | Ga0501047_0175016 | 3300049581 | Bacteria | 2014 |
| 402 | Ga0501223_000016 | 3300049663 | Bacteria | 68443 |
| 403 | Ga0501235_003688 | 3300049669 | Bacteria | 3308 |
| 404 | Ga0501246_000930 | 3300049676 | Bacteria | 2188 |
| 405 | Ga0501225_0000013 | 3300049705 | Bacteria | 71839 |
| 406 | Ga0501225_0004736 | 3300049705 | Bacteria | 4036 |
| 407 | Ga0501245_002499 | 3300049708 | Bacteria | 2454 |
| 408 | Ga0501282_003798 | 3300049778 | Bacteria | 1623 |
| 409 | Ga0501035_0028457 | 3300049822 | Bacteria | 5099 |
| 410 | Ga0501044_0003900 | 3300049823 | Bacteria | 16715 |
| 411 | Ga0501044_0064035 | 3300049823 | Bacteria | 3754 |
| 412 | Ga0501044_0153891 | 3300049823 | Bacteria | 2280 |
| 413 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 414 | nmdc:mga03683_4448_c1 | 3300050489 | Bacteria | 4651 |
| 415 | nmdc:mga03683_94_c1 | 3300050489 | Bacteria | 32220 |
| 416 | nmdc:mga03n38_591_c1 | 3300050490 | Bacteria | 7911 |
| 417 | nmdc:mga00v17_14785_c1 | 3300050491 | Bacteria | 4366 |
| 418 | nmdc:mga00v17_47906_c1 | 3300050491 | Bacteria | 2590 |
| 419 | nmdc:mga00v17_7063_c1 | 3300050491 | Bacteria | 5978 |
| 420 | nmdc:mga0k408_125529_c1 | 3300050493 | Bacteria | 1522 |
| 421 | nmdc:mga0k408_16895_c1 | 3300050493 | Bacteria | 4057 |
| 422 | nmdc:mga0k408_41451_c1 | 3300050493 | Bacteria | 2650 |
| 423 | nmdc:mga0k408_622_c1 | 3300050493 | Bacteria | 19548 |
| 424 | nmdc:mga0k408_8571_c2 | 3300050493 | Bacteria | 3206 |
| 425 | nmdc:mga06z11_300_c1 | 3300050494 | Bacteria | 19031 |
| 426 | nmdc:mga04h51_1373_c1 | 3300050495 | Bacteria | 5604 |
| 427 | nmdc:mga07m45_14397_c1 | 3300050496 | Bacteria | 4212 |
| 428 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 429 | nmdc:mga07m45_32180_c1 | 3300050496 | Bacteria | 2909 |
| 430 | nmdc:mga07m45_91_c2 | 3300050496 | Bacteria | 3132 |
| 431 | nmdc:mga07m45_9_c1 | 3300050496 | Bacteria | 171776 |
| 432 | nmdc:mga0sz30_50_c1 | 3300050516 | Bacteria | 43433 |
| 433 | nmdc:mga0sz30_7108_c1 | 3300050516 | Bacteria | 4186 |
| 434 | Ga0500643_000005 | 3300053087 | Bacteria | 539775 |
| 435 | Ga0500643_003354 | 3300053087 | Bacteria | 7748 |
| 436 | Ga0500566_0036445 | 3300053094 | Bacteria | 2853 |
| 437 | Ga0500641_0087517 | 3300053096 | Bacteria | 1327 |
| 438 | Ga0500595_017151 | 3300053119 | Bacteria | 2680 |
| 439 | Ga0500607_000473 | 3300053121 | Bacteria | 38991 |
| 440 | Ga0500607_000541 | 3300053121 | Bacteria | 36492 |
| 441 | Ga0500608_000438 | 3300053122 | Bacteria | 15683 |
| 442 | Ga0500614_004745 | 3300053123 | Bacteria | 2859 |
| 443 | Ga0500559_0001290 | 3300053136 | Bacteria | 14517 |
| 444 | Ga0500559_0003774 | 3300053136 | Bacteria | 7357 |
| 445 | Ga0500559_0039672 | 3300053136 | Bacteria | 2049 |
| 446 | Ga0500564_002230 | 3300053138 | Bacteria | 7082 |
| 447 | Ga0500568_0001218 | 3300053139 | Bacteria | 17161 |
| 448 | Ga0500568_0070149 | 3300053139 | Bacteria | 1343 |
| 449 | Ga0500590_000274 | 3300053148 | Bacteria | 16192 |
| 450 | Ga0500616_0090518 | 3300053153 | Bacteria | 1516 |
| 451 | Ga0500622_0000587 | 3300053156 | Bacteria | 33059 |
| 452 | Ga0500627_0000070 | 3300053158 | Bacteria | 41863 |
| 453 | Ga0500627_0043382 | 3300053158 | Bacteria | 1939 |
| 454 | Ga0500627_0132523 | 3300053158 | Bacteria | 1126 |
| 455 | Ga0500637_0001632 | 3300053178 | Bacteria | 9626 |
| 456 | Ga0500567_000200 | 3300053723 | Bacteria | 17563 |
| 457 | Ga0500625_000014 | 3300053729 | Bacteria | 109364 |
| 458 | Ga0500645_007838 | 3300053730 | Bacteria | 3691 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2896253425 | 2896253492 | 313 |
| 2 | 3300050493 | nmdc:mga0k408_8571_c2 | nmdc:mga0k408_8571_c2_2130_3095 | 314 |
| 3 | 3300032004 | Ga0307414_10040269 | Ga0307414_100402692 | 315 |
| 4 | 3300046522 | Ga0495643_0011737 | Ga0495643_0011737_211_1167 | 318 |
| 5 | 3300009177 | Ga0105248_10129371 | Ga0105248_101293713 | 320 |
| 6 | 3300042015 | Ga0439462_0001498 | Ga0439462_0001498_2901_3863 | 320 |
| 7 | 3300046453 | Ga0495627_000198 | Ga0495627_000198_14689_15651 | 320 |
| 8 | 3300046471 | Ga0495650_0003812 | Ga0495650_0003812_7950_8912 | 320 |
| 9 | 3300046512 | Ga0495610_0000050 | Ga0495610_0000050_110410_111372 | 320 |
| 10 | 3300047470 | Ga0495681_0000095 | Ga0495681_0000095_14711_15673 | 320 |
| 11 | 3300048906 | Ga0496103_0058475 | Ga0496103_0058475_75_1037 | 320 |
| 12 | 3300048907 | Ga0496104_0102688 | Ga0496104_0102688_181_1143 | 320 |
| 13 | 3300048908 | Ga0496105_0079844 | Ga0496105_0079844_410_1372 | 320 |
| 14 | 3300048909 | Ga0496106_0004278 | Ga0496106_0004278_4748_5710 | 320 |
| 15 | 3300048910 | Ga0496107_0001239 | Ga0496107_0001239_98_1060 | 320 |
| 16 | 3300048914 | Ga0496111_0084557 | Ga0496111_0084557_712_1674 | 320 |
| 17 | 3300048916 | Ga0496113_0003272 | Ga0496113_0003272_7946_8908 | 320 |
| 18 | 3300048924 | Ga0496121_0000024 | Ga0496121_0000024_184928_185890 | 320 |
| 19 | 3300049823 | Ga0501044_0153891 | Ga0501044_0153891_307_1269 | 320 |
| 20 | 3300050489 | nmdc:mga03683_94_c1 | nmdc:mga03683_94_c1_12783_13745 | 320 |
| 21 | 3300050491 | nmdc:mga00v17_47906_c1 | nmdc:mga00v17_47906_c1_21_983 | 320 |
| 22 | 3300050494 | nmdc:mga06z11_300_c1 | nmdc:mga06z11_300_c1_2430_3392 | 320 |
| 23 | 3300050495 | nmdc:mga04h51_1373_c1 | nmdc:mga04h51_1373_c1_1016_1978 | 320 |
| 24 | 3300050496 | nmdc:mga07m45_9_c1 | nmdc:mga07m45_9_c1_126717_127679 | 320 |
| 25 | 3300050516 | nmdc:mga0sz30_50_c1 | nmdc:mga0sz30_50_c1_30932_31894 | 320 |
| 26 | 3300053121 | Ga0500607_000541 | Ga0500607_000541_4638_5600 | 320 |
| 27 | 3300009177 | Ga0105248_10000026 | Ga0105248_1000002648 | 321 |
| 28 | 3300013306 | Ga0163162_10009714 | Ga0163162_100097148 | 321 |
| 29 | 3300046558 | Ga0495633_0051995 | Ga0495633_0051995_908_1873 | 321 |
| 30 | 3300053158 | Ga0500627_0132523 | Ga0500627_0132523_124_1116 | 321 |
| 31 | iso_pu_bacteria | 2895880812 | 2895881043 | 321 |
| 32 | 3300045836 | Ga0466958_0192557 | Ga0466958_0192557_99_1070 | 322 |
| 33 | 3300032005 | Ga0307411_10414222 | Ga0307411_104142222 | 323 |
| 34 | 3300009978 | Ga0105148_100032 | Ga0105148_10003213 | 324 |
| 35 | 3300047469 | Ga0495673_0099421 | Ga0495673_0099421_188_1165 | 324 |
| 36 | 3300048911 | Ga0496108_0012158 | Ga0496108_0012158_2613_3587 | 324 |
| 37 | 3300048913 | Ga0496110_0044717 | Ga0496110_0044717_1967_2941 | 324 |
| 38 | 3300048916 | Ga0496113_0090086 | Ga0496113_0090086_906_1880 | 324 |
| 39 | 3300048926 | Ga0496123_0086223 | Ga0496123_0086223_796_1770 | 324 |
| 40 | 3300048913 | Ga0496110_0035256 | Ga0496110_0035256_1822_2820 | 327 |
| 41 | 3300009545 | Ga0105237_10074642 | Ga0105237_100746422 | 331 |
| 42 | 3300046492 | Ga0495585_0165050 | Ga0495585_0165050_34_1029 | 331 |
| 43 | iso_pu_bacteria | 2896184354 | 2896186152 | 334 |
| 44 | 3300006195 | Ga0075366_10088431 | Ga0075366_100884312 | 335 |
| 45 | iso_pu_bacteria | 2643221560 | 2643819221 | 336 |
| 46 | iso_pu_bacteria | 2643221588 | 2643951098 | 337 |
| 47 | iso_pu_bacteria | 2818991438 | 2819551074 | 337 |
| 48 | iso_pu_bacteria | 2882806704 | 2882809271 | 337 |
| 49 | iso_pu_bacteria | 2919138771 | 2919138897 | 337 |
| 50 | iso_pu_bacteria | 3000865235 | 3000867415 | 337 |
| 51 | iso_pu_bacteria | 8054302542 | 8054304009 | 337 |
| 52 | 3300005327 | Ga0070658_10121692 | Ga0070658_101216922 | 338 |
| 53 | 3300005339 | Ga0070660_100112385 | Ga0070660_1001123852 | 338 |
| 54 | 3300005455 | Ga0070663_100060112 | Ga0070663_1000601123 | 338 |
| 55 | 3300025304 | Ga0209257_1001563 | Ga0209257_100156324 | 338 |
| 56 | 3300025909 | Ga0207705_10165046 | Ga0207705_101650462 | 338 |
| 57 | 3300025909 | Ga0207705_10198877 | Ga0207705_101988772 | 338 |
| 58 | 3300025914 | Ga0207671_10000924 | Ga0207671_1000092428 | 338 |
| 59 | 3300025919 | Ga0207657_10014245 | Ga0207657_100142453 | 338 |
| 60 | 3300032004 | Ga0307414_10029300 | Ga0307414_100293003 | 338 |
| 61 | 3300049570 | Ga0501033_0088852 | Ga0501033_0088852_1169_2194 | 338 |
| 62 | 3300049571 | Ga0501034_0028784 | Ga0501034_0028784_642_1667 | 338 |
| 63 | 3300049573 | Ga0501037_0021339 | Ga0501037_0021339_461_1486 | 338 |
| 64 | 3300049574 | Ga0501038_0041175 | Ga0501038_0041175_1714_2739 | 338 |
| 65 | 3300049574 | Ga0501038_0125105 | Ga0501038_0125105_640_1662 | 338 |
| 66 | 3300049575 | Ga0501039_0034162 | Ga0501039_0034162_1706_2731 | 338 |
| 67 | 3300049579 | Ga0501043_0203801 | Ga0501043_0203801_19_1044 | 338 |
| 68 | 3300049581 | Ga0501047_0166362 | Ga0501047_0166362_490_1515 | 338 |
| 69 | 3300049822 | Ga0501035_0028457 | Ga0501035_0028457_676_1701 | 338 |
| 70 | 3300049823 | Ga0501044_0064035 | Ga0501044_0064035_1303_2328 | 338 |
| 71 | iso_pu_bacteria | 2510917021 | 2511129832 | 338 |
| 72 | iso_pu_bacteria | 2643221563 | 2643835084 | 338 |
| 73 | iso_pu_bacteria | 2643221608 | 2644056011 | 338 |
| 74 | iso_pu_bacteria | 2738541275 | 2738710466 | 338 |
| 75 | iso_pu_bacteria | 2738541301 | 2738848891 | 338 |
| 76 | iso_pu_bacteria | 2738541304 | 2738864620 | 338 |
| 77 | iso_pu_bacteria | 2738543022 | 2739297138 | 338 |
| 78 | iso_pu_bacteria | 2738543033 | 2739358816 | 338 |
| 79 | iso_pu_bacteria | 2739367664 | 2739650838 | 338 |
| 80 | iso_pu_bacteria | 2739367865 | 2740029311 | 338 |
| 81 | iso_pu_bacteria | 2848297114 | 2848297951 | 338 |
| 82 | iso_pu_bacteria | 2852653556 | 2852655898 | 338 |
| 83 | iso_pu_bacteria | 2852680915 | 2852683048 | 338 |
| 84 | iso_pu_bacteria | 2928100450 | 2928100566 | 338 |
| 85 | iso_pu_bacteria | 2928959182 | 2928960629 | 338 |
| 86 | 3300003781 | Ga0055536_1002684 | Ga0055536_100268411 | 339 |
| 87 | 3300003791 | Ga0055530_10005156 | Ga0055530_100051563 | 339 |
| 88 | 3300003794 | Ga0055531_10000492 | Ga0055531_100004922 | 339 |
| 89 | 3300003794 | Ga0055531_10009125 | Ga0055531_100091256 | 339 |
| 90 | 3300005618 | Ga0068864_100000145 | Ga0068864_10000014557 | 339 |
| 91 | 3300005842 | Ga0068858_100000268 | Ga0068858_10000026811 | 339 |
| 92 | 3300009177 | Ga0105248_10008523 | Ga0105248_1000852311 | 339 |
| 93 | 3300013306 | Ga0163162_10010851 | Ga0163162_100108513 | 339 |
| 94 | 3300013306 | Ga0163162_10079146 | Ga0163162_100791463 | 339 |
| 95 | 3300025291 | Ga0209675_1000638 | Ga0209675_100063819 | 339 |
| 96 | 3300025292 | Ga0209676_1000897 | Ga0209676_100089722 | 339 |
| 97 | 3300025292 | Ga0209676_1001537 | Ga0209676_100153722 | 339 |
| 98 | 3300025294 | Ga0209025_1005555 | Ga0209025_100555511 | 339 |
| 99 | 3300025298 | Ga0209050_1000113 | Ga0209050_10001137 | 339 |
| 100 | 3300025304 | Ga0209257_1000083 | Ga0209257_100008316 | 339 |
| 101 | 3300025304 | Ga0209257_1000330 | Ga0209257_10003306 | 339 |
| 102 | 3300025315 | Ga0207697_10003663 | Ga0207697_100036638 | 339 |
| 103 | 3300025941 | Ga0207711_10003775 | Ga0207711_1000377513 | 339 |
| 104 | 3300026035 | Ga0207703_10000139 | Ga0207703_1000013939 | 339 |
| 105 | 3300026095 | Ga0207676_10000072 | Ga0207676_1000007285 | 339 |
| 106 | 3300031456 | Ga0307513_10020089 | Ga0307513_100200897 | 339 |
| 107 | 3300031456 | Ga0307513_10297252 | Ga0307513_102972521 | 339 |
| 108 | 3300031911 | Ga0307412_10037132 | Ga0307412_100371324 | 339 |
| 109 | 3300032004 | Ga0307414_10026241 | Ga0307414_100262412 | 339 |
| 110 | 3300032004 | Ga0307414_10090510 | Ga0307414_100905103 | 339 |
| 111 | 3300032004 | Ga0307414_10128413 | Ga0307414_101284132 | 339 |
| 112 | 3300033180 | Ga0307510_10000369 | Ga0307510_1000036912 | 339 |
| 113 | 3300037471 | Ga0395905_0047981 | Ga0395905_0047981_518_1543 | 339 |
| 114 | 3300038443 | Ga0395901_0034194 | Ga0395901_0034194_1076_2101 | 339 |
| 115 | 3300046471 | Ga0495650_0000995 | Ga0495650_0000995_17575_18618 | 339 |
| 116 | 3300046506 | Ga0495583_0001362 | Ga0495583_0001362_22985_24028 | 339 |
| 117 | 3300046506 | Ga0495583_0014773 | Ga0495583_0014773_2833_3858 | 339 |
| 118 | 3300046522 | Ga0495643_0083313 | Ga0495643_0083313_133_1176 | 339 |
| 119 | 3300046524 | Ga0495648_0025497 | Ga0495648_0025497_2269_3312 | 339 |
| 120 | 3300046530 | Ga0495654_0030697 | Ga0495654_0030697_873_1901 | 339 |
| 121 | 3300046616 | Ga0495668_0000234 | Ga0495668_0000234_14886_15914 | 339 |
| 122 | 3300046660 | Ga0495625_0000195 | Ga0495625_0000195_22894_23922 | 339 |
| 123 | 3300046660 | Ga0495625_0018549 | Ga0495625_0018549_1323_2348 | 339 |
| 124 | 3300048929 | Ga0496126_0204859 | Ga0496126_0204859_530_1558 | 339 |
| 125 | 3300053139 | Ga0500568_0001218 | Ga0500568_0001218_1603_2631 | 339 |
| 126 | 3300053158 | Ga0500627_0000070 | Ga0500627_0000070_12584_13612 | 339 |
| 127 | 3300053158 | Ga0500627_0043382 | Ga0500627_0043382_250_1278 | 339 |
| 128 | 3300002075 | JGI24738J21930_10021438 | JGI24738J21930_100214382 | 340 |
| 129 | 3300005329 | Ga0070683_100026685 | Ga0070683_1000266853 | 340 |
| 130 | 3300005336 | Ga0070680_100006749 | Ga0070680_1000067498 | 340 |
| 131 | 3300005337 | Ga0070682_100055656 | Ga0070682_1000556562 | 340 |
| 132 | 3300005344 | Ga0070661_100011548 | Ga0070661_1000115484 | 340 |
| 133 | 3300005366 | Ga0070659_100024854 | Ga0070659_1000248543 | 340 |
| 134 | 3300005455 | Ga0070663_100050582 | Ga0070663_1000505823 | 340 |
| 135 | 3300005457 | Ga0070662_100138316 | Ga0070662_1001383161 | 340 |
| 136 | 3300005458 | Ga0070681_10029381 | Ga0070681_100293817 | 340 |
| 137 | 3300005539 | Ga0068853_100000627 | Ga0068853_10000062723 | 340 |
| 138 | 3300005563 | Ga0068855_100036684 | Ga0068855_1000366843 | 340 |
| 139 | 3300005563 | Ga0068855_100084549 | Ga0068855_1000845493 | 340 |
| 140 | 3300005564 | Ga0070664_100024807 | Ga0070664_1000248074 | 340 |
| 141 | 3300005564 | Ga0070664_100102832 | Ga0070664_1001028323 | 340 |
| 142 | 3300005577 | Ga0068857_100043993 | Ga0068857_1000439933 | 340 |
| 143 | 3300005614 | Ga0068856_100172821 | Ga0068856_1001728213 | 340 |
| 144 | 3300005834 | Ga0068851_10039174 | Ga0068851_100391742 | 340 |
| 145 | 3300011119 | Ga0105246_10000074 | Ga0105246_1000007414 | 340 |
| 146 | 3300013100 | Ga0157373_10048756 | Ga0157373_100487564 | 340 |
| 147 | 3300013102 | Ga0157371_10001651 | Ga0157371_1000165132 | 340 |
| 148 | 3300013102 | Ga0157371_10030900 | Ga0157371_100309001 | 340 |
| 149 | 3300013104 | Ga0157370_10096838 | Ga0157370_100968383 | 340 |
| 150 | 3300013105 | Ga0157369_10000384 | Ga0157369_1000038441 | 340 |
| 151 | 3300013307 | Ga0157372_10004422 | Ga0157372_100044223 | 340 |
| 152 | 3300013307 | Ga0157372_10181667 | Ga0157372_101816671 | 340 |
| 153 | 3300025909 | Ga0207705_10026471 | Ga0207705_100264713 | 340 |
| 154 | 3300025912 | Ga0207707_10120012 | Ga0207707_101200123 | 340 |
| 155 | 3300025917 | Ga0207660_10020186 | Ga0207660_100201862 | 340 |
| 156 | 3300025919 | Ga0207657_10000156 | Ga0207657_100001563 | 340 |
| 157 | 3300025920 | Ga0207649_10013083 | Ga0207649_100130831 | 340 |
| 158 | 3300025921 | Ga0207652_10017465 | Ga0207652_100174655 | 340 |
| 159 | 3300025932 | Ga0207690_10014927 | Ga0207690_100149274 | 340 |
| 160 | 3300025932 | Ga0207690_10031407 | Ga0207690_100314071 | 340 |
| 161 | 3300025933 | Ga0207706_10001346 | Ga0207706_1000134632 | 340 |
| 162 | 3300025933 | Ga0207706_10055156 | Ga0207706_100551564 | 340 |
| 163 | 3300025944 | Ga0207661_10066915 | Ga0207661_100669153 | 340 |
| 164 | 3300025945 | Ga0207679_10066538 | Ga0207679_100665383 | 340 |
| 165 | 3300025949 | Ga0207667_10003313 | Ga0207667_1000331311 | 340 |
| 166 | 3300025949 | Ga0207667_10021208 | Ga0207667_100212088 | 340 |
| 167 | 3300025949 | Ga0207667_10088309 | Ga0207667_100883092 | 340 |
| 168 | 3300026041 | Ga0207639_10035941 | Ga0207639_100359414 | 340 |
| 169 | 3300026067 | Ga0207678_10029457 | Ga0207678_100294573 | 340 |
| 170 | 3300026078 | Ga0207702_10148746 | Ga0207702_101487461 | 340 |
| 171 | 3300026116 | Ga0207674_10127701 | Ga0207674_101277011 | 340 |
| 172 | 3300026116 | Ga0207674_10358601 | Ga0207674_103586011 | 340 |
| 173 | 3300026116 | Ga0207674_10365333 | Ga0207674_103653332 | 340 |
| 174 | 3300032005 | Ga0307411_10054774 | Ga0307411_100547742 | 340 |
| 175 | 3300048917 | Ga0496114_0014507 | Ga0496114_0014507_269_1291 | 340 |
| 176 | 3300049570 | Ga0501033_0298694 | Ga0501033_0298694_99_1121 | 340 |
| 177 | 2162886007 | SwRhRL2b_contig_780398 | SwRhRL2b_0866.00007260 | 341 |
| 178 | 3300001904 | JGI24736J21556_1001522 | JGI24736J21556_10015222 | 341 |
| 179 | 3300001990 | JGI24737J22298_10000792 | JGI24737J22298_1000079211 | 341 |
| 180 | 3300002067 | JGI24735J21928_10000784 | JGI24735J21928_1000078413 | 341 |
| 181 | 3300002075 | JGI24738J21930_10004957 | JGI24738J21930_100049574 | 341 |
| 182 | 3300002459 | JGI24751J29686_10000270 | JGI24751J29686_100002704 | 341 |
| 183 | 3300003791 | Ga0055530_10012841 | Ga0055530_100128412 | 341 |
| 184 | 3300005289 | Ga0065704_10003765 | Ga0065704_100037658 | 341 |
| 185 | 3300005289 | Ga0065704_10070157 | Ga0065704_1007015786 | 341 |
| 186 | 3300005289 | Ga0065704_10075725 | Ga0065704_100757252 | 341 |
| 187 | 3300005295 | Ga0065707_10087470 | Ga0065707_100874702 | 341 |
| 188 | 3300005327 | Ga0070658_10000811 | Ga0070658_1000081120 | 341 |
| 189 | 3300005327 | Ga0070658_10130414 | Ga0070658_101304143 | 341 |
| 190 | 3300005335 | Ga0070666_10011761 | Ga0070666_100117615 | 341 |
| 191 | 3300005335 | Ga0070666_10044153 | Ga0070666_100441534 | 341 |
| 192 | 3300005339 | Ga0070660_100029871 | Ga0070660_1000298714 | 341 |
| 193 | 3300005344 | Ga0070661_100040788 | Ga0070661_1000407883 | 341 |
| 194 | 3300005347 | Ga0070668_100003911 | Ga0070668_1000039115 | 341 |
| 195 | 3300005347 | Ga0070668_100115461 | Ga0070668_1001154614 | 341 |
| 196 | 3300005347 | Ga0070668_100173312 | Ga0070668_1001733121 | 341 |
| 197 | 3300005347 | Ga0070668_100190402 | Ga0070668_1001904022 | 341 |
| 198 | 3300005353 | Ga0070669_100000291 | Ga0070669_1000002915 | 341 |
| 199 | 3300005353 | Ga0070669_100057741 | Ga0070669_1000577412 | 341 |
| 200 | 3300005355 | Ga0070671_100000005 | Ga0070671_10000000564 | 341 |
| 201 | 3300005355 | Ga0070671_100008960 | Ga0070671_1000089606 | 341 |
| 202 | 3300005355 | Ga0070671_100016614 | Ga0070671_1000166143 | 341 |
| 203 | 3300005355 | Ga0070671_100122127 | Ga0070671_1001221271 | 341 |
| 204 | 3300005367 | Ga0070667_100000160 | Ga0070667_10000016049 | 341 |
| 205 | 3300005367 | Ga0070667_100032565 | Ga0070667_1000325653 | 341 |
| 206 | 3300005455 | Ga0070663_100001281 | Ga0070663_10000128118 | 341 |
| 207 | 3300005548 | Ga0070665_100000101 | Ga0070665_10000010197 | 341 |
| 208 | 3300005563 | Ga0068855_100006162 | Ga0068855_1000061624 | 341 |
| 209 | 3300005563 | Ga0068855_100076452 | Ga0068855_1000764526 | 341 |
| 210 | 3300005614 | Ga0068856_100013169 | Ga0068856_1000131694 | 341 |
| 211 | 3300005616 | Ga0068852_100000259 | Ga0068852_10000025929 | 341 |
| 212 | 3300005617 | Ga0068859_100012366 | Ga0068859_1000123664 | 341 |
| 213 | 3300005617 | Ga0068859_100097647 | Ga0068859_1000976473 | 341 |
| 214 | 3300005618 | Ga0068864_100026543 | Ga0068864_1000265433 | 341 |
| 215 | 3300005618 | Ga0068864_100114553 | Ga0068864_1001145532 | 341 |
| 216 | 3300005618 | Ga0068864_100159787 | Ga0068864_1001597872 | 341 |
| 217 | 3300005841 | Ga0068863_100002604 | Ga0068863_10000260422 | 341 |
| 218 | 3300005841 | Ga0068863_100009722 | Ga0068863_10000972212 | 341 |
| 219 | 3300005842 | Ga0068858_100010173 | Ga0068858_1000101733 | 341 |
| 220 | 3300005843 | Ga0068860_100005319 | Ga0068860_1000053193 | 341 |
| 221 | 3300005843 | Ga0068860_100026953 | Ga0068860_1000269534 | 341 |
| 222 | 3300005844 | Ga0068862_100003464 | Ga0068862_10000346413 | 341 |
| 223 | 3300005844 | Ga0068862_100016320 | Ga0068862_1000163207 | 341 |
| 224 | 3300006038 | Ga0075365_10028501 | Ga0075365_100285012 | 341 |
| 225 | 3300006048 | Ga0075363_100129347 | Ga0075363_1001293472 | 341 |
| 226 | 3300006051 | Ga0075364_10000854 | Ga0075364_100008546 | 341 |
| 227 | 3300006051 | Ga0075364_10017718 | Ga0075364_100177185 | 341 |
| 228 | 3300006177 | Ga0075362_10000110 | Ga0075362_1000011013 | 341 |
| 229 | 3300006178 | Ga0075367_10010578 | Ga0075367_100105784 | 341 |
| 230 | 3300006178 | Ga0075367_10019591 | Ga0075367_100195914 | 341 |
| 231 | 3300006186 | Ga0075369_10001156 | Ga0075369_100011563 | 341 |
| 232 | 3300006186 | Ga0075369_10007540 | Ga0075369_100075404 | 341 |
| 233 | 3300006186 | Ga0075369_10010778 | Ga0075369_100107783 | 341 |
| 234 | 3300006195 | Ga0075366_10000262 | Ga0075366_100002626 | 341 |
| 235 | 3300006195 | Ga0075366_10010488 | Ga0075366_100104883 | 341 |
| 236 | 3300006195 | Ga0075366_10025434 | Ga0075366_100254343 | 341 |
| 237 | 3300006353 | Ga0075370_10000195 | Ga0075370_1000019519 | 341 |
| 238 | 3300006353 | Ga0075370_10017288 | Ga0075370_100172884 | 341 |
| 239 | 3300006931 | Ga0097620_100012366 | Ga0097620_1000123664 | 341 |
| 240 | 3300006931 | Ga0097620_100097649 | Ga0097620_1000976493 | 341 |
| 241 | 3300009011 | Ga0105251_10002929 | Ga0105251_100029295 | 341 |
| 242 | 3300009093 | Ga0105240_10007612 | Ga0105240_1000761220 | 341 |
| 243 | 3300009101 | Ga0105247_10044657 | Ga0105247_100446572 | 341 |
| 244 | 3300009101 | Ga0105247_10098687 | Ga0105247_100986872 | 341 |
| 245 | 3300009174 | Ga0105241_10005155 | Ga0105241_100051552 | 341 |
| 246 | 3300009177 | Ga0105248_10031331 | Ga0105248_100313313 | 341 |
| 247 | 3300009177 | Ga0105248_10058985 | Ga0105248_100589853 | 341 |
| 248 | 3300009551 | Ga0105238_10075828 | Ga0105238_100758281 | 341 |
| 249 | 3300009553 | Ga0105249_10097244 | Ga0105249_100972442 | 341 |
| 250 | 3300010375 | Ga0105239_10304064 | Ga0105239_103040641 | 341 |
| 251 | 3300013104 | Ga0157370_10151128 | Ga0157370_101511282 | 341 |
| 252 | 3300017792 | Ga0163161_10000412 | Ga0163161_100004127 | 341 |
| 253 | 3300025298 | Ga0209050_1000474 | Ga0209050_100047441 | 341 |
| 254 | 3300025735 | Ga0207713_1002253 | Ga0207713_100225312 | 341 |
| 255 | 3300025900 | Ga0207710_10050140 | Ga0207710_100501401 | 341 |
| 256 | 3300025903 | Ga0207680_10026602 | Ga0207680_100266022 | 341 |
| 257 | 3300025903 | Ga0207680_10080705 | Ga0207680_100807052 | 341 |
| 258 | 3300025904 | Ga0207647_10004980 | Ga0207647_1000498012 | 341 |
| 259 | 3300025904 | Ga0207647_10029637 | Ga0207647_100296373 | 341 |
| 260 | 3300025909 | Ga0207705_10000007 | Ga0207705_10000007236 | 341 |
| 261 | 3300025909 | Ga0207705_10029817 | Ga0207705_100298173 | 341 |
| 262 | 3300025913 | Ga0207695_10004641 | Ga0207695_1000464120 | 341 |
| 263 | 3300025919 | Ga0207657_10008855 | Ga0207657_100088557 | 341 |
| 264 | 3300025919 | Ga0207657_10152713 | Ga0207657_101527132 | 341 |
| 265 | 3300025923 | Ga0207681_10000224 | Ga0207681_1000022440 | 341 |
| 266 | 3300025923 | Ga0207681_10000288 | Ga0207681_1000028820 | 341 |
| 267 | 3300025924 | Ga0207694_10244236 | Ga0207694_102442361 | 341 |
| 268 | 3300025931 | Ga0207644_10000008 | Ga0207644_10000008261 | 341 |
| 269 | 3300025931 | Ga0207644_10001440 | Ga0207644_1000144011 | 341 |
| 270 | 3300025931 | Ga0207644_10006347 | Ga0207644_100063474 | 341 |
| 271 | 3300025931 | Ga0207644_10089486 | Ga0207644_100894861 | 341 |
| 272 | 3300025941 | Ga0207711_10004284 | Ga0207711_100042843 | 341 |
| 273 | 3300025941 | Ga0207711_10035500 | Ga0207711_100355004 | 341 |
| 274 | 3300025949 | Ga0207667_10013321 | Ga0207667_100133217 | 341 |
| 275 | 3300025949 | Ga0207667_10035280 | Ga0207667_100352802 | 341 |
| 276 | 3300025972 | Ga0207668_10072863 | Ga0207668_100728632 | 341 |
| 277 | 3300025972 | Ga0207668_10209789 | Ga0207668_102097892 | 341 |
| 278 | 3300025981 | Ga0207640_10063240 | Ga0207640_100632401 | 341 |
| 279 | 3300025986 | Ga0207658_10019519 | Ga0207658_100195195 | 341 |
| 280 | 3300025986 | Ga0207658_10032599 | Ga0207658_100325992 | 341 |
| 281 | 3300026035 | Ga0207703_10005939 | Ga0207703_100059394 | 341 |
| 282 | 3300026041 | Ga0207639_10000995 | Ga0207639_100009956 | 341 |
| 283 | 3300026067 | Ga0207678_10000025 | Ga0207678_1000002564 | 341 |
| 284 | 3300026078 | Ga0207702_10000369 | Ga0207702_1000036922 | 341 |
| 285 | 3300026078 | Ga0207702_10001204 | Ga0207702_1000120429 | 341 |
| 286 | 3300026088 | Ga0207641_10002819 | Ga0207641_1000281910 | 341 |
| 287 | 3300026088 | Ga0207641_10013915 | Ga0207641_100139153 | 341 |
| 288 | 3300026095 | Ga0207676_10045755 | Ga0207676_100457551 | 341 |
| 289 | 3300026116 | Ga0207674_10027894 | Ga0207674_100278943 | 341 |
| 290 | 3300026116 | Ga0207674_10180863 | Ga0207674_101808632 | 341 |
| 291 | 3300026142 | Ga0207698_10000036 | Ga0207698_1000003698 | 341 |
| 292 | 3300026142 | Ga0207698_10084866 | Ga0207698_100848661 | 341 |
| 293 | 3300027866 | Ga0209813_10000027 | Ga0209813_100000279 | 341 |
| 294 | 3300027876 | Ga0209974_10003827 | Ga0209974_100038274 | 341 |
| 295 | 3300027876 | Ga0209974_10003959 | Ga0209974_100039593 | 341 |
| 296 | 3300028379 | Ga0268266_10001320 | Ga0268266_100013206 | 341 |
| 297 | 3300028380 | Ga0268265_10049324 | Ga0268265_100493242 | 341 |
| 298 | 3300028381 | Ga0268264_10015563 | Ga0268264_100155638 | 341 |
| 299 | 3300028381 | Ga0268264_10021472 | Ga0268264_100214724 | 341 |
| 300 | 3300030731 | Ga0316177_1112568 | Ga0316177_11125681 | 341 |
| 301 | 3300031548 | Ga0307408_100059804 | Ga0307408_1000598043 | 341 |
| 302 | 3300031548 | Ga0307408_100338121 | Ga0307408_1003381212 | 341 |
| 303 | 3300031731 | Ga0307405_10001457 | Ga0307405_100014576 | 341 |
| 304 | 3300031852 | Ga0307410_10096743 | Ga0307410_100967433 | 341 |
| 305 | 3300031911 | Ga0307412_10004837 | Ga0307412_100048374 | 341 |
| 306 | 3300031911 | Ga0307412_10024687 | Ga0307412_100246874 | 341 |
| 307 | 3300031995 | Ga0307409_100262187 | Ga0307409_1002621872 | 341 |
| 308 | 3300032002 | Ga0307416_100060687 | Ga0307416_1000606871 | 341 |
| 309 | 3300032002 | Ga0307416_100073403 | Ga0307416_1000734033 | 341 |
| 310 | 3300032002 | Ga0307416_100077340 | Ga0307416_1000773403 | 341 |
| 311 | 3300032004 | Ga0307414_10121763 | Ga0307414_101217632 | 341 |
| 312 | 3300032126 | Ga0307415_100128122 | Ga0307415_1001281222 | 341 |
| 313 | 3300045051 | Ga0451576_0181423 | Ga0451576_0181423_858_1883 | 341 |
| 314 | 3300046500 | Ga0495596_0001077 | Ga0495596_0001077_1660_2685 | 341 |
| 315 | 3300046507 | Ga0495606_0073295 | Ga0495606_0073295_997_2022 | 341 |
| 316 | 3300046512 | Ga0495610_0000352 | Ga0495610_0000352_44130_45194 | 341 |
| 317 | 3300046512 | Ga0495610_0008942 | Ga0495610_0008942_374_1399 | 341 |
| 318 | 3300046519 | Ga0495632_0003354 | Ga0495632_0003354_2669_3694 | 341 |
| 319 | 3300046522 | Ga0495643_0000036 | Ga0495643_0000036_133778_134827 | 341 |
| 320 | 3300046537 | Ga0495598_0009027 | Ga0495598_0009027_66_1091 | 341 |
| 321 | 3300048090 | Ga0495615_0000158 | Ga0495615_0000158_13433_14458 | 341 |
| 322 | 3300048091 | Ga0495626_0001951 | Ga0495626_0001951_4587_5612 | 341 |
| 323 | 3300048906 | Ga0496103_0017222 | Ga0496103_0017222_1296_2339 | 341 |
| 324 | 3300048912 | Ga0496109_0130154 | Ga0496109_0130154_1205_2245 | 341 |
| 325 | 3300048919 | Ga0496116_0000149 | Ga0496116_0000149_58833_59858 | 341 |
| 326 | 3300048919 | Ga0496116_0043247 | Ga0496116_0043247_1078_2121 | 341 |
| 327 | 3300048920 | Ga0496117_0216112 | Ga0496117_0216112_16_1041 | 341 |
| 328 | 3300048921 | Ga0496118_0067248 | Ga0496118_0067248_83_1126 | 341 |
| 329 | 3300048923 | Ga0496120_0047121 | Ga0496120_0047121_574_1617 | 341 |
| 330 | 3300048924 | Ga0496121_0001791 | Ga0496121_0001791_15294_16319 | 341 |
| 331 | 3300048924 | Ga0496121_0041460 | Ga0496121_0041460_1328_2371 | 341 |
| 332 | 3300048925 | Ga0496122_0022271 | Ga0496122_0022271_1006_2031 | 341 |
| 333 | 3300048926 | Ga0496123_0000830 | Ga0496123_0000830_34157_35182 | 341 |
| 334 | 3300048926 | Ga0496123_0004529 | Ga0496123_0004529_11940_12965 | 341 |
| 335 | 3300048927 | Ga0496124_0004393 | Ga0496124_0004393_613_1638 | 341 |
| 336 | 3300048927 | Ga0496124_0027409 | Ga0496124_0027409_3470_4495 | 341 |
| 337 | 3300048928 | Ga0496125_0005390 | Ga0496125_0005390_4253_5278 | 341 |
| 338 | 3300048929 | Ga0496126_0000261 | Ga0496126_0000261_81685_82710 | 341 |
| 339 | 3300048929 | Ga0496126_0003215 | Ga0496126_0003215_14194_15234 | 341 |
| 340 | 3300048929 | Ga0496126_0031715 | Ga0496126_0031715_2409_3452 | 341 |
| 341 | 3300048929 | Ga0496126_0052165 | Ga0496126_0052165_1029_2054 | 341 |
| 342 | 3300049581 | Ga0501047_0175016 | Ga0501047_0175016_586_1611 | 341 |
| 343 | 3300049823 | Ga0501044_0003900 | Ga0501044_0003900_13984_15009 | 341 |
| 344 | 3300050489 | nmdc:mga03683_3_c1 | nmdc:mga03683_3_c1_153886_154911 | 341 |
| 345 | 3300050489 | nmdc:mga03683_4448_c1 | nmdc:mga03683_4448_c1_2051_3076 | 341 |
| 346 | 3300050490 | nmdc:mga03n38_591_c1 | nmdc:mga03n38_591_c1_6685_7710 | 341 |
| 347 | 3300050491 | nmdc:mga00v17_14785_c1 | nmdc:mga00v17_14785_c1_2172_3197 | 341 |
| 348 | 3300050491 | nmdc:mga00v17_7063_c1 | nmdc:mga00v17_7063_c1_3453_4478 | 341 |
| 349 | 3300050493 | nmdc:mga0k408_125529_c1 | nmdc:mga0k408_125529_c1_123_1148 | 341 |
| 350 | 3300050493 | nmdc:mga0k408_16895_c1 | nmdc:mga0k408_16895_c1_1581_2606 | 341 |
| 351 | 3300050493 | nmdc:mga0k408_622_c1 | nmdc:mga0k408_622_c1_18401_19426 | 341 |
| 352 | 3300050496 | nmdc:mga07m45_14397_c1 | nmdc:mga07m45_14397_c1_1116_2141 | 341 |
| 353 | 3300050496 | nmdc:mga07m45_1_c1 | nmdc:mga07m45_1_c1_290600_291625 | 341 |
| 354 | 3300050516 | nmdc:mga0sz30_7108_c1 | nmdc:mga0sz30_7108_c1_1078_2103 | 341 |
| 355 | 3300053096 | Ga0500641_0087517 | Ga0500641_0087517_13_1038 | 341 |
| 356 | 3300053136 | Ga0500559_0039672 | Ga0500559_0039672_671_1696 | 341 |
| 357 | 3300053139 | Ga0500568_0070149 | Ga0500568_0070149_185_1210 | 341 |
| 358 | 3300053153 | Ga0500616_0090518 | Ga0500616_0090518_248_1273 | 341 |
| 359 | iso_pu_bacteria | 2775507255 | 2778125589 | 341 |
| 360 | 2162886007 | SwRhRL2b_contig_2859790 | SwRhRL2b_0880.00000410 | 342 |
| 361 | 3300002074 | JGI24748J21848_1000910 | JGI24748J21848_10009103 | 342 |
| 362 | 3300005289 | Ga0065704_10009113 | Ga0065704_100091135 | 342 |
| 363 | 3300005289 | Ga0065704_10070610 | Ga0065704_1007061011 | 342 |
| 364 | 3300005295 | Ga0065707_10093677 | Ga0065707_100936774 | 342 |
| 365 | 3300005295 | Ga0065707_10144281 | Ga0065707_101442812 | 342 |
| 366 | 3300005327 | Ga0070658_10133606 | Ga0070658_101336061 | 342 |
| 367 | 3300005331 | Ga0070670_100166174 | Ga0070670_1001661742 | 342 |
| 368 | 3300005347 | Ga0070668_100001596 | Ga0070668_1000015967 | 342 |
| 369 | 3300005353 | Ga0070669_100000056 | Ga0070669_10000005654 | 342 |
| 370 | 3300005353 | Ga0070669_100013132 | Ga0070669_1000131321 | 342 |
| 371 | 3300005353 | Ga0070669_100211468 | Ga0070669_1002114681 | 342 |
| 372 | 3300005355 | Ga0070671_100012272 | Ga0070671_1000122726 | 342 |
| 373 | 3300005355 | Ga0070671_100042748 | Ga0070671_1000427482 | 342 |
| 374 | 3300005367 | Ga0070667_100002172 | Ga0070667_10000217213 | 342 |
| 375 | 3300005367 | Ga0070667_100043636 | Ga0070667_1000436364 | 342 |
| 376 | 3300005530 | Ga0070679_100011790 | Ga0070679_1000117908 | 342 |
| 377 | 3300005548 | Ga0070665_100002164 | Ga0070665_1000021642 | 342 |
| 378 | 3300005548 | Ga0070665_100079499 | Ga0070665_1000794994 | 342 |
| 379 | 3300005563 | Ga0068855_100103441 | Ga0068855_1001034413 | 342 |
| 380 | 3300005616 | Ga0068852_100420319 | Ga0068852_1004203191 | 342 |
| 381 | 3300005842 | Ga0068858_100022546 | Ga0068858_1000225465 | 342 |
| 382 | 3300005842 | Ga0068858_100044087 | Ga0068858_1000440873 | 342 |
| 383 | 3300005843 | Ga0068860_100005374 | Ga0068860_10000537410 | 342 |
| 384 | 3300006058 | Ga0075432_10010630 | Ga0075432_100106302 | 342 |
| 385 | 3300006353 | Ga0075370_10004142 | Ga0075370_100041421 | 342 |
| 386 | 3300006946 | Ga0079104_1030865 | Ga0079104_10308652 | 342 |
| 387 | 3300009177 | Ga0105248_10047898 | Ga0105248_100478984 | 342 |
| 388 | 3300009177 | Ga0105248_10155032 | Ga0105248_101550322 | 342 |
| 389 | 3300009177 | Ga0105248_10312391 | Ga0105248_103123911 | 342 |
| 390 | 3300009553 | Ga0105249_10000123 | Ga0105249_1000012329 | 342 |
| 391 | 3300013306 | Ga0163162_10062635 | Ga0163162_100626352 | 342 |
| 392 | 3300014326 | Ga0157380_10028296 | Ga0157380_100282963 | 342 |
| 393 | 3300017792 | Ga0163161_10014323 | Ga0163161_100143232 | 342 |
| 394 | 3300017792 | Ga0163161_10039436 | Ga0163161_100394362 | 342 |
| 395 | 3300025711 | Ga0207696_1003632 | Ga0207696_10036322 | 342 |
| 396 | 3300025921 | Ga0207652_10003649 | Ga0207652_100036493 | 342 |
| 397 | 3300025923 | Ga0207681_10000019 | Ga0207681_10000019182 | 342 |
| 398 | 3300025923 | Ga0207681_10067232 | Ga0207681_100672323 | 342 |
| 399 | 3300025925 | Ga0207650_10210022 | Ga0207650_102100222 | 342 |
| 400 | 3300025931 | Ga0207644_10000446 | Ga0207644_100004462 | 342 |
| 401 | 3300025949 | Ga0207667_10094048 | Ga0207667_100940483 | 342 |
| 402 | 3300025961 | Ga0207712_10000102 | Ga0207712_1000010230 | 342 |
| 403 | 3300025972 | Ga0207668_10000618 | Ga0207668_100006185 | 342 |
| 404 | 3300025986 | Ga0207658_10001615 | Ga0207658_1000161513 | 342 |
| 405 | 3300025986 | Ga0207658_10058050 | Ga0207658_100580503 | 342 |
| 406 | 3300026035 | Ga0207703_10015133 | Ga0207703_100151335 | 342 |
| 407 | 3300026035 | Ga0207703_10056187 | Ga0207703_100561872 | 342 |
| 408 | 3300026142 | Ga0207698_10225109 | Ga0207698_102251092 | 342 |
| 409 | 3300027111 | Ga0209281_1007404 | Ga0209281_10074042 | 342 |
| 410 | 3300028379 | Ga0268266_10002061 | Ga0268266_1000206111 | 342 |
| 411 | 3300028379 | Ga0268266_10085384 | Ga0268266_100853842 | 342 |
| 412 | 3300028379 | Ga0268266_10103441 | Ga0268266_101034413 | 342 |
| 413 | 3300028380 | Ga0268265_10029687 | Ga0268265_100296872 | 342 |
| 414 | 3300028381 | Ga0268264_10011006 | Ga0268264_100110068 | 342 |
| 415 | 3300031251 | Ga0265327_10036809 | Ga0265327_100368092 | 342 |
| 416 | 3300031616 | Ga0307508_10010338 | Ga0307508_100103384 | 342 |
| 417 | 3300031824 | Ga0307413_10043785 | Ga0307413_100437851 | 342 |
| 418 | 3300031824 | Ga0307413_10058025 | Ga0307413_100580251 | 342 |
| 419 | 3300031852 | Ga0307410_10013400 | Ga0307410_100134003 | 342 |
| 420 | 3300031852 | Ga0307410_10033994 | Ga0307410_100339942 | 342 |
| 421 | 3300031903 | Ga0307407_10024624 | Ga0307407_100246242 | 342 |
| 422 | 3300031995 | Ga0307409_100118205 | Ga0307409_1001182053 | 342 |
| 423 | 3300032002 | Ga0307416_100008298 | Ga0307416_1000082985 | 342 |
| 424 | 3300032005 | Ga0307411_10021405 | Ga0307411_100214051 | 342 |
| 425 | 3300032005 | Ga0307411_10078747 | Ga0307411_100787471 | 342 |
| 426 | 3300032126 | Ga0307415_100053359 | Ga0307415_1000533593 | 342 |
| 427 | 3300046500 | Ga0495596_0000119 | Ga0495596_0000119_49765_50817 | 342 |
| 428 | 3300046501 | Ga0495607_0007039 | Ga0495607_0007039_4897_5949 | 342 |
| 429 | 3300046506 | Ga0495583_0039881 | Ga0495583_0039881_255_1307 | 342 |
| 430 | 3300046507 | Ga0495606_0024329 | Ga0495606_0024329_1123_2175 | 342 |
| 431 | 3300046522 | Ga0495643_0022436 | Ga0495643_0022436_1074_2126 | 342 |
| 432 | 3300046522 | Ga0495643_0028242 | Ga0495643_0028242_1483_2535 | 342 |
| 433 | 3300046522 | Ga0495643_0033021 | Ga0495643_0033021_1601_2629 | 342 |
| 434 | 3300046660 | Ga0495625_0014033 | Ga0495625_0014033_3678_4730 | 342 |
| 435 | 3300046692 | Ga0495671_0064128 | Ga0495671_0064128_423_1475 | 342 |
| 436 | 3300048903 | Ga0496100_0033018 | Ga0496100_0033018_894_1922 | 342 |
| 437 | 3300048904 | Ga0496101_0009605 | Ga0496101_0009605_1659_2687 | 342 |
| 438 | 3300048905 | Ga0496102_0000768 | Ga0496102_0000768_22489_23517 | 342 |
| 439 | 3300048906 | Ga0496103_0001148 | Ga0496103_0001148_3191_4219 | 342 |
| 440 | 3300048907 | Ga0496104_0001773 | Ga0496104_0001773_1110_2138 | 342 |
| 441 | 3300048908 | Ga0496105_0006834 | Ga0496105_0006834_4607_5635 | 342 |
| 442 | 3300048909 | Ga0496106_0124046 | Ga0496106_0124046_689_1717 | 342 |
| 443 | 3300048910 | Ga0496107_0046768 | Ga0496107_0046768_1085_2230 | 342 |
| 444 | 3300048912 | Ga0496109_0022253 | Ga0496109_0022253_4075_5136 | 342 |
| 445 | 3300048915 | Ga0496112_0023353 | Ga0496112_0023353_334_1362 | 342 |
| 446 | 3300048916 | Ga0496113_0028190 | Ga0496113_0028190_2446_3474 | 342 |
| 447 | 3300048920 | Ga0496117_0001020 | Ga0496117_0001020_8754_9782 | 342 |
| 448 | 3300048920 | Ga0496117_0032449 | Ga0496117_0032449_223_1299 | 342 |
| 449 | 3300048921 | Ga0496118_0098872 | Ga0496118_0098872_89_1165 | 342 |
| 450 | 3300048922 | Ga0496119_0078041 | Ga0496119_0078041_721_1749 | 342 |
| 451 | 3300048923 | Ga0496120_0010787 | Ga0496120_0010787_4736_5764 | 342 |
| 452 | 3300048924 | Ga0496121_0026615 | Ga0496121_0026615_694_1722 | 342 |
| 453 | 3300048925 | Ga0496122_0008900 | Ga0496122_0008900_4274_5338 | 342 |
| 454 | 3300048925 | Ga0496122_0026553 | Ga0496122_0026553_1361_2389 | 342 |
| 455 | 3300048925 | Ga0496122_0099811 | Ga0496122_0099811_151_1206 | 342 |
| 456 | 3300048926 | Ga0496123_0085588 | Ga0496123_0085588_692_1720 | 342 |
| 457 | 3300048927 | Ga0496124_0003326 | Ga0496124_0003326_13410_14438 | 342 |
| 458 | 3300048929 | Ga0496126_0000051 | Ga0496126_0000051_223602_224630 | 342 |
| 459 | 3300049663 | Ga0501223_000016 | Ga0501223_000016_6176_7237 | 342 |
| 460 | 3300049669 | Ga0501235_003688 | Ga0501235_003688_953_2014 | 342 |
| 461 | 3300049676 | Ga0501246_000930 | Ga0501246_000930_727_1788 | 342 |
| 462 | 3300049705 | Ga0501225_0000013 | Ga0501225_0000013_6202_7263 | 342 |
| 463 | 3300049705 | Ga0501225_0004736 | Ga0501225_0004736_1904_2965 | 342 |
| 464 | 3300049708 | Ga0501245_002499 | Ga0501245_002499_711_1772 | 342 |
| 465 | 3300049778 | Ga0501282_003798 | Ga0501282_003798_232_1293 | 342 |
| 466 | 3300050493 | nmdc:mga0k408_41451_c1 | nmdc:mga0k408_41451_c1_597_1625 | 342 |
| 467 | 3300050496 | nmdc:mga07m45_32180_c1 | nmdc:mga07m45_32180_c1_135_1163 | 342 |
| 468 | 3300050496 | nmdc:mga07m45_91_c2 | nmdc:mga07m45_91_c2_679_1707 | 342 |
| 469 | 3300053087 | Ga0500643_000005 | Ga0500643_000005_333378_334406 | 342 |
| 470 | 3300053087 | Ga0500643_003354 | Ga0500643_003354_557_1585 | 342 |
| 471 | 3300053094 | Ga0500566_0036445 | Ga0500566_0036445_449_1477 | 342 |
| 472 | 3300053119 | Ga0500595_017151 | Ga0500595_017151_1474_2502 | 342 |
| 473 | 3300053121 | Ga0500607_000473 | Ga0500607_000473_1620_2648 | 342 |
| 474 | 3300053122 | Ga0500608_000438 | Ga0500608_000438_12763_13791 | 342 |
| 475 | 3300053123 | Ga0500614_004745 | Ga0500614_004745_1027_2055 | 342 |
| 476 | 3300053136 | Ga0500559_0001290 | Ga0500559_0001290_11796_12824 | 342 |
| 477 | 3300053136 | Ga0500559_0003774 | Ga0500559_0003774_4608_5636 | 342 |
| 478 | 3300053138 | Ga0500564_002230 | Ga0500564_002230_1510_2538 | 342 |
| 479 | 3300053148 | Ga0500590_000274 | Ga0500590_000274_13498_14526 | 342 |
| 480 | 3300053156 | Ga0500622_0000587 | Ga0500622_0000587_3381_4409 | 342 |
| 481 | 3300053178 | Ga0500637_0001632 | Ga0500637_0001632_1746_2774 | 342 |
| 482 | 3300053723 | Ga0500567_000200 | Ga0500567_000200_12677_13705 | 342 |
| 483 | 3300053729 | Ga0500625_000014 | Ga0500625_000014_66423_67451 | 342 |
| 484 | 3300053730 | Ga0500645_007838 | Ga0500645_007838_1019_2047 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1jpi-assembly1.cif.gz_A-2 | phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase | 0.9497 | 1 | 337 |
| 1jph-assembly1.cif.gz_A-2 | ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase | 0.9492 | 1 | 337 |
| 2eja-assembly1.cif.gz_B | crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus | 0.945 | 2 | 341 |
| 1r3q-assembly1.cif.gz_A | uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i | 0.9448 | 1 | 337 |
| 1r3s-assembly1.cif.gz_A | uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i | 0.9447 | 1 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ejaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.945 | 2 | 341 | 3.20.20.210 |
| 1r3sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9447 | 1 | 337 | 3.20.20.210 |
| af_P32347_4_362_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9381 | 1 | 336 | 3.20.20.210 |
| 2ejaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9368 | 2 | 341 | 3.20.20.210 |
| af_C6TEE8_35_387_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9306 | 3 | 341 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A844Z894-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9937 | 1 | 341 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A653J780-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9933 | 1 | 341 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A4Q2KJY7-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9929 | 1 | 341 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A502CTB7-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.992 | 4 | 338 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A6N0WZN4-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9916 | 1 | 338 |
GO:0004853
GO:0005829 GO:0019353 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar