F452906

General Info

Members Datasets Scaffolds Average Seq Length
484 255 458 341

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10088431|Ga0075366_100884312
Length 335
Sequence MSGLLLRTLRGENASERPIWLMRQAGRYLPEYRALRAEKGGFLALVYDTDAAAEITLQPIRRFGFDGAILFSDILIVPYAMGQDLEFLVGEGPRLSPRLVDSALDGLRAVPERLEPIYVTVAKVKAGLGSGRTLLGFAGSPWTVATYMVAGEGSRDQHVTRAMAYRDPQGFQAIIDAYLAGQVRAGAEAVQLFDSWAGSLAPAEFERWVIAPNAAIVARLKARFPELPVIGFPKGAGEKLPAYARETGVDALGLDETIDPLWAAKALPEGMPVQGNFDPLLIEAGGPEIDRQARRILDAFADRPHVFNLGHGIGQHTPIAHVEQLLAVVRGWRRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
8 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
9 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
10 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
11 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
12 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
13 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
14 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
15 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
16 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
17 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
18 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
19 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
20 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
21 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
22 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
23 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
24 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
25 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
26 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
226 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
237 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
242 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
243 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.12
Nodule 0.41
Rhizoplane 5.17
Rhizosphere 67.77
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2859790 2162886007 Bacteria 5733
2 SwRhRL2b_contig_780398 2162886007 Bacteria 36690
3 JGI24736J21556_1001522 3300001904 Bacteria 4223
4 JGI24737J22298_10000792 3300001990 Bacteria 11199
5 JGI24735J21928_10000784 3300002067 Bacteria 11304
6 JGI24748J21848_1000910 3300002074 Bacteria 3207
7 JGI24738J21930_10004957 3300002075 Bacteria 3221
8 JGI24738J21930_10021438 3300002075 Bacteria 1340
9 JGI24751J29686_10000270 3300002459 Bacteria 20156
10 Ga0055536_1002684 3300003781 Bacteria 9870
11 Ga0055530_10005156 3300003791 Bacteria 6368
12 Ga0055530_10012841 3300003791 Bacteria 2896
13 Ga0055531_10000492 3300003794 Bacteria 36203
14 Ga0055531_10009125 3300003794 Bacteria 5112
15 Ga0065704_10003765 3300005289 Bacteria 7897
16 Ga0065704_10009113 3300005289 Bacteria 3984
17 Ga0065704_10070157 3300005289 Bacteria 211668
18 Ga0065704_10070610 3300005289 Bacteria 19142
19 Ga0065704_10075725 3300005289 Bacteria 5446
20 Ga0065707_10087470 3300005295 Bacteria 5011
21 Ga0065707_10093677 3300005295 Bacteria 3593
22 Ga0065707_10144281 3300005295 Bacteria 1732
23 Ga0070658_10000811 3300005327 Bacteria 26743
24 Ga0070658_10121692 3300005327 Bacteria 2169
25 Ga0070658_10130414 3300005327 Bacteria 2095
26 Ga0070658_10133606 3300005327 Bacteria 2069
27 Ga0070683_100026685 3300005329 Bacteria 5205
28 Ga0070670_100166174 3300005331 Bacteria 1913
29 Ga0070666_10011761 3300005335 Bacteria 5503
30 Ga0070666_10044153 3300005335 Bacteria 2985
31 Ga0070680_100006749 3300005336 Bacteria 8745
32 Ga0070682_100055656 3300005337 Bacteria 2485
33 Ga0070660_100029871 3300005339 Bacteria 4086
34 Ga0070660_100112385 3300005339 Bacteria 2168
35 Ga0070661_100011548 3300005344 Bacteria 6154
36 Ga0070661_100040788 3300005344 Bacteria 3387
37 Ga0070668_100001596 3300005347 Bacteria 16399
38 Ga0070668_100003911 3300005347 Bacteria 11002
39 Ga0070668_100115461 3300005347 Bacteria 2140
40 Ga0070668_100173312 3300005347 Bacteria 1758
41 Ga0070668_100190402 3300005347 Bacteria 1680
42 Ga0070669_100000056 3300005353 Bacteria 111413
43 Ga0070669_100000291 3300005353 Bacteria 39339
44 Ga0070669_100013132 3300005353 Bacteria 5886
45 Ga0070669_100057741 3300005353 Bacteria 2848
46 Ga0070669_100211468 3300005353 Bacteria 1530
47 Ga0070671_100000005 3300005355 Bacteria 256547
48 Ga0070671_100008960 3300005355 Bacteria 8029
49 Ga0070671_100012272 3300005355 Bacteria 6896
50 Ga0070671_100016614 3300005355 Bacteria 5949
51 Ga0070671_100042748 3300005355 Bacteria 3767
52 Ga0070671_100122127 3300005355 Bacteria 2192
53 Ga0070659_100024854 3300005366 Bacteria 4595
54 Ga0070667_100000160 3300005367 Bacteria 83754
55 Ga0070667_100002172 3300005367 Bacteria 17269
56 Ga0070667_100032565 3300005367 Bacteria 4348
57 Ga0070667_100043636 3300005367 Bacteria 3764
58 Ga0070663_100001281 3300005455 Bacteria 13770
59 Ga0070663_100050582 3300005455 Bacteria 2956
60 Ga0070663_100060112 3300005455 Bacteria 2732
61 Ga0070662_100138316 3300005457 Bacteria 1885
62 Ga0070681_10029381 3300005458 Bacteria 5520
63 Ga0070679_100011790 3300005530 Bacteria 8336
64 Ga0068853_100000627 3300005539 Bacteria 24278
65 Ga0070665_100000101 3300005548 Bacteria 159353
66 Ga0070665_100002164 3300005548 Bacteria 21915
67 Ga0070665_100079499 3300005548 Bacteria 3285
68 Ga0068855_100006162 3300005563 Bacteria 14623
69 Ga0068855_100036684 3300005563 Bacteria 5832
70 Ga0068855_100076452 3300005563 Bacteria 3886
71 Ga0068855_100084549 3300005563 Bacteria 3673
72 Ga0068855_100103441 3300005563 Bacteria 3276
73 Ga0070664_100024807 3300005564 Bacteria 4965
74 Ga0070664_100102832 3300005564 Bacteria 2486
75 Ga0068857_100043993 3300005577 Bacteria 3960
76 Ga0068856_100013169 3300005614 Bacteria 8011
77 Ga0068856_100172821 3300005614 Bacteria 2173
78 Ga0068852_100000259 3300005616 Bacteria 35916
79 Ga0068852_100420319 3300005616 Bacteria 1318
80 Ga0068859_100012366 3300005617 Bacteria 8584
81 Ga0068859_100097647 3300005617 Bacteria 2991
82 Ga0068864_100000145 3300005618 Bacteria 68040
83 Ga0068864_100026543 3300005618 Bacteria 4884
84 Ga0068864_100114553 3300005618 Bacteria 2404
85 Ga0068864_100159787 3300005618 Bacteria 2048
86 Ga0068851_10039174 3300005834 Bacteria 2380
87 Ga0068863_100002604 3300005841 Bacteria 17894
88 Ga0068863_100009722 3300005841 Bacteria 9382
89 Ga0068858_100000268 3300005842 Bacteria 55747
90 Ga0068858_100010173 3300005842 Bacteria 8928
91 Ga0068858_100022546 3300005842 Bacteria 5875
92 Ga0068858_100044087 3300005842 Bacteria 4136
93 Ga0068860_100005319 3300005843 Bacteria 13065
94 Ga0068860_100005374 3300005843 Bacteria 12996
95 Ga0068860_100026953 3300005843 Bacteria 5538
96 Ga0068862_100003464 3300005844 Bacteria 13574
97 Ga0068862_100016320 3300005844 Bacteria 6180
98 Ga0075365_10028501 3300006038 Bacteria 3562
99 Ga0075363_100129347 3300006048 Bacteria 1415
100 Ga0075364_10000854 3300006051 Bacteria 16048
101 Ga0075364_10017718 3300006051 Bacteria 4454
102 Ga0075432_10010630 3300006058 Bacteria 3127
103 Ga0075362_10000110 3300006177 Bacteria 22774
104 Ga0075367_10010578 3300006178 Bacteria 4851
105 Ga0075367_10019591 3300006178 Bacteria 3754
106 Ga0075369_10001156 3300006186 Bacteria 8910
107 Ga0075369_10007540 3300006186 Bacteria 4151
108 Ga0075369_10010778 3300006186 Bacteria 3581
109 Ga0075366_10000262 3300006195 Bacteria 23232
110 Ga0075366_10010488 3300006195 Bacteria 5202
111 Ga0075366_10025434 3300006195 Bacteria 3458
112 Ga0075366_10088431 3300006195 Bacteria 1855
113 Ga0075370_10000195 3300006353 Bacteria 21283
114 Ga0075370_10004142 3300006353 Bacteria 6988
115 Ga0075370_10017288 3300006353 Bacteria 3896
116 Ga0097620_100012366 3300006931 Bacteria 8584
117 Ga0097620_100097649 3300006931 Bacteria 2991
118 Ga0079104_1030865 3300006946 Bacteria 1333
119 Ga0105251_10002929 3300009011 Bacteria 12791
120 Ga0105240_10007612 3300009093 Bacteria 15687
121 Ga0105247_10044657 3300009101 Bacteria 2718
122 Ga0105247_10098687 3300009101 Bacteria 1865
123 Ga0105241_10005155 3300009174 Bacteria 9640
124 Ga0105248_10000026 3300009177 Bacteria 257155
125 Ga0105248_10008523 3300009177 Bacteria 11256
126 Ga0105248_10031331 3300009177 Bacteria 5943
127 Ga0105248_10047898 3300009177 Bacteria 4794
128 Ga0105248_10058985 3300009177 Bacteria 4310
129 Ga0105248_10129371 3300009177 Bacteria 2848
130 Ga0105248_10155032 3300009177 Bacteria 2585
131 Ga0105248_10312391 3300009177 Bacteria 1770
132 Ga0105237_10074642 3300009545 Bacteria 3383
133 Ga0105238_10075828 3300009551 Bacteria 3355
134 Ga0105249_10000123 3300009553 Bacteria 104747
135 Ga0105249_10097244 3300009553 Bacteria 2763
136 Ga0105148_100032 3300009978 Bacteria 20199
137 Ga0105239_10304064 3300010375 Bacteria 1796
138 Ga0105246_10000074 3300011119 Bacteria 41753
139 Ga0157373_10048756 3300013100 Bacteria 3020
140 Ga0157371_10001651 3300013102 Bacteria 22752
141 Ga0157371_10030900 3300013102 Bacteria 3860
142 Ga0157370_10096838 3300013104 Bacteria 2768
143 Ga0157370_10151128 3300013104 Bacteria 2160
144 Ga0157369_10000384 3300013105 Bacteria 58625
145 Ga0163162_10009714 3300013306 Bacteria 9363
146 Ga0163162_10010851 3300013306 Bacteria 8866
147 Ga0163162_10062635 3300013306 Bacteria 3760
148 Ga0163162_10079146 3300013306 Bacteria 3353
149 Ga0157372_10004422 3300013307 Bacteria 14988
150 Ga0157372_10181667 3300013307 Bacteria 2435
151 Ga0157380_10028296 3300014326 Bacteria 4271
152 Ga0163161_10000412 3300017792 Bacteria 35877
153 Ga0163161_10014323 3300017792 Bacteria 5521
154 Ga0163161_10039436 3300017792 Bacteria 3391
155 Ga0209675_1000638 3300025291 Bacteria 24903
156 Ga0209676_1000897 3300025292 Bacteria 37715
157 Ga0209676_1001537 3300025292 Bacteria 20872
158 Ga0209025_1005555 3300025294 Bacteria 10219
159 Ga0209050_1000113 3300025298 Bacteria 209222
160 Ga0209050_1000474 3300025298 Bacteria 71192
161 Ga0209257_1000083 3300025304 Bacteria 296207
162 Ga0209257_1000330 3300025304 Bacteria 99167
163 Ga0209257_1001563 3300025304 Bacteria 26461
164 Ga0207697_10003663 3300025315 Bacteria 7527
165 Ga0207696_1003632 3300025711 Bacteria 6942
166 Ga0207713_1002253 3300025735 Bacteria 14260
167 Ga0207710_10050140 3300025900 Bacteria 1872
168 Ga0207680_10026602 3300025903 Bacteria 3209
169 Ga0207680_10080705 3300025903 Bacteria 2043
170 Ga0207647_10004980 3300025904 Bacteria 9792
171 Ga0207647_10029637 3300025904 Bacteria 3538
172 Ga0207705_10000007 3300025909 Bacteria 597387
173 Ga0207705_10026471 3300025909 Bacteria 4136
174 Ga0207705_10029817 3300025909 Bacteria 3890
175 Ga0207705_10165046 3300025909 Bacteria 1665
176 Ga0207705_10198877 3300025909 Bacteria 1518
177 Ga0207707_10120012 3300025912 Bacteria 2298
178 Ga0207695_10004641 3300025913 Bacteria 18616
179 Ga0207671_10000924 3300025914 Bacteria 36861
180 Ga0207660_10020186 3300025917 Bacteria 4469
181 Ga0207657_10000156 3300025919 Bacteria 69892
182 Ga0207657_10008855 3300025919 Bacteria 10178
183 Ga0207657_10014245 3300025919 Bacteria 7773
184 Ga0207657_10152713 3300025919 Bacteria 1880
185 Ga0207649_10013083 3300025920 Bacteria 4627
186 Ga0207652_10003649 3300025921 Bacteria 12670
187 Ga0207652_10017465 3300025921 Bacteria 5872
188 Ga0207681_10000019 3300025923 Bacteria 243902
189 Ga0207681_10000224 3300025923 Bacteria 44695
190 Ga0207681_10000288 3300025923 Bacteria 37371
191 Ga0207681_10067232 3300025923 Bacteria 2484
192 Ga0207694_10244236 3300025924 Bacteria 1468
193 Ga0207650_10210022 3300025925 Bacteria 1563
194 Ga0207644_10000008 3300025931 Bacteria 354219
195 Ga0207644_10000446 3300025931 Bacteria 26672
196 Ga0207644_10001440 3300025931 Bacteria 15329
197 Ga0207644_10006347 3300025931 Bacteria 7699
198 Ga0207644_10089486 3300025931 Bacteria 2291
199 Ga0207690_10014927 3300025932 Bacteria 4702
200 Ga0207690_10031407 3300025932 Bacteria 3397
201 Ga0207706_10001346 3300025933 Bacteria 24541
202 Ga0207706_10055156 3300025933 Bacteria 3505
203 Ga0207711_10003775 3300025941 Bacteria 13046
204 Ga0207711_10004284 3300025941 Bacteria 12191
205 Ga0207711_10035500 3300025941 Bacteria 4226
206 Ga0207661_10066915 3300025944 Bacteria 2920
207 Ga0207679_10066538 3300025945 Bacteria 2700
208 Ga0207667_10003313 3300025949 Bacteria 19874
209 Ga0207667_10013321 3300025949 Bacteria 9419
210 Ga0207667_10021208 3300025949 Bacteria 7202
211 Ga0207667_10035280 3300025949 Bacteria 5366
212 Ga0207667_10088309 3300025949 Bacteria 3207
213 Ga0207667_10094048 3300025949 Bacteria 3095
214 Ga0207712_10000102 3300025961 Bacteria 96444
215 Ga0207668_10000618 3300025972 Bacteria 22100
216 Ga0207668_10072863 3300025972 Bacteria 2459
217 Ga0207668_10209789 3300025972 Bacteria 1557
218 Ga0207640_10063240 3300025981 Bacteria 2458
219 Ga0207658_10001615 3300025986 Bacteria 17298
220 Ga0207658_10019519 3300025986 Bacteria 4688
221 Ga0207658_10032599 3300025986 Bacteria 3709
222 Ga0207658_10058050 3300025986 Bacteria 2878
223 Ga0207703_10000139 3300026035 Bacteria 86495
224 Ga0207703_10005939 3300026035 Bacteria 9782
225 Ga0207703_10015133 3300026035 Bacteria 6021
226 Ga0207703_10056187 3300026035 Bacteria 3205
227 Ga0207639_10000995 3300026041 Bacteria 19317
228 Ga0207639_10035941 3300026041 Bacteria 3668
229 Ga0207678_10000025 3300026067 Bacteria 119139
230 Ga0207678_10029457 3300026067 Bacteria 4791
231 Ga0207702_10000369 3300026078 Bacteria 51295
232 Ga0207702_10001204 3300026078 Bacteria 26266
233 Ga0207702_10148746 3300026078 Bacteria 2128
234 Ga0207641_10002819 3300026088 Bacteria 15805
235 Ga0207641_10013915 3300026088 Bacteria 6598
236 Ga0207676_10000072 3300026095 Bacteria 101978
237 Ga0207676_10045755 3300026095 Bacteria 3383
238 Ga0207674_10027894 3300026116 Bacteria 5965
239 Ga0207674_10127701 3300026116 Bacteria 2507
240 Ga0207674_10180863 3300026116 Bacteria 2060
241 Ga0207674_10358601 3300026116 Bacteria 1409
242 Ga0207674_10365333 3300026116 Bacteria 1395
243 Ga0207698_10000036 3300026142 Bacteria 105391
244 Ga0207698_10084866 3300026142 Bacteria 2569
245 Ga0207698_10225109 3300026142 Bacteria 1698
246 Ga0209281_1007404 3300027111 Bacteria 2758
247 Ga0209813_10000027 3300027866 Bacteria 69637
248 Ga0209974_10003827 3300027876 Bacteria 5391
249 Ga0209974_10003959 3300027876 Bacteria 5304
250 Ga0268266_10001320 3300028379 Bacteria 30084
251 Ga0268266_10002061 3300028379 Bacteria 22273
252 Ga0268266_10085384 3300028379 Bacteria 2758
253 Ga0268266_10103441 3300028379 Bacteria 2513
254 Ga0268265_10029687 3300028380 Bacteria 3928
255 Ga0268265_10049324 3300028380 Bacteria 3165
256 Ga0268264_10011006 3300028381 Bacteria 7469
257 Ga0268264_10015563 3300028381 Bacteria 6235
258 Ga0268264_10021472 3300028381 Bacteria 5272
259 Ga0316177_1112568 3300030731 Bacteria 1263
260 Ga0265327_10036809 3300031251 Bacteria 2686
261 Ga0307513_10020089 3300031456 Bacteria 7931
262 Ga0307513_10297252 3300031456 Bacteria 1383
263 Ga0307408_100059804 3300031548 Bacteria 2774
264 Ga0307408_100338121 3300031548 Bacteria 1273
265 Ga0307508_10010338 3300031616 Bacteria 8539
266 Ga0307405_10001457 3300031731 Bacteria 9965
267 Ga0307413_10043785 3300031824 Bacteria 2640
268 Ga0307413_10058025 3300031824 Bacteria 2370
269 Ga0307410_10013400 3300031852 Bacteria 4782
270 Ga0307410_10033994 3300031852 Bacteria 3297
271 Ga0307410_10096743 3300031852 Bacteria 2108
272 Ga0307407_10024624 3300031903 Bacteria 3159
273 Ga0307412_10004837 3300031911 Bacteria 7515
274 Ga0307412_10024687 3300031911 Bacteria 3713
275 Ga0307412_10037132 3300031911 Bacteria 3128
276 Ga0307409_100118205 3300031995 Bacteria 2238
277 Ga0307409_100262187 3300031995 Bacteria 1587
278 Ga0307416_100008298 3300032002 Bacteria 6687
279 Ga0307416_100060687 3300032002 Bacteria 3081
280 Ga0307416_100073403 3300032002 Bacteria 2852
281 Ga0307416_100077340 3300032002 Bacteria 2794
282 Ga0307414_10026241 3300032004 Bacteria 3747
283 Ga0307414_10029300 3300032004 Bacteria 3581
284 Ga0307414_10040269 3300032004 Bacteria 3154
285 Ga0307414_10090510 3300032004 Bacteria 2271
286 Ga0307414_10121763 3300032004 Bacteria 2007
287 Ga0307414_10128413 3300032004 Bacteria 1963
288 Ga0307411_10021405 3300032005 Bacteria 3783
289 Ga0307411_10054774 3300032005 Bacteria 2621
290 Ga0307411_10078747 3300032005 Bacteria 2260
291 Ga0307411_10414222 3300032005 Bacteria 1117
292 Ga0307415_100053359 3300032126 Bacteria 2754
293 Ga0307415_100128122 3300032126 Bacteria 1916
294 Ga0307510_10000369 3300033180 Bacteria 42647
295 Ga0395905_0047981 3300037471 Bacteria 4002
296 Ga0395901_0034194 3300038443 Bacteria 5249
297 Ga0439462_0001498 3300042015 Bacteria 5214
298 Ga0451576_0181423 3300045051 Bacteria 2198
299 Ga0466958_0192557 3300045836 Bacteria 1296
300 Ga0495627_000198 3300046453 Bacteria 65997
301 Ga0495650_0000995 3300046471 Bacteria 32148
302 Ga0495650_0003812 3300046471 Bacteria 10726
303 Ga0495585_0165050 3300046492 Bacteria 1147
304 Ga0495596_0000119 3300046500 Bacteria 54166
305 Ga0495596_0001077 3300046500 Bacteria 16192
306 Ga0495607_0007039 3300046501 Bacteria 7821
307 Ga0495583_0001362 3300046506 Bacteria 25203
308 Ga0495583_0014773 3300046506 Bacteria 4283
309 Ga0495583_0039881 3300046506 Bacteria 2209
310 Ga0495606_0024329 3300046507 Bacteria 4367
311 Ga0495606_0073295 3300046507 Bacteria 2149
312 Ga0495610_0000050 3300046512 Bacteria 143781
313 Ga0495610_0000352 3300046512 Bacteria 48332
314 Ga0495610_0008942 3300046512 Bacteria 6408
315 Ga0495632_0003354 3300046519 Bacteria 11413
316 Ga0495643_0000036 3300046522 Bacteria 238374
317 Ga0495643_0011737 3300046522 Bacteria 5316
318 Ga0495643_0022436 3300046522 Bacteria 3602
319 Ga0495643_0028242 3300046522 Bacteria 3147
320 Ga0495643_0033021 3300046522 Bacteria 2867
321 Ga0495643_0083313 3300046522 Bacteria 1660
322 Ga0495648_0025497 3300046524 Bacteria 4001
323 Ga0495654_0030697 3300046530 Bacteria 2733
324 Ga0495598_0009027 3300046537 Bacteria 2342
325 Ga0495633_0051995 3300046558 Bacteria 1930
326 Ga0495668_0000234 3300046616 Bacteria 79147
327 Ga0495625_0000195 3300046660 Bacteria 96493
328 Ga0495625_0014033 3300046660 Bacteria 6413
329 Ga0495625_0018549 3300046660 Bacteria 5426
330 Ga0495671_0064128 3300046692 Bacteria 1809
331 Ga0495673_0099421 3300047469 Bacteria 1178
332 Ga0495681_0000095 3300047470 Bacteria 76975
333 Ga0495615_0000158 3300048090 Bacteria 17114
334 Ga0495626_0001951 3300048091 Bacteria 15322
335 Ga0496100_0033018 3300048903 Bacteria 3234
336 Ga0496101_0009605 3300048904 Bacteria 6363
337 Ga0496102_0000768 3300048905 Bacteria 31216
338 Ga0496103_0001148 3300048906 Bacteria 18311
339 Ga0496103_0017222 3300048906 Bacteria 4322
340 Ga0496103_0058475 3300048906 Bacteria 2395
341 Ga0496104_0001773 3300048907 Bacteria 18662
342 Ga0496104_0102688 3300048907 Bacteria 2738
343 Ga0496105_0006834 3300048908 Bacteria 8774
344 Ga0496105_0079844 3300048908 Bacteria 2701
345 Ga0496106_0004278 3300048909 Bacteria 10617
346 Ga0496106_0124046 3300048909 Bacteria 2021
347 Ga0496107_0001239 3300048910 Bacteria 15597
348 Ga0496107_0046768 3300048910 Bacteria 3115
349 Ga0496108_0012158 3300048911 Bacteria 7000
350 Ga0496109_0022253 3300048912 Bacteria 5614
351 Ga0496109_0130154 3300048912 Bacteria 2348
352 Ga0496110_0035256 3300048913 Bacteria 4340
353 Ga0496110_0044717 3300048913 Bacteria 3868
354 Ga0496111_0084557 3300048914 Bacteria 2319
355 Ga0496112_0023353 3300048915 Bacteria 5908
356 Ga0496113_0003272 3300048916 Bacteria 9668
357 Ga0496113_0028190 3300048916 Bacteria 4036
358 Ga0496113_0090086 3300048916 Bacteria 2362
359 Ga0496114_0014507 3300048917 Bacteria 6329
360 Ga0496116_0000149 3300048919 Bacteria 141841
361 Ga0496116_0043247 3300048919 Bacteria 3071
362 Ga0496117_0001020 3300048920 Bacteria 42763
363 Ga0496117_0032449 3300048920 Bacteria 3967
364 Ga0496117_0216112 3300048920 Bacteria 1071
365 Ga0496118_0067248 3300048921 Bacteria 2610
366 Ga0496118_0098872 3300048921 Bacteria 1980
367 Ga0496119_0078041 3300048922 Bacteria 1916
368 Ga0496120_0010787 3300048923 Bacteria 6330
369 Ga0496120_0047121 3300048923 Bacteria 2487
370 Ga0496121_0000024 3300048924 Bacteria 462959
371 Ga0496121_0001791 3300048924 Bacteria 34731
372 Ga0496121_0026615 3300048924 Bacteria 5440
373 Ga0496121_0041460 3300048924 Bacteria 4021
374 Ga0496122_0008900 3300048925 Bacteria 10694
375 Ga0496122_0022271 3300048925 Bacteria 5638
376 Ga0496122_0026553 3300048925 Bacteria 4986
377 Ga0496122_0099811 3300048925 Bacteria 1945
378 Ga0496123_0000830 3300048926 Bacteria 49505
379 Ga0496123_0004529 3300048926 Bacteria 14518
380 Ga0496123_0085588 3300048926 Bacteria 1895
381 Ga0496123_0086223 3300048926 Bacteria 1885
382 Ga0496124_0003326 3300048927 Bacteria 19799
383 Ga0496124_0004393 3300048927 Bacteria 16474
384 Ga0496124_0027409 3300048927 Bacteria 5114
385 Ga0496125_0005390 3300048928 Bacteria 14262
386 Ga0496126_0000051 3300048929 Bacteria 313169
387 Ga0496126_0000261 3300048929 Bacteria 112027
388 Ga0496126_0003215 3300048929 Bacteria 20931
389 Ga0496126_0031715 3300048929 Bacteria 4987
390 Ga0496126_0052165 3300048929 Bacteria 3719
391 Ga0496126_0204859 3300048929 Bacteria 1664
392 Ga0501033_0088852 3300049570 Bacteria 2260
393 Ga0501033_0298694 3300049570 Bacteria 1134
394 Ga0501034_0028784 3300049571 Bacteria 5652
395 Ga0501037_0021339 3300049573 Bacteria 4784
396 Ga0501038_0041175 3300049574 Bacteria 4029
397 Ga0501038_0125105 3300049574 Bacteria 2117
398 Ga0501039_0034162 3300049575 Bacteria 3924
399 Ga0501043_0203801 3300049579 Bacteria 1534
400 Ga0501047_0166362 3300049581 Bacteria 2075
401 Ga0501047_0175016 3300049581 Bacteria 2014
402 Ga0501223_000016 3300049663 Bacteria 68443
403 Ga0501235_003688 3300049669 Bacteria 3308
404 Ga0501246_000930 3300049676 Bacteria 2188
405 Ga0501225_0000013 3300049705 Bacteria 71839
406 Ga0501225_0004736 3300049705 Bacteria 4036
407 Ga0501245_002499 3300049708 Bacteria 2454
408 Ga0501282_003798 3300049778 Bacteria 1623
409 Ga0501035_0028457 3300049822 Bacteria 5099
410 Ga0501044_0003900 3300049823 Bacteria 16715
411 Ga0501044_0064035 3300049823 Bacteria 3754
412 Ga0501044_0153891 3300049823 Bacteria 2280
413 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
414 nmdc:mga03683_4448_c1 3300050489 Bacteria 4651
415 nmdc:mga03683_94_c1 3300050489 Bacteria 32220
416 nmdc:mga03n38_591_c1 3300050490 Bacteria 7911
417 nmdc:mga00v17_14785_c1 3300050491 Bacteria 4366
418 nmdc:mga00v17_47906_c1 3300050491 Bacteria 2590
419 nmdc:mga00v17_7063_c1 3300050491 Bacteria 5978
420 nmdc:mga0k408_125529_c1 3300050493 Bacteria 1522
421 nmdc:mga0k408_16895_c1 3300050493 Bacteria 4057
422 nmdc:mga0k408_41451_c1 3300050493 Bacteria 2650
423 nmdc:mga0k408_622_c1 3300050493 Bacteria 19548
424 nmdc:mga0k408_8571_c2 3300050493 Bacteria 3206
425 nmdc:mga06z11_300_c1 3300050494 Bacteria 19031
426 nmdc:mga04h51_1373_c1 3300050495 Bacteria 5604
427 nmdc:mga07m45_14397_c1 3300050496 Bacteria 4212
428 nmdc:mga07m45_1_c1 3300050496 Bacteria 485809
429 nmdc:mga07m45_32180_c1 3300050496 Bacteria 2909
430 nmdc:mga07m45_91_c2 3300050496 Bacteria 3132
431 nmdc:mga07m45_9_c1 3300050496 Bacteria 171776
432 nmdc:mga0sz30_50_c1 3300050516 Bacteria 43433
433 nmdc:mga0sz30_7108_c1 3300050516 Bacteria 4186
434 Ga0500643_000005 3300053087 Bacteria 539775
435 Ga0500643_003354 3300053087 Bacteria 7748
436 Ga0500566_0036445 3300053094 Bacteria 2853
437 Ga0500641_0087517 3300053096 Bacteria 1327
438 Ga0500595_017151 3300053119 Bacteria 2680
439 Ga0500607_000473 3300053121 Bacteria 38991
440 Ga0500607_000541 3300053121 Bacteria 36492
441 Ga0500608_000438 3300053122 Bacteria 15683
442 Ga0500614_004745 3300053123 Bacteria 2859
443 Ga0500559_0001290 3300053136 Bacteria 14517
444 Ga0500559_0003774 3300053136 Bacteria 7357
445 Ga0500559_0039672 3300053136 Bacteria 2049
446 Ga0500564_002230 3300053138 Bacteria 7082
447 Ga0500568_0001218 3300053139 Bacteria 17161
448 Ga0500568_0070149 3300053139 Bacteria 1343
449 Ga0500590_000274 3300053148 Bacteria 16192
450 Ga0500616_0090518 3300053153 Bacteria 1516
451 Ga0500622_0000587 3300053156 Bacteria 33059
452 Ga0500627_0000070 3300053158 Bacteria 41863
453 Ga0500627_0043382 3300053158 Bacteria 1939
454 Ga0500627_0132523 3300053158 Bacteria 1126
455 Ga0500637_0001632 3300053178 Bacteria 9626
456 Ga0500567_000200 3300053723 Bacteria 17563
457 Ga0500625_000014 3300053729 Bacteria 109364
458 Ga0500645_007838 3300053730 Bacteria 3691

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2896253425 2896253492 313
2 3300050493 nmdc:mga0k408_8571_c2 nmdc:mga0k408_8571_c2_2130_3095 314
3 3300032004 Ga0307414_10040269 Ga0307414_100402692 315
4 3300046522 Ga0495643_0011737 Ga0495643_0011737_211_1167 318
5 3300009177 Ga0105248_10129371 Ga0105248_101293713 320
6 3300042015 Ga0439462_0001498 Ga0439462_0001498_2901_3863 320
7 3300046453 Ga0495627_000198 Ga0495627_000198_14689_15651 320
8 3300046471 Ga0495650_0003812 Ga0495650_0003812_7950_8912 320
9 3300046512 Ga0495610_0000050 Ga0495610_0000050_110410_111372 320
10 3300047470 Ga0495681_0000095 Ga0495681_0000095_14711_15673 320
11 3300048906 Ga0496103_0058475 Ga0496103_0058475_75_1037 320
12 3300048907 Ga0496104_0102688 Ga0496104_0102688_181_1143 320
13 3300048908 Ga0496105_0079844 Ga0496105_0079844_410_1372 320
14 3300048909 Ga0496106_0004278 Ga0496106_0004278_4748_5710 320
15 3300048910 Ga0496107_0001239 Ga0496107_0001239_98_1060 320
16 3300048914 Ga0496111_0084557 Ga0496111_0084557_712_1674 320
17 3300048916 Ga0496113_0003272 Ga0496113_0003272_7946_8908 320
18 3300048924 Ga0496121_0000024 Ga0496121_0000024_184928_185890 320
19 3300049823 Ga0501044_0153891 Ga0501044_0153891_307_1269 320
20 3300050489 nmdc:mga03683_94_c1 nmdc:mga03683_94_c1_12783_13745 320
21 3300050491 nmdc:mga00v17_47906_c1 nmdc:mga00v17_47906_c1_21_983 320
22 3300050494 nmdc:mga06z11_300_c1 nmdc:mga06z11_300_c1_2430_3392 320
23 3300050495 nmdc:mga04h51_1373_c1 nmdc:mga04h51_1373_c1_1016_1978 320
24 3300050496 nmdc:mga07m45_9_c1 nmdc:mga07m45_9_c1_126717_127679 320
25 3300050516 nmdc:mga0sz30_50_c1 nmdc:mga0sz30_50_c1_30932_31894 320
26 3300053121 Ga0500607_000541 Ga0500607_000541_4638_5600 320
27 3300009177 Ga0105248_10000026 Ga0105248_1000002648 321
28 3300013306 Ga0163162_10009714 Ga0163162_100097148 321
29 3300046558 Ga0495633_0051995 Ga0495633_0051995_908_1873 321
30 3300053158 Ga0500627_0132523 Ga0500627_0132523_124_1116 321
31 iso_pu_bacteria 2895880812 2895881043 321
32 3300045836 Ga0466958_0192557 Ga0466958_0192557_99_1070 322
33 3300032005 Ga0307411_10414222 Ga0307411_104142222 323
34 3300009978 Ga0105148_100032 Ga0105148_10003213 324
35 3300047469 Ga0495673_0099421 Ga0495673_0099421_188_1165 324
36 3300048911 Ga0496108_0012158 Ga0496108_0012158_2613_3587 324
37 3300048913 Ga0496110_0044717 Ga0496110_0044717_1967_2941 324
38 3300048916 Ga0496113_0090086 Ga0496113_0090086_906_1880 324
39 3300048926 Ga0496123_0086223 Ga0496123_0086223_796_1770 324
40 3300048913 Ga0496110_0035256 Ga0496110_0035256_1822_2820 327
41 3300009545 Ga0105237_10074642 Ga0105237_100746422 331
42 3300046492 Ga0495585_0165050 Ga0495585_0165050_34_1029 331
43 iso_pu_bacteria 2896184354 2896186152 334
44 3300006195 Ga0075366_10088431 Ga0075366_100884312 335
45 iso_pu_bacteria 2643221560 2643819221 336
46 iso_pu_bacteria 2643221588 2643951098 337
47 iso_pu_bacteria 2818991438 2819551074 337
48 iso_pu_bacteria 2882806704 2882809271 337
49 iso_pu_bacteria 2919138771 2919138897 337
50 iso_pu_bacteria 3000865235 3000867415 337
51 iso_pu_bacteria 8054302542 8054304009 337
52 3300005327 Ga0070658_10121692 Ga0070658_101216922 338
53 3300005339 Ga0070660_100112385 Ga0070660_1001123852 338
54 3300005455 Ga0070663_100060112 Ga0070663_1000601123 338
55 3300025304 Ga0209257_1001563 Ga0209257_100156324 338
56 3300025909 Ga0207705_10165046 Ga0207705_101650462 338
57 3300025909 Ga0207705_10198877 Ga0207705_101988772 338
58 3300025914 Ga0207671_10000924 Ga0207671_1000092428 338
59 3300025919 Ga0207657_10014245 Ga0207657_100142453 338
60 3300032004 Ga0307414_10029300 Ga0307414_100293003 338
61 3300049570 Ga0501033_0088852 Ga0501033_0088852_1169_2194 338
62 3300049571 Ga0501034_0028784 Ga0501034_0028784_642_1667 338
63 3300049573 Ga0501037_0021339 Ga0501037_0021339_461_1486 338
64 3300049574 Ga0501038_0041175 Ga0501038_0041175_1714_2739 338
65 3300049574 Ga0501038_0125105 Ga0501038_0125105_640_1662 338
66 3300049575 Ga0501039_0034162 Ga0501039_0034162_1706_2731 338
67 3300049579 Ga0501043_0203801 Ga0501043_0203801_19_1044 338
68 3300049581 Ga0501047_0166362 Ga0501047_0166362_490_1515 338
69 3300049822 Ga0501035_0028457 Ga0501035_0028457_676_1701 338
70 3300049823 Ga0501044_0064035 Ga0501044_0064035_1303_2328 338
71 iso_pu_bacteria 2510917021 2511129832 338
72 iso_pu_bacteria 2643221563 2643835084 338
73 iso_pu_bacteria 2643221608 2644056011 338
74 iso_pu_bacteria 2738541275 2738710466 338
75 iso_pu_bacteria 2738541301 2738848891 338
76 iso_pu_bacteria 2738541304 2738864620 338
77 iso_pu_bacteria 2738543022 2739297138 338
78 iso_pu_bacteria 2738543033 2739358816 338
79 iso_pu_bacteria 2739367664 2739650838 338
80 iso_pu_bacteria 2739367865 2740029311 338
81 iso_pu_bacteria 2848297114 2848297951 338
82 iso_pu_bacteria 2852653556 2852655898 338
83 iso_pu_bacteria 2852680915 2852683048 338
84 iso_pu_bacteria 2928100450 2928100566 338
85 iso_pu_bacteria 2928959182 2928960629 338
86 3300003781 Ga0055536_1002684 Ga0055536_100268411 339
87 3300003791 Ga0055530_10005156 Ga0055530_100051563 339
88 3300003794 Ga0055531_10000492 Ga0055531_100004922 339
89 3300003794 Ga0055531_10009125 Ga0055531_100091256 339
90 3300005618 Ga0068864_100000145 Ga0068864_10000014557 339
91 3300005842 Ga0068858_100000268 Ga0068858_10000026811 339
92 3300009177 Ga0105248_10008523 Ga0105248_1000852311 339
93 3300013306 Ga0163162_10010851 Ga0163162_100108513 339
94 3300013306 Ga0163162_10079146 Ga0163162_100791463 339
95 3300025291 Ga0209675_1000638 Ga0209675_100063819 339
96 3300025292 Ga0209676_1000897 Ga0209676_100089722 339
97 3300025292 Ga0209676_1001537 Ga0209676_100153722 339
98 3300025294 Ga0209025_1005555 Ga0209025_100555511 339
99 3300025298 Ga0209050_1000113 Ga0209050_10001137 339
100 3300025304 Ga0209257_1000083 Ga0209257_100008316 339
101 3300025304 Ga0209257_1000330 Ga0209257_10003306 339
102 3300025315 Ga0207697_10003663 Ga0207697_100036638 339
103 3300025941 Ga0207711_10003775 Ga0207711_1000377513 339
104 3300026035 Ga0207703_10000139 Ga0207703_1000013939 339
105 3300026095 Ga0207676_10000072 Ga0207676_1000007285 339
106 3300031456 Ga0307513_10020089 Ga0307513_100200897 339
107 3300031456 Ga0307513_10297252 Ga0307513_102972521 339
108 3300031911 Ga0307412_10037132 Ga0307412_100371324 339
109 3300032004 Ga0307414_10026241 Ga0307414_100262412 339
110 3300032004 Ga0307414_10090510 Ga0307414_100905103 339
111 3300032004 Ga0307414_10128413 Ga0307414_101284132 339
112 3300033180 Ga0307510_10000369 Ga0307510_1000036912 339
113 3300037471 Ga0395905_0047981 Ga0395905_0047981_518_1543 339
114 3300038443 Ga0395901_0034194 Ga0395901_0034194_1076_2101 339
115 3300046471 Ga0495650_0000995 Ga0495650_0000995_17575_18618 339
116 3300046506 Ga0495583_0001362 Ga0495583_0001362_22985_24028 339
117 3300046506 Ga0495583_0014773 Ga0495583_0014773_2833_3858 339
118 3300046522 Ga0495643_0083313 Ga0495643_0083313_133_1176 339
119 3300046524 Ga0495648_0025497 Ga0495648_0025497_2269_3312 339
120 3300046530 Ga0495654_0030697 Ga0495654_0030697_873_1901 339
121 3300046616 Ga0495668_0000234 Ga0495668_0000234_14886_15914 339
122 3300046660 Ga0495625_0000195 Ga0495625_0000195_22894_23922 339
123 3300046660 Ga0495625_0018549 Ga0495625_0018549_1323_2348 339
124 3300048929 Ga0496126_0204859 Ga0496126_0204859_530_1558 339
125 3300053139 Ga0500568_0001218 Ga0500568_0001218_1603_2631 339
126 3300053158 Ga0500627_0000070 Ga0500627_0000070_12584_13612 339
127 3300053158 Ga0500627_0043382 Ga0500627_0043382_250_1278 339
128 3300002075 JGI24738J21930_10021438 JGI24738J21930_100214382 340
129 3300005329 Ga0070683_100026685 Ga0070683_1000266853 340
130 3300005336 Ga0070680_100006749 Ga0070680_1000067498 340
131 3300005337 Ga0070682_100055656 Ga0070682_1000556562 340
132 3300005344 Ga0070661_100011548 Ga0070661_1000115484 340
133 3300005366 Ga0070659_100024854 Ga0070659_1000248543 340
134 3300005455 Ga0070663_100050582 Ga0070663_1000505823 340
135 3300005457 Ga0070662_100138316 Ga0070662_1001383161 340
136 3300005458 Ga0070681_10029381 Ga0070681_100293817 340
137 3300005539 Ga0068853_100000627 Ga0068853_10000062723 340
138 3300005563 Ga0068855_100036684 Ga0068855_1000366843 340
139 3300005563 Ga0068855_100084549 Ga0068855_1000845493 340
140 3300005564 Ga0070664_100024807 Ga0070664_1000248074 340
141 3300005564 Ga0070664_100102832 Ga0070664_1001028323 340
142 3300005577 Ga0068857_100043993 Ga0068857_1000439933 340
143 3300005614 Ga0068856_100172821 Ga0068856_1001728213 340
144 3300005834 Ga0068851_10039174 Ga0068851_100391742 340
145 3300011119 Ga0105246_10000074 Ga0105246_1000007414 340
146 3300013100 Ga0157373_10048756 Ga0157373_100487564 340
147 3300013102 Ga0157371_10001651 Ga0157371_1000165132 340
148 3300013102 Ga0157371_10030900 Ga0157371_100309001 340
149 3300013104 Ga0157370_10096838 Ga0157370_100968383 340
150 3300013105 Ga0157369_10000384 Ga0157369_1000038441 340
151 3300013307 Ga0157372_10004422 Ga0157372_100044223 340
152 3300013307 Ga0157372_10181667 Ga0157372_101816671 340
153 3300025909 Ga0207705_10026471 Ga0207705_100264713 340
154 3300025912 Ga0207707_10120012 Ga0207707_101200123 340
155 3300025917 Ga0207660_10020186 Ga0207660_100201862 340
156 3300025919 Ga0207657_10000156 Ga0207657_100001563 340
157 3300025920 Ga0207649_10013083 Ga0207649_100130831 340
158 3300025921 Ga0207652_10017465 Ga0207652_100174655 340
159 3300025932 Ga0207690_10014927 Ga0207690_100149274 340
160 3300025932 Ga0207690_10031407 Ga0207690_100314071 340
161 3300025933 Ga0207706_10001346 Ga0207706_1000134632 340
162 3300025933 Ga0207706_10055156 Ga0207706_100551564 340
163 3300025944 Ga0207661_10066915 Ga0207661_100669153 340
164 3300025945 Ga0207679_10066538 Ga0207679_100665383 340
165 3300025949 Ga0207667_10003313 Ga0207667_1000331311 340
166 3300025949 Ga0207667_10021208 Ga0207667_100212088 340
167 3300025949 Ga0207667_10088309 Ga0207667_100883092 340
168 3300026041 Ga0207639_10035941 Ga0207639_100359414 340
169 3300026067 Ga0207678_10029457 Ga0207678_100294573 340
170 3300026078 Ga0207702_10148746 Ga0207702_101487461 340
171 3300026116 Ga0207674_10127701 Ga0207674_101277011 340
172 3300026116 Ga0207674_10358601 Ga0207674_103586011 340
173 3300026116 Ga0207674_10365333 Ga0207674_103653332 340
174 3300032005 Ga0307411_10054774 Ga0307411_100547742 340
175 3300048917 Ga0496114_0014507 Ga0496114_0014507_269_1291 340
176 3300049570 Ga0501033_0298694 Ga0501033_0298694_99_1121 340
177 2162886007 SwRhRL2b_contig_780398 SwRhRL2b_0866.00007260 341
178 3300001904 JGI24736J21556_1001522 JGI24736J21556_10015222 341
179 3300001990 JGI24737J22298_10000792 JGI24737J22298_1000079211 341
180 3300002067 JGI24735J21928_10000784 JGI24735J21928_1000078413 341
181 3300002075 JGI24738J21930_10004957 JGI24738J21930_100049574 341
182 3300002459 JGI24751J29686_10000270 JGI24751J29686_100002704 341
183 3300003791 Ga0055530_10012841 Ga0055530_100128412 341
184 3300005289 Ga0065704_10003765 Ga0065704_100037658 341
185 3300005289 Ga0065704_10070157 Ga0065704_1007015786 341
186 3300005289 Ga0065704_10075725 Ga0065704_100757252 341
187 3300005295 Ga0065707_10087470 Ga0065707_100874702 341
188 3300005327 Ga0070658_10000811 Ga0070658_1000081120 341
189 3300005327 Ga0070658_10130414 Ga0070658_101304143 341
190 3300005335 Ga0070666_10011761 Ga0070666_100117615 341
191 3300005335 Ga0070666_10044153 Ga0070666_100441534 341
192 3300005339 Ga0070660_100029871 Ga0070660_1000298714 341
193 3300005344 Ga0070661_100040788 Ga0070661_1000407883 341
194 3300005347 Ga0070668_100003911 Ga0070668_1000039115 341
195 3300005347 Ga0070668_100115461 Ga0070668_1001154614 341
196 3300005347 Ga0070668_100173312 Ga0070668_1001733121 341
197 3300005347 Ga0070668_100190402 Ga0070668_1001904022 341
198 3300005353 Ga0070669_100000291 Ga0070669_1000002915 341
199 3300005353 Ga0070669_100057741 Ga0070669_1000577412 341
200 3300005355 Ga0070671_100000005 Ga0070671_10000000564 341
201 3300005355 Ga0070671_100008960 Ga0070671_1000089606 341
202 3300005355 Ga0070671_100016614 Ga0070671_1000166143 341
203 3300005355 Ga0070671_100122127 Ga0070671_1001221271 341
204 3300005367 Ga0070667_100000160 Ga0070667_10000016049 341
205 3300005367 Ga0070667_100032565 Ga0070667_1000325653 341
206 3300005455 Ga0070663_100001281 Ga0070663_10000128118 341
207 3300005548 Ga0070665_100000101 Ga0070665_10000010197 341
208 3300005563 Ga0068855_100006162 Ga0068855_1000061624 341
209 3300005563 Ga0068855_100076452 Ga0068855_1000764526 341
210 3300005614 Ga0068856_100013169 Ga0068856_1000131694 341
211 3300005616 Ga0068852_100000259 Ga0068852_10000025929 341
212 3300005617 Ga0068859_100012366 Ga0068859_1000123664 341
213 3300005617 Ga0068859_100097647 Ga0068859_1000976473 341
214 3300005618 Ga0068864_100026543 Ga0068864_1000265433 341
215 3300005618 Ga0068864_100114553 Ga0068864_1001145532 341
216 3300005618 Ga0068864_100159787 Ga0068864_1001597872 341
217 3300005841 Ga0068863_100002604 Ga0068863_10000260422 341
218 3300005841 Ga0068863_100009722 Ga0068863_10000972212 341
219 3300005842 Ga0068858_100010173 Ga0068858_1000101733 341
220 3300005843 Ga0068860_100005319 Ga0068860_1000053193 341
221 3300005843 Ga0068860_100026953 Ga0068860_1000269534 341
222 3300005844 Ga0068862_100003464 Ga0068862_10000346413 341
223 3300005844 Ga0068862_100016320 Ga0068862_1000163207 341
224 3300006038 Ga0075365_10028501 Ga0075365_100285012 341
225 3300006048 Ga0075363_100129347 Ga0075363_1001293472 341
226 3300006051 Ga0075364_10000854 Ga0075364_100008546 341
227 3300006051 Ga0075364_10017718 Ga0075364_100177185 341
228 3300006177 Ga0075362_10000110 Ga0075362_1000011013 341
229 3300006178 Ga0075367_10010578 Ga0075367_100105784 341
230 3300006178 Ga0075367_10019591 Ga0075367_100195914 341
231 3300006186 Ga0075369_10001156 Ga0075369_100011563 341
232 3300006186 Ga0075369_10007540 Ga0075369_100075404 341
233 3300006186 Ga0075369_10010778 Ga0075369_100107783 341
234 3300006195 Ga0075366_10000262 Ga0075366_100002626 341
235 3300006195 Ga0075366_10010488 Ga0075366_100104883 341
236 3300006195 Ga0075366_10025434 Ga0075366_100254343 341
237 3300006353 Ga0075370_10000195 Ga0075370_1000019519 341
238 3300006353 Ga0075370_10017288 Ga0075370_100172884 341
239 3300006931 Ga0097620_100012366 Ga0097620_1000123664 341
240 3300006931 Ga0097620_100097649 Ga0097620_1000976493 341
241 3300009011 Ga0105251_10002929 Ga0105251_100029295 341
242 3300009093 Ga0105240_10007612 Ga0105240_1000761220 341
243 3300009101 Ga0105247_10044657 Ga0105247_100446572 341
244 3300009101 Ga0105247_10098687 Ga0105247_100986872 341
245 3300009174 Ga0105241_10005155 Ga0105241_100051552 341
246 3300009177 Ga0105248_10031331 Ga0105248_100313313 341
247 3300009177 Ga0105248_10058985 Ga0105248_100589853 341
248 3300009551 Ga0105238_10075828 Ga0105238_100758281 341
249 3300009553 Ga0105249_10097244 Ga0105249_100972442 341
250 3300010375 Ga0105239_10304064 Ga0105239_103040641 341
251 3300013104 Ga0157370_10151128 Ga0157370_101511282 341
252 3300017792 Ga0163161_10000412 Ga0163161_100004127 341
253 3300025298 Ga0209050_1000474 Ga0209050_100047441 341
254 3300025735 Ga0207713_1002253 Ga0207713_100225312 341
255 3300025900 Ga0207710_10050140 Ga0207710_100501401 341
256 3300025903 Ga0207680_10026602 Ga0207680_100266022 341
257 3300025903 Ga0207680_10080705 Ga0207680_100807052 341
258 3300025904 Ga0207647_10004980 Ga0207647_1000498012 341
259 3300025904 Ga0207647_10029637 Ga0207647_100296373 341
260 3300025909 Ga0207705_10000007 Ga0207705_10000007236 341
261 3300025909 Ga0207705_10029817 Ga0207705_100298173 341
262 3300025913 Ga0207695_10004641 Ga0207695_1000464120 341
263 3300025919 Ga0207657_10008855 Ga0207657_100088557 341
264 3300025919 Ga0207657_10152713 Ga0207657_101527132 341
265 3300025923 Ga0207681_10000224 Ga0207681_1000022440 341
266 3300025923 Ga0207681_10000288 Ga0207681_1000028820 341
267 3300025924 Ga0207694_10244236 Ga0207694_102442361 341
268 3300025931 Ga0207644_10000008 Ga0207644_10000008261 341
269 3300025931 Ga0207644_10001440 Ga0207644_1000144011 341
270 3300025931 Ga0207644_10006347 Ga0207644_100063474 341
271 3300025931 Ga0207644_10089486 Ga0207644_100894861 341
272 3300025941 Ga0207711_10004284 Ga0207711_100042843 341
273 3300025941 Ga0207711_10035500 Ga0207711_100355004 341
274 3300025949 Ga0207667_10013321 Ga0207667_100133217 341
275 3300025949 Ga0207667_10035280 Ga0207667_100352802 341
276 3300025972 Ga0207668_10072863 Ga0207668_100728632 341
277 3300025972 Ga0207668_10209789 Ga0207668_102097892 341
278 3300025981 Ga0207640_10063240 Ga0207640_100632401 341
279 3300025986 Ga0207658_10019519 Ga0207658_100195195 341
280 3300025986 Ga0207658_10032599 Ga0207658_100325992 341
281 3300026035 Ga0207703_10005939 Ga0207703_100059394 341
282 3300026041 Ga0207639_10000995 Ga0207639_100009956 341
283 3300026067 Ga0207678_10000025 Ga0207678_1000002564 341
284 3300026078 Ga0207702_10000369 Ga0207702_1000036922 341
285 3300026078 Ga0207702_10001204 Ga0207702_1000120429 341
286 3300026088 Ga0207641_10002819 Ga0207641_1000281910 341
287 3300026088 Ga0207641_10013915 Ga0207641_100139153 341
288 3300026095 Ga0207676_10045755 Ga0207676_100457551 341
289 3300026116 Ga0207674_10027894 Ga0207674_100278943 341
290 3300026116 Ga0207674_10180863 Ga0207674_101808632 341
291 3300026142 Ga0207698_10000036 Ga0207698_1000003698 341
292 3300026142 Ga0207698_10084866 Ga0207698_100848661 341
293 3300027866 Ga0209813_10000027 Ga0209813_100000279 341
294 3300027876 Ga0209974_10003827 Ga0209974_100038274 341
295 3300027876 Ga0209974_10003959 Ga0209974_100039593 341
296 3300028379 Ga0268266_10001320 Ga0268266_100013206 341
297 3300028380 Ga0268265_10049324 Ga0268265_100493242 341
298 3300028381 Ga0268264_10015563 Ga0268264_100155638 341
299 3300028381 Ga0268264_10021472 Ga0268264_100214724 341
300 3300030731 Ga0316177_1112568 Ga0316177_11125681 341
301 3300031548 Ga0307408_100059804 Ga0307408_1000598043 341
302 3300031548 Ga0307408_100338121 Ga0307408_1003381212 341
303 3300031731 Ga0307405_10001457 Ga0307405_100014576 341
304 3300031852 Ga0307410_10096743 Ga0307410_100967433 341
305 3300031911 Ga0307412_10004837 Ga0307412_100048374 341
306 3300031911 Ga0307412_10024687 Ga0307412_100246874 341
307 3300031995 Ga0307409_100262187 Ga0307409_1002621872 341
308 3300032002 Ga0307416_100060687 Ga0307416_1000606871 341
309 3300032002 Ga0307416_100073403 Ga0307416_1000734033 341
310 3300032002 Ga0307416_100077340 Ga0307416_1000773403 341
311 3300032004 Ga0307414_10121763 Ga0307414_101217632 341
312 3300032126 Ga0307415_100128122 Ga0307415_1001281222 341
313 3300045051 Ga0451576_0181423 Ga0451576_0181423_858_1883 341
314 3300046500 Ga0495596_0001077 Ga0495596_0001077_1660_2685 341
315 3300046507 Ga0495606_0073295 Ga0495606_0073295_997_2022 341
316 3300046512 Ga0495610_0000352 Ga0495610_0000352_44130_45194 341
317 3300046512 Ga0495610_0008942 Ga0495610_0008942_374_1399 341
318 3300046519 Ga0495632_0003354 Ga0495632_0003354_2669_3694 341
319 3300046522 Ga0495643_0000036 Ga0495643_0000036_133778_134827 341
320 3300046537 Ga0495598_0009027 Ga0495598_0009027_66_1091 341
321 3300048090 Ga0495615_0000158 Ga0495615_0000158_13433_14458 341
322 3300048091 Ga0495626_0001951 Ga0495626_0001951_4587_5612 341
323 3300048906 Ga0496103_0017222 Ga0496103_0017222_1296_2339 341
324 3300048912 Ga0496109_0130154 Ga0496109_0130154_1205_2245 341
325 3300048919 Ga0496116_0000149 Ga0496116_0000149_58833_59858 341
326 3300048919 Ga0496116_0043247 Ga0496116_0043247_1078_2121 341
327 3300048920 Ga0496117_0216112 Ga0496117_0216112_16_1041 341
328 3300048921 Ga0496118_0067248 Ga0496118_0067248_83_1126 341
329 3300048923 Ga0496120_0047121 Ga0496120_0047121_574_1617 341
330 3300048924 Ga0496121_0001791 Ga0496121_0001791_15294_16319 341
331 3300048924 Ga0496121_0041460 Ga0496121_0041460_1328_2371 341
332 3300048925 Ga0496122_0022271 Ga0496122_0022271_1006_2031 341
333 3300048926 Ga0496123_0000830 Ga0496123_0000830_34157_35182 341
334 3300048926 Ga0496123_0004529 Ga0496123_0004529_11940_12965 341
335 3300048927 Ga0496124_0004393 Ga0496124_0004393_613_1638 341
336 3300048927 Ga0496124_0027409 Ga0496124_0027409_3470_4495 341
337 3300048928 Ga0496125_0005390 Ga0496125_0005390_4253_5278 341
338 3300048929 Ga0496126_0000261 Ga0496126_0000261_81685_82710 341
339 3300048929 Ga0496126_0003215 Ga0496126_0003215_14194_15234 341
340 3300048929 Ga0496126_0031715 Ga0496126_0031715_2409_3452 341
341 3300048929 Ga0496126_0052165 Ga0496126_0052165_1029_2054 341
342 3300049581 Ga0501047_0175016 Ga0501047_0175016_586_1611 341
343 3300049823 Ga0501044_0003900 Ga0501044_0003900_13984_15009 341
344 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_153886_154911 341
345 3300050489 nmdc:mga03683_4448_c1 nmdc:mga03683_4448_c1_2051_3076 341
346 3300050490 nmdc:mga03n38_591_c1 nmdc:mga03n38_591_c1_6685_7710 341
347 3300050491 nmdc:mga00v17_14785_c1 nmdc:mga00v17_14785_c1_2172_3197 341
348 3300050491 nmdc:mga00v17_7063_c1 nmdc:mga00v17_7063_c1_3453_4478 341
349 3300050493 nmdc:mga0k408_125529_c1 nmdc:mga0k408_125529_c1_123_1148 341
350 3300050493 nmdc:mga0k408_16895_c1 nmdc:mga0k408_16895_c1_1581_2606 341
351 3300050493 nmdc:mga0k408_622_c1 nmdc:mga0k408_622_c1_18401_19426 341
352 3300050496 nmdc:mga07m45_14397_c1 nmdc:mga07m45_14397_c1_1116_2141 341
353 3300050496 nmdc:mga07m45_1_c1 nmdc:mga07m45_1_c1_290600_291625 341
354 3300050516 nmdc:mga0sz30_7108_c1 nmdc:mga0sz30_7108_c1_1078_2103 341
355 3300053096 Ga0500641_0087517 Ga0500641_0087517_13_1038 341
356 3300053136 Ga0500559_0039672 Ga0500559_0039672_671_1696 341
357 3300053139 Ga0500568_0070149 Ga0500568_0070149_185_1210 341
358 3300053153 Ga0500616_0090518 Ga0500616_0090518_248_1273 341
359 iso_pu_bacteria 2775507255 2778125589 341
360 2162886007 SwRhRL2b_contig_2859790 SwRhRL2b_0880.00000410 342
361 3300002074 JGI24748J21848_1000910 JGI24748J21848_10009103 342
362 3300005289 Ga0065704_10009113 Ga0065704_100091135 342
363 3300005289 Ga0065704_10070610 Ga0065704_1007061011 342
364 3300005295 Ga0065707_10093677 Ga0065707_100936774 342
365 3300005295 Ga0065707_10144281 Ga0065707_101442812 342
366 3300005327 Ga0070658_10133606 Ga0070658_101336061 342
367 3300005331 Ga0070670_100166174 Ga0070670_1001661742 342
368 3300005347 Ga0070668_100001596 Ga0070668_1000015967 342
369 3300005353 Ga0070669_100000056 Ga0070669_10000005654 342
370 3300005353 Ga0070669_100013132 Ga0070669_1000131321 342
371 3300005353 Ga0070669_100211468 Ga0070669_1002114681 342
372 3300005355 Ga0070671_100012272 Ga0070671_1000122726 342
373 3300005355 Ga0070671_100042748 Ga0070671_1000427482 342
374 3300005367 Ga0070667_100002172 Ga0070667_10000217213 342
375 3300005367 Ga0070667_100043636 Ga0070667_1000436364 342
376 3300005530 Ga0070679_100011790 Ga0070679_1000117908 342
377 3300005548 Ga0070665_100002164 Ga0070665_1000021642 342
378 3300005548 Ga0070665_100079499 Ga0070665_1000794994 342
379 3300005563 Ga0068855_100103441 Ga0068855_1001034413 342
380 3300005616 Ga0068852_100420319 Ga0068852_1004203191 342
381 3300005842 Ga0068858_100022546 Ga0068858_1000225465 342
382 3300005842 Ga0068858_100044087 Ga0068858_1000440873 342
383 3300005843 Ga0068860_100005374 Ga0068860_10000537410 342
384 3300006058 Ga0075432_10010630 Ga0075432_100106302 342
385 3300006353 Ga0075370_10004142 Ga0075370_100041421 342
386 3300006946 Ga0079104_1030865 Ga0079104_10308652 342
387 3300009177 Ga0105248_10047898 Ga0105248_100478984 342
388 3300009177 Ga0105248_10155032 Ga0105248_101550322 342
389 3300009177 Ga0105248_10312391 Ga0105248_103123911 342
390 3300009553 Ga0105249_10000123 Ga0105249_1000012329 342
391 3300013306 Ga0163162_10062635 Ga0163162_100626352 342
392 3300014326 Ga0157380_10028296 Ga0157380_100282963 342
393 3300017792 Ga0163161_10014323 Ga0163161_100143232 342
394 3300017792 Ga0163161_10039436 Ga0163161_100394362 342
395 3300025711 Ga0207696_1003632 Ga0207696_10036322 342
396 3300025921 Ga0207652_10003649 Ga0207652_100036493 342
397 3300025923 Ga0207681_10000019 Ga0207681_10000019182 342
398 3300025923 Ga0207681_10067232 Ga0207681_100672323 342
399 3300025925 Ga0207650_10210022 Ga0207650_102100222 342
400 3300025931 Ga0207644_10000446 Ga0207644_100004462 342
401 3300025949 Ga0207667_10094048 Ga0207667_100940483 342
402 3300025961 Ga0207712_10000102 Ga0207712_1000010230 342
403 3300025972 Ga0207668_10000618 Ga0207668_100006185 342
404 3300025986 Ga0207658_10001615 Ga0207658_1000161513 342
405 3300025986 Ga0207658_10058050 Ga0207658_100580503 342
406 3300026035 Ga0207703_10015133 Ga0207703_100151335 342
407 3300026035 Ga0207703_10056187 Ga0207703_100561872 342
408 3300026142 Ga0207698_10225109 Ga0207698_102251092 342
409 3300027111 Ga0209281_1007404 Ga0209281_10074042 342
410 3300028379 Ga0268266_10002061 Ga0268266_1000206111 342
411 3300028379 Ga0268266_10085384 Ga0268266_100853842 342
412 3300028379 Ga0268266_10103441 Ga0268266_101034413 342
413 3300028380 Ga0268265_10029687 Ga0268265_100296872 342
414 3300028381 Ga0268264_10011006 Ga0268264_100110068 342
415 3300031251 Ga0265327_10036809 Ga0265327_100368092 342
416 3300031616 Ga0307508_10010338 Ga0307508_100103384 342
417 3300031824 Ga0307413_10043785 Ga0307413_100437851 342
418 3300031824 Ga0307413_10058025 Ga0307413_100580251 342
419 3300031852 Ga0307410_10013400 Ga0307410_100134003 342
420 3300031852 Ga0307410_10033994 Ga0307410_100339942 342
421 3300031903 Ga0307407_10024624 Ga0307407_100246242 342
422 3300031995 Ga0307409_100118205 Ga0307409_1001182053 342
423 3300032002 Ga0307416_100008298 Ga0307416_1000082985 342
424 3300032005 Ga0307411_10021405 Ga0307411_100214051 342
425 3300032005 Ga0307411_10078747 Ga0307411_100787471 342
426 3300032126 Ga0307415_100053359 Ga0307415_1000533593 342
427 3300046500 Ga0495596_0000119 Ga0495596_0000119_49765_50817 342
428 3300046501 Ga0495607_0007039 Ga0495607_0007039_4897_5949 342
429 3300046506 Ga0495583_0039881 Ga0495583_0039881_255_1307 342
430 3300046507 Ga0495606_0024329 Ga0495606_0024329_1123_2175 342
431 3300046522 Ga0495643_0022436 Ga0495643_0022436_1074_2126 342
432 3300046522 Ga0495643_0028242 Ga0495643_0028242_1483_2535 342
433 3300046522 Ga0495643_0033021 Ga0495643_0033021_1601_2629 342
434 3300046660 Ga0495625_0014033 Ga0495625_0014033_3678_4730 342
435 3300046692 Ga0495671_0064128 Ga0495671_0064128_423_1475 342
436 3300048903 Ga0496100_0033018 Ga0496100_0033018_894_1922 342
437 3300048904 Ga0496101_0009605 Ga0496101_0009605_1659_2687 342
438 3300048905 Ga0496102_0000768 Ga0496102_0000768_22489_23517 342
439 3300048906 Ga0496103_0001148 Ga0496103_0001148_3191_4219 342
440 3300048907 Ga0496104_0001773 Ga0496104_0001773_1110_2138 342
441 3300048908 Ga0496105_0006834 Ga0496105_0006834_4607_5635 342
442 3300048909 Ga0496106_0124046 Ga0496106_0124046_689_1717 342
443 3300048910 Ga0496107_0046768 Ga0496107_0046768_1085_2230 342
444 3300048912 Ga0496109_0022253 Ga0496109_0022253_4075_5136 342
445 3300048915 Ga0496112_0023353 Ga0496112_0023353_334_1362 342
446 3300048916 Ga0496113_0028190 Ga0496113_0028190_2446_3474 342
447 3300048920 Ga0496117_0001020 Ga0496117_0001020_8754_9782 342
448 3300048920 Ga0496117_0032449 Ga0496117_0032449_223_1299 342
449 3300048921 Ga0496118_0098872 Ga0496118_0098872_89_1165 342
450 3300048922 Ga0496119_0078041 Ga0496119_0078041_721_1749 342
451 3300048923 Ga0496120_0010787 Ga0496120_0010787_4736_5764 342
452 3300048924 Ga0496121_0026615 Ga0496121_0026615_694_1722 342
453 3300048925 Ga0496122_0008900 Ga0496122_0008900_4274_5338 342
454 3300048925 Ga0496122_0026553 Ga0496122_0026553_1361_2389 342
455 3300048925 Ga0496122_0099811 Ga0496122_0099811_151_1206 342
456 3300048926 Ga0496123_0085588 Ga0496123_0085588_692_1720 342
457 3300048927 Ga0496124_0003326 Ga0496124_0003326_13410_14438 342
458 3300048929 Ga0496126_0000051 Ga0496126_0000051_223602_224630 342
459 3300049663 Ga0501223_000016 Ga0501223_000016_6176_7237 342
460 3300049669 Ga0501235_003688 Ga0501235_003688_953_2014 342
461 3300049676 Ga0501246_000930 Ga0501246_000930_727_1788 342
462 3300049705 Ga0501225_0000013 Ga0501225_0000013_6202_7263 342
463 3300049705 Ga0501225_0004736 Ga0501225_0004736_1904_2965 342
464 3300049708 Ga0501245_002499 Ga0501245_002499_711_1772 342
465 3300049778 Ga0501282_003798 Ga0501282_003798_232_1293 342
466 3300050493 nmdc:mga0k408_41451_c1 nmdc:mga0k408_41451_c1_597_1625 342
467 3300050496 nmdc:mga07m45_32180_c1 nmdc:mga07m45_32180_c1_135_1163 342
468 3300050496 nmdc:mga07m45_91_c2 nmdc:mga07m45_91_c2_679_1707 342
469 3300053087 Ga0500643_000005 Ga0500643_000005_333378_334406 342
470 3300053087 Ga0500643_003354 Ga0500643_003354_557_1585 342
471 3300053094 Ga0500566_0036445 Ga0500566_0036445_449_1477 342
472 3300053119 Ga0500595_017151 Ga0500595_017151_1474_2502 342
473 3300053121 Ga0500607_000473 Ga0500607_000473_1620_2648 342
474 3300053122 Ga0500608_000438 Ga0500608_000438_12763_13791 342
475 3300053123 Ga0500614_004745 Ga0500614_004745_1027_2055 342
476 3300053136 Ga0500559_0001290 Ga0500559_0001290_11796_12824 342
477 3300053136 Ga0500559_0003774 Ga0500559_0003774_4608_5636 342
478 3300053138 Ga0500564_002230 Ga0500564_002230_1510_2538 342
479 3300053148 Ga0500590_000274 Ga0500590_000274_13498_14526 342
480 3300053156 Ga0500622_0000587 Ga0500622_0000587_3381_4409 342
481 3300053178 Ga0500637_0001632 Ga0500637_0001632_1746_2774 342
482 3300053723 Ga0500567_000200 Ga0500567_000200_12677_13705 342
483 3300053729 Ga0500625_000014 Ga0500625_000014_66423_67451 342
484 3300053730 Ga0500645_007838 Ga0500645_007838_1019_2047 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

2

332

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jpi-assembly1.cif.gz_A-2 phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9497 1 337
1jph-assembly1.cif.gz_A-2 ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9492 1 337
2eja-assembly1.cif.gz_B crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus 0.945 2 341
1r3q-assembly1.cif.gz_A uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i 0.9448 1 337
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.9447 1 337
ID Description Score Start End Superfamily
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.945 2 341 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9447 1 337 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9381 1 336 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9368 2 341 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9306 3 341 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A844Z894-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9937 1 341 GO:0004853
GO:0005829
GO:0019353
AF-A0A653J780-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9933 1 341 GO:0004853
GO:0005829
GO:0019353
AF-A0A4Q2KJY7-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9929 1 341 GO:0004853
GO:0005829
GO:0019353
AF-A0A502CTB7-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.992 4 338 GO:0004853
GO:0005829
GO:0019353
AF-A0A6N0WZN4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9916 1 338 GO:0004853
GO:0005829
GO:0019353

Feature Viewer

pLDDT pTM Quality
93.24 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map