F452892

General Info

Members Datasets Scaffolds Average Seq Length
484 312 968 152

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100174535|Ga0070694_1001745351
Length 186
Sequence MIRVQREDFDPGQEQARLTVGRTDIGGVVTFCGLVREEIGSGAALAGGRLAGEQIRAMTLEHYPGMTEKMLAAIEAEAQARWPLSASLIVHRYGRLLPGDRIVLVITCSAHRQAAFEANMFLVDWLKTKAPFWKLEERRAGAAWVEARASDDAAAKRWARSTPSAGGGDAKAVRSKARKPAPKAAE

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
73 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
162 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
212 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
213 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
214 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
238 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
239 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
240 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
241 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
244 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
245 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
246 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
252 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
253 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
254 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
277 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
278 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
284 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
290 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
295 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
296 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
297 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
298 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
299 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
300 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
301 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
302 2849560528 Caulobacter zeae 410 Isolate Unclassified
303 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
304 2851153111 Caulobacter radicis 736 Isolate Unclassified
305 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
306 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
307 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
308 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
309 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
310 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
311 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
312 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.87
Metatranscriptomes 0.21
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.16
Nodule 0
Rhizoplane 3.1
Rhizosphere 78.1
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100174535 3300005444 Bacteria 1585
2 JGI25151J46595_10000290 3300003187 Bacteria 56749
3 JGI25406J46586_10000203 3300003203 Bacteria 26378
4 JGI25160J50197_1019627 3300003354 Bacteria 2066
5 Ga0055526_1020555 3300003771 Bacteria 2342
6 Ga0055524_1005249 3300003775 Bacteria 5821
7 Ga0055524_1020526 3300003775 Bacteria 2222
8 Ga0065165_1029653 3300005262 Bacteria 1750
9 Ga0065715_10090252 3300005293 Bacteria 7352
10 Ga0070683_101213236 3300005329 Bacteria 725
11 Ga0070690_100088192 3300005330 Bacteria 2039
12 Ga0070670_100736218 3300005331 Bacteria 888
13 Ga0068869_100273420 3300005334 Bacteria 1356
14 Ga0070680_100229947 3300005336 Bacteria 1566
15 Ga0070689_100888226 3300005340 Bacteria 788
16 Ga0070668_100260595 3300005347 Bacteria 1442
17 Ga0070668_100382120 3300005347 Bacteria 1199
18 Ga0070668_100483035 3300005347 Bacteria 1070
19 Ga0070659_100721427 3300005366 Bacteria 863
20 Ga0070667_100258859 3300005367 Bacteria 1557
21 Ga0070703_10314368 3300005406 Bacteria 657
22 Ga0070714_100006838 3300005435 Bacteria 8840
23 Ga0070713_101043763 3300005436 Bacteria 789
24 Ga0070711_100910543 3300005439 Bacteria 751
25 Ga0070694_100138513 3300005444 Bacteria 1765
26 Ga0070694_100157604 3300005444 Bacteria 1663
27 Ga0070663_100068579 3300005455 Bacteria 2575
28 Ga0070663_100530687 3300005455 Bacteria 981
29 Ga0070681_10063655 3300005458 Bacteria 3660
30 Ga0070681_10231318 3300005458 Bacteria 1763
31 Ga0070681_10314408 3300005458 Bacteria 1475
32 Ga0070681_10483429 3300005458 Bacteria 1151
33 Ga0070681_10565666 3300005458 Bacteria 1051
34 Ga0070707_100038568 3300005468 Bacteria 4563
35 Ga0070698_100522312 3300005471 Bacteria 1126
36 Ga0070699_100056824 3300005518 Bacteria 3389
37 Ga0070679_100009479 3300005530 Bacteria 9210
38 Ga0070679_100119245 3300005530 Bacteria 2623
39 Ga0070684_100914562 3300005535 Bacteria 822
40 Ga0068853_100056940 3300005539 Bacteria 3372
41 Ga0068853_100243936 3300005539 Bacteria 1647
42 Ga0070695_100010028 3300005545 Bacteria 5650
43 Ga0070695_100487565 3300005545 Bacteria 951
44 Ga0070696_100101640 3300005546 Bacteria 2061
45 Ga0070665_100228709 3300005548 Bacteria 1860
46 Ga0070704_100399688 3300005549 Bacteria 1172
47 Ga0070704_100647372 3300005549 Bacteria 933
48 Ga0068855_100029866 3300005563 Bacteria 6519
49 Ga0068855_101978909 3300005563 Bacteria 589
50 Ga0068857_100220025 3300005577 Bacteria 1734
51 Ga0068854_101045831 3300005578 Bacteria 725
52 Ga0068856_101262293 3300005614 Bacteria 754
53 Ga0068856_101555285 3300005614 Bacteria 675
54 Ga0070702_100620467 3300005615 Bacteria 813
55 Ga0068859_100011274 3300005617 Bacteria 8995
56 Ga0068864_100087146 3300005618 Bacteria 2748
57 Ga0068864_100472236 3300005618 Bacteria 1203
58 Ga0068861_101547913 3300005719 Bacteria 652
59 Ga0068863_100001219 3300005841 Bacteria 25689
60 Ga0068863_101058516 3300005841 Bacteria 815
61 Ga0068860_100002421 3300005843 Bacteria 19585
62 Ga0068860_100090911 3300005843 Bacteria 2908
63 Ga0068862_100014126 3300005844 Bacteria 6621
64 Ga0068862_101199858 3300005844 Bacteria 757
65 Ga0081455_10658205 3300005937 Bacteria 673
66 Ga0081540_1098798 3300005983 Bacteria 1263
67 Ga0081539_10000240 3300005985 Bacteria 128629
68 Ga0081539_10287221 3300005985 Bacteria 713
69 Ga0075363_100143284 3300006048 Bacteria 1347
70 Ga0070712_100349411 3300006175 Bacteria 1210
71 Ga0075362_10004762 3300006177 Bacteria 4902
72 Ga0075362_10008245 3300006177 Bacteria 3978
73 Ga0075367_10070953 3300006178 Bacteria 2095
74 Ga0075369_10102382 3300006186 Bacteria 1286
75 Ga0075369_10127467 3300006186 Bacteria 1155
76 Ga0075428_100264117 3300006844 Bacteria 1853
77 Ga0075428_100461464 3300006844 Bacteria 1360
78 Ga0075430_100026572 3300006846 Bacteria 4923
79 Ga0075430_100514165 3300006846 Bacteria 988
80 Ga0075431_100020317 3300006847 Bacteria 6783
81 Ga0075431_100176678 3300006847 Bacteria 2193
82 Ga0075433_10276859 3300006852 Bacteria 1487
83 Ga0075433_10297904 3300006852 Bacteria 1428
84 Ga0075433_11296898 3300006852 Bacteria 631
85 Ga0075434_100031611 3300006871 Bacteria 5219
86 Ga0075434_100091834 3300006871 Bacteria 3038
87 Ga0075429_100701935 3300006880 Bacteria 886
88 Ga0075436_100517028 3300006914 Unclassified 874
89 Ga0097620_100011274 3300006931 Bacteria 8995
90 Ga0075435_101356130 3300007076 Bacteria 623
91 Ga0105240_10038581 3300009093 Bacteria 6125
92 Ga0105240_10127988 3300009093 Bacteria 3049
93 Ga0105240_10193242 3300009093 Bacteria 2392
94 Ga0105240_10225836 3300009093 Bacteria 2179
95 Ga0105240_10610109 3300009093 Bacteria 1200
96 Ga0105240_11436077 3300009093 Bacteria 725
97 Ga0111539_10445470 3300009094 Bacteria 1508
98 Ga0111539_12412486 3300009094 Bacteria 610
99 Ga0105245_11127068 3300009098 Bacteria 831
100 Ga0114129_10017466 3300009147 Bacteria 10215
101 Ga0114129_10231220 3300009147 Bacteria 2490
102 Ga0114129_10266601 3300009147 Bacteria 2293
103 Ga0114129_10313623 3300009147 Bacteria 2087
104 Ga0114129_10883231 3300009147 Bacteria 1134
105 Ga0114129_10897158 3300009147 Bacteria 1123
106 Ga0105243_10268901 3300009148 Bacteria 1529
107 Ga0105241_10640951 3300009174 Bacteria 964
108 Ga0105242_11242917 3300009176 Bacteria 766
109 Ga0105248_10023607 3300009177 Bacteria 6833
110 Ga0105248_10102363 3300009177 Bacteria 3228
111 Ga0105237_10248099 3300009545 Bacteria 1782
112 Ga0105238_10094908 3300009551 Bacteria 2970
113 Ga0105033_126277 3300009986 Bacteria 535
114 Ga0105035_119217 3300009988 Bacteria 645
115 Ga0105035_120154 3300009988 Bacteria 632
116 Ga0105239_10214746 3300010375 Bacteria 2156
117 Ga0157370_10020853 3300013104 Bacteria 6539
118 Ga0157515_139265 3300013875 Bacteria 632
119 Ga0163163_10174711 3300014325 Bacteria 2194
120 Ga0163163_11269821 3300014325 Bacteria 799
121 Ga0182008_10179016 3300014497 Bacteria 1072
122 Ga0157379_11004604 3300014968 Bacteria 795
123 Ga0157379_11778487 3300014968 Bacteria 605
124 Ga0157379_12553023 3300014968 Bacteria 511
125 Ga0213873_10020680 3300021358 Bacteria 1540
126 Ga0213872_10020081 3300021361 Bacteria 3078
127 Ga0213872_10031988 3300021361 Bacteria 2411
128 Ga0213872_10058748 3300021361 Bacteria 1740
129 Ga0213872_10087404 3300021361 Bacteria 1396
130 Ga0213872_10088235 3300021361 Bacteria 1389
131 Ga0213872_10117407 3300021361 Bacteria 1178
132 Ga0213872_10170918 3300021361 Bacteria 942
133 Ga0213876_10003623 3300021384 Bacteria 8784
134 Ga0213875_10000963 3300021388 Bacteria 20574
135 Ga0213875_10011250 3300021388 Bacteria 4457
136 Ga0213875_10053107 3300021388 Bacteria 1898
137 Ga0213875_10063930 3300021388 Bacteria 1720
138 Ga0213875_10121669 3300021388 Bacteria 1220
139 Ga0213871_10006952 3300021441 Bacteria 2422
140 Ga0224712_10226626 3300022467 Bacteria 857
141 Ga0209130_1001424 3300025284 Bacteria 15911
142 Ga0209675_1004932 3300025291 Bacteria 5755
143 Ga0209025_1000212 3300025294 Bacteria 139086
144 Ga0209564_1000397 3300025295 Bacteria 77778
145 Ga0209564_1016064 3300025295 Bacteria 3005
146 Ga0209758_1046356 3300025297 Bacteria 1568
147 Ga0209256_1002646 3300025299 Bacteria 14093
148 Ga0207426_1000102 3300025302 Bacteria 255303
149 Ga0207707_10023240 3300025912 Bacteria 5424
150 Ga0207707_10478086 3300025912 Bacteria 1064
151 Ga0207707_11265441 3300025912 Bacteria 594
152 Ga0207695_10029349 3300025913 Bacteria 6081
153 Ga0207695_10076630 3300025913 Bacteria 3399
154 Ga0207695_10576421 3300025913 Bacteria 1007
155 Ga0207671_10293044 3300025914 Bacteria 1285
156 Ga0207693_10389020 3300025915 Bacteria 1090
157 Ga0207652_10099699 3300025921 Bacteria 2563
158 Ga0207652_10245085 3300025921 Bacteria 1616
159 Ga0207646_10168113 3300025922 Bacteria 1980
160 Ga0207681_11030295 3300025923 Bacteria 691
161 Ga0207694_10204899 3300025924 Bacteria 1605
162 Ga0207659_11566467 3300025926 Bacteria 563
163 Ga0207687_11299333 3300025927 Bacteria 625
164 Ga0207700_11195431 3300025928 Bacteria 679
165 Ga0207706_10233846 3300025933 Bacteria 1607
166 Ga0207706_10337294 3300025933 Bacteria 1311
167 Ga0207669_10893247 3300025937 Bacteria 742
168 Ga0207704_10633167 3300025938 Bacteria 879
169 Ga0207711_10028131 3300025941 Bacteria 4728
170 Ga0207711_10949272 3300025941 Bacteria 799
171 Ga0207667_10126575 3300025949 Bacteria 2631
172 Ga0207668_10549578 3300025972 Bacteria 1000
173 Ga0207668_10565227 3300025972 Bacteria 987
174 Ga0207658_10173059 3300025986 Bacteria 1781
175 Ga0207639_10052456 3300026041 Bacteria 3108
176 Ga0207678_10063138 3300026067 Bacteria 3183
177 Ga0207641_10004476 3300026088 Bacteria 12094
178 Ga0207674_10333792 3300026116 Bacteria 1466
179 Ga0207675_100903619 3300026118 Bacteria 899
180 Ga0209984_1024093 3300027424 Bacteria 843
181 Ga0209998_10007683 3300027717 Bacteria 2237
182 Ga0209974_10030814 3300027876 Bacteria 1776
183 Ga0209974_10037050 3300027876 Bacteria 1619
184 Ga0268266_10465002 3300028379 Bacteria 1204
185 Ga0268264_10000820 3300028381 Bacteria 33465
186 Ga0268264_10626736 3300028381 Bacteria 1062
187 Ga0265318_10107233 3300028577 Bacteria 1027
188 Ga0265318_10158054 3300028577 Bacteria 831
189 Ga0307515_10011587 3300028794 Bacteria 16720
190 Ga0265338_10041844 3300028800 Bacteria 4278
191 Ga0265324_10001043 3300029957 Bacteria 16919
192 Ga0265324_10131328 3300029957 Bacteria 850
193 Ga0265324_10144088 3300029957 Bacteria 809
194 Ga0265328_10071262 3300031239 Bacteria 1278
195 Ga0265320_10003923 3300031240 Bacteria 9828
196 Ga0265331_10000194 3300031250 Bacteria 74646
197 Ga0265331_10080632 3300031250 Bacteria 1512
198 Ga0265331_10502578 3300031250 Bacteria 546
199 Ga0265327_10000928 3300031251 Bacteria 42902
200 Ga0307408_100310302 3300031548 Bacteria 1325
201 Ga0265313_10002979 3300031595 Bacteria 14117
202 Ga0265314_10055814 3300031711 Bacteria 2724
203 Ga0265314_10090743 3300031711 Bacteria 1990
204 Ga0316576_10024571 3300031727 Bacteria 4208
205 Ga0307405_10994117 3300031731 Bacteria 715
206 Ga0316577_10078367 3300031733 Bacteria 1846
207 Ga0307406_10977132 3300031901 Bacteria 725
208 Ga0307416_100224163 3300032002 Bacteria 1806
209 Ga0307416_100234523 3300032002 Bacteria 1772
210 Ga0307416_101560502 3300032002 Bacteria 766
211 Ga0307411_10897306 3300032005 Bacteria 787
212 Ga0316583_10282648 3300032133 Bacteria 574
213 Ga0373923_0029770 3300035111 Bacteria 2192
214 Ga0373943_0263390 3300035170 Bacteria 971
215 Ga0316574_0006048 3300035398 Bacteria 6505
216 Ga0373935_0532339 3300035692 Bacteria 855
217 Ga0373927_0218525 3300035695 Bacteria 1252
218 Ga0373927_0241667 3300035695 Bacteria 1187
219 Ga0373933_0485704 3300035724 Bacteria 809
220 Ga0373937_0019631 3300036401 Bacteria 6050
221 Ga0316584_0009353 3300036712 Bacteria 6797
222 Ga0373925_0086519 3300037068 Bacteria 2391
223 Ga0373925_0693664 3300037068 Bacteria 839
224 Ga0395899_0010644 3300037312 Bacteria 7048
225 Ga0395900_0060839 3300037418 Bacteria 3884
226 Ga0395898_0005108 3300037466 Bacteria 14224
227 Ga0395898_0156637 3300037466 Bacteria 2179
228 Ga0436364_0217969 3300037853 Bacteria 6227
229 Ga0436364_0757094 3300037853 Bacteria 1893
230 Ga0436364_0979303 3300037853 Bacteria 39415
231 Ga0436364_1216742 3300037853 Bacteria 3445
232 Ga0436364_1564687 3300037853 Bacteria 4965
233 Ga0395901_0010632 3300038443 Bacteria 9326
234 Ga0395901_0054446 3300038443 Bacteria 4158
235 Ga0395901_0517455 3300038443 Bacteria 1213
236 Ga0395901_0569394 3300038443 Bacteria 1146
237 Ga0436365_0054759 3300039437 Bacteria 6993
238 Ga0436365_0895402 3300039437 Bacteria 1398
239 Ga0436360_0546151 3300039438 Bacteria 1118
240 Ga0436360_0649673 3300039438 Bacteria 2392
241 Ga0436360_0824855 3300039438 Bacteria 722
242 Ga0436360_0871572 3300039438 Bacteria 6477
243 Ga0436360_1097959 3300039438 Bacteria 550
244 Ga0436361_0014192 3300039447 Bacteria 7870
245 Ga0436361_0078045 3300039447 Bacteria 841
246 Ga0436361_0134486 3300039447 Bacteria 3376
247 Ga0436361_0210234 3300039447 Bacteria 3275
248 Ga0436361_0226184 3300039447 Bacteria 2697
249 Ga0436361_0284853 3300039447 Bacteria 1540
250 Ga0436361_0326992 3300039447 Bacteria 19284
251 Ga0436361_0372157 3300039447 Bacteria 1354
252 Ga0436361_0518557 3300039447 Bacteria 5651
253 Ga0436361_0575585 3300039447 Bacteria 1506
254 Ga0436361_0598340 3300039447 Bacteria 1199
255 Ga0436361_0675233 3300039447 Bacteria 5782
256 Ga0436361_0726868 3300039447 Bacteria 3204
257 Ga0436361_0903096 3300039447 Bacteria 924
258 Ga0436361_1049896 3300039447 Bacteria 3199
259 Ga0436361_1082774 3300039447 Bacteria 1112
260 Ga0436363_0162544 3300039450 Bacteria 2177
261 Ga0436362_0614989 3300039453 Bacteria 3423
262 Ga0436362_1225684 3300039453 Bacteria 617
263 Ga0439465_0023693 3300041413 Bacteria 1932
264 Ga0451787_152004 3300041441 Bacteria 580
265 Ga0451849_0252292 3300041505 Bacteria 584
266 Ga0439437_025691 3300042000 Bacteria 726
267 Ga0450907_012402 3300042146 Bacteria 1418
268 Ga0439446_0023768 3300042156 Bacteria 1745
269 Ga0451577_0029282 3300042876 Bacteria 4976
270 Ga0451577_0138832 3300042876 Bacteria 2183
271 Ga0453683_0205672 3300044673 Bacteria 1250
272 Ga0453684_0009034 3300044712 Bacteria 17591
273 Ga0453684_0051971 3300044712 Bacteria 5364
274 Ga0453684_0142629 3300044712 Bacteria 2858
275 Ga0453684_1754454 3300044712 Bacteria 632
276 Ga0466968_0412818 3300044735 Bacteria 663
277 Ga0466957_0005329 3300044842 Bacteria 7216
278 Ga0451576_0001471 3300045051 Bacteria 39915
279 Ga0451576_0001637 3300045051 Bacteria 37429
280 Ga0451576_0084524 3300045051 Bacteria 3301
281 Ga0451576_0110429 3300045051 Bacteria 2862
282 Ga0451576_0424848 3300045051 Bacteria 1394
283 Ga0451576_1602195 3300045051 Bacteria 675
284 Ga0466967_0977328 3300045976 Bacteria 843
285 Ga0466967_1106842 3300045976 Bacteria 789
286 Ga0495638_0000639 3300046460 Bacteria 38450
287 Ga0495638_0000972 3300046460 Bacteria 28909
288 Ga0495650_0000468 3300046471 Bacteria 62149
289 Ga0495650_0033744 3300046471 Bacteria 2274
290 Ga0495664_0065809 3300046477 Bacteria 2161
291 Ga0495606_0034256 3300046507 Bacteria 3487
292 Ga0495610_0000663 3300046512 Bacteria 33505
293 Ga0495610_0069343 3300046512 Bacteria 1650
294 Ga0495620_0025962 3300046515 Bacteria 2762
295 Ga0495620_0223050 3300046515 Bacteria 721
296 Ga0495631_0047264 3300046518 Bacteria 1890
297 Ga0495632_0140521 3300046519 Bacteria 1120
298 Ga0495637_0003037 3300046520 Bacteria 8974
299 Ga0495643_0072895 3300046522 Bacteria 1800
300 Ga0495643_0103399 3300046522 Bacteria 1457
301 Ga0495644_0214678 3300046523 Bacteria 743
302 Ga0495648_0034597 3300046524 Bacteria 3286
303 Ga0495654_0010175 3300046530 Bacteria 5128
304 Ga0495654_0072550 3300046530 Bacteria 1629
305 Ga0495609_0031379 3300046538 Bacteria 2416
306 Ga0495633_0105974 3300046558 Bacteria 1304
307 Ga0495668_0029995 3300046616 Bacteria 3072
308 Ga0495668_0077976 3300046616 Bacteria 1819
309 Ga0495625_0000152 3300046660 Bacteria 105589
310 Ga0495625_0009565 3300046660 Bacteria 8098
311 Ga0495625_0014695 3300046660 Bacteria 6236
312 Ga0495635_0198788 3300046663 Bacteria 1360
313 Ga0495670_0536228 3300046691 Bacteria 636
314 Ga0495649_0421234 3300046694 Bacteria 669
315 Ga0495672_0001471 3300047320 Bacteria 23126
316 Ga0495679_009455 3300047446 Bacteria 3902
317 Ga0495673_0002747 3300047469 Bacteria 12052
318 Ga0495686_0161473 3300047472 Bacteria 1309
319 Ga0495602_0100116 3300048088 Bacteria 2381
320 Ga0495602_0828815 3300048088 Bacteria 619
321 Ga0496101_0513947 3300048904 Bacteria 946
322 Ga0496102_0525737 3300048905 Bacteria 1105
323 Ga0496103_0552780 3300048906 Bacteria 735
324 Ga0496106_0233140 3300048909 Bacteria 1470
325 Ga0496107_0000209 3300048910 Bacteria 30900
326 Ga0496107_0065922 3300048910 Bacteria 2625
327 Ga0496108_0422038 3300048911 Bacteria 1165
328 Ga0496109_0273832 3300048912 Bacteria 1591
329 Ga0496109_1057845 3300048912 Bacteria 749
330 Ga0496110_0555911 3300048913 Unclassified 1043
331 Ga0496111_0382611 3300048914 Bacteria 1041
332 Ga0496112_0775261 3300048915 Bacteria 884
333 Ga0496115_0016590 3300048918 Bacteria 5611
334 Ga0496115_0081961 3300048918 Bacteria 2628
335 Ga0496121_0003463 3300048924 Bacteria 22495
336 Ga0496121_0394489 3300048924 Bacteria 908
337 Ga0496121_0628756 3300048924 Bacteria 658
338 Ga0496123_0037534 3300048926 Bacteria 3419
339 Ga0496124_0106664 3300048927 Bacteria 2262
340 Ga0496125_0263118 3300048928 Bacteria 1080
341 Ga0496125_0380688 3300048928 Bacteria 832
342 Ga0501290_000181 3300049513 Bacteria 10137
343 Ga0501292_000065 3300049515 Bacteria 21691
344 Ga0501293_015394 3300049516 Bacteria 704
345 Ga0501294_004572 3300049517 Bacteria 1302
346 Ga0501032_0171879 3300049569 Bacteria 1421
347 Ga0501033_0027509 3300049570 Bacteria 4275
348 Ga0501033_0561715 3300049570 Bacteria 785
349 Ga0501034_0236396 3300049571 Bacteria 1775
350 Ga0501034_0256602 3300049571 Bacteria 1692
351 Ga0501034_0444602 3300049571 Bacteria 1215
352 Ga0501034_0943322 3300049571 Bacteria 749
353 Ga0501036_0571826 3300049572 Bacteria 938
354 Ga0501037_0904521 3300049573 Bacteria 578
355 Ga0501038_0039918 3300049574 Bacteria 4103
356 Ga0501039_0147352 3300049575 Unclassified 1850
357 Ga0501040_0002576 3300049576 Bacteria 11693
358 Ga0501041_0002803 3300049577 Bacteria 9957
359 Ga0501042_0239019 3300049578 Bacteria 1310
360 Ga0501043_0165470 3300049579 Unclassified 1727
361 Ga0501046_0005678 3300049580 Bacteria 11138
362 Ga0501047_0169721 3300049581 Bacteria 2051
363 Ga0501047_0320093 3300049581 Bacteria 1391
364 Ga0501047_0417702 3300049581 Bacteria 1173
365 Ga0501048_0012365 3300049582 Bacteria 6350
366 Ga0501048_0525071 3300049582 Bacteria 849
367 Ga0501067_0192916 3300049583 Bacteria 1135
368 Ga0501067_0311026 3300049583 Bacteria 877
369 Ga0501069_0089114 3300049585 Bacteria 1744
370 Ga0501070_0275162 3300049586 Bacteria 1374
371 Ga0501070_1127872 3300049586 Bacteria 604
372 Ga0501071_0046923 3300049587 Unclassified 3103
373 Ga0501072_0106801 3300049588 Unclassified 2226
374 Ga0501072_0344559 3300049588 Bacteria 1183
375 Ga0501072_0800967 3300049588 Bacteria 738
376 Ga0501074_0800907 3300049590 Bacteria 664
377 Ga0501075_0006258 3300049591 Bacteria 8184
378 Ga0501076_0010384 3300049592 Bacteria 6910
379 Ga0501076_0463071 3300049592 Bacteria 1044
380 Ga0501076_0680544 3300049592 Bacteria 849
381 Ga0501206_000963 3300049653 Bacteria 3571
382 Ga0501222_002643 3300049662 Bacteria 2475
383 Ga0501223_021642 3300049663 Bacteria 1257
384 Ga0501224_001910 3300049664 Bacteria 2807
385 Ga0501227_045168 3300049665 Bacteria 1099
386 Ga0501233_044143 3300049668 Bacteria 1058
387 Ga0501238_000522 3300049671 Bacteria 4394
388 Ga0501238_002142 3300049671 Bacteria 2332
389 Ga0501261_000083 3300049690 Bacteria 15292
390 Ga0501225_0002881 3300049705 Bacteria 5282
391 Ga0501245_000315 3300049708 Bacteria 5713
392 Ga0501079_0007638 3300049741 Bacteria 8190
393 Ga0501080_0047243 3300049742 Bacteria 4007
394 Ga0501080_0563214 3300049742 Bacteria 1014
395 Ga0501080_0600673 3300049742 Bacteria 977
396 Ga0501080_0608809 3300049742 Bacteria 969
397 Ga0501080_0925378 3300049742 Bacteria 759
398 Ga0501081_0003618 3300049743 Bacteria 9886
399 Ga0501083_0012684 3300049744 Bacteria 5896
400 Ga0501279_000010 3300049775 Bacteria 103375
401 Ga0501280_000132 3300049776 Bacteria 19443
402 Ga0501281_00065 3300049777 Bacteria 12291
403 Ga0501282_000304 3300049778 Bacteria 5945
404 Ga0501283_015981 3300049779 Bacteria 1160
405 Ga0501035_0107876 3300049822 Bacteria 2441
406 Ga0501035_0223887 3300049822 Bacteria 1605
407 Ga0501035_0569368 3300049822 Bacteria 926
408 Ga0501044_0015554 3300049823 Bacteria 8197
409 Ga0501044_0164145 3300049823 Bacteria 2196
410 Ga0501044_0189712 3300049823 Bacteria 2019
411 Ga0501044_0630013 3300049823 Bacteria 963
412 Ga0501045_0051529 3300049824 Bacteria 3004
413 nmdc:mga03683_22435_c1 3300050489 Bacteria 2447
414 nmdc:mga03683_8293_c1 3300050489 Bacteria 3647
415 nmdc:mga03n38_505587_c1 3300050490 Bacteria 679
416 nmdc:mga00v17_316875_c1 3300050491 Bacteria 1013
417 nmdc:mga0yw44_280612_c1 3300050492 Bacteria 1113
418 nmdc:mga05p37_1138404_c1 3300050507 Bacteria 813
419 nmdc:mga05p37_235594_c1 3300050507 Bacteria 2203
420 nmdc:mga05p37_322729_c1 3300050507 Bacteria 1827
421 nmdc:mga05p37_328843_c1 3300050507 Bacteria 1806
422 nmdc:mga05p37_429865_c1 3300050507 Unclassified 1534
423 nmdc:mga0qj67_68328_c1 3300050509 Bacteria 2832
424 nmdc:mga06r32_163687_c1 3300050510 Bacteria 2207
425 nmdc:mga06r32_28144_c1 3300050510 Bacteria 5256
426 nmdc:mga08y16_441535_c1 3300050511 Bacteria 1328
427 nmdc:mga0n895_240619_c1 3300050512 Bacteria 1836
428 nmdc:mga0n895_401717_c1 3300050512 Bacteria 1386
429 nmdc:mga0n895_80872_c1 3300050512 Bacteria 3238
430 nmdc:mga0a205_182036_c1 3300050515 Bacteria 1995
431 nmdc:mga0a205_368328_c1 3300050515 Bacteria 1303
432 Ga0500578_0053719 3300053086 Bacteria 2579
433 Ga0500643_000195 3300053087 Bacteria 57960
434 Ga0500643_018024 3300053087 Bacteria 2352
435 Ga0500643_018789 3300053087 Bacteria 2287
436 Ga0500644_0410424 3300053088 Bacteria 591
437 Ga0500651_0197459 3300053093 Bacteria 1188
438 Ga0500641_0083514 3300053096 Bacteria 1358
439 Ga0500554_000867 3300053102 Bacteria 5939
440 Ga0500555_033290 3300053103 Bacteria 1453
441 Ga0500556_0000300 3300053104 Bacteria 37857
442 Ga0500556_0235040 3300053104 Unclassified 722
443 Ga0500592_000112 3300053116 Bacteria 17479
444 Ga0500592_003159 3300053116 Bacteria 2633
445 Ga0500614_049042 3300053123 Bacteria 1102
446 Ga0500618_000205 3300053125 Bacteria 46863
447 Ga0500655_002261 3300053133 Bacteria 3536
448 Ga0500655_128248 3300053133 Bacteria 541
449 Ga0500658_0002593 3300053134 Bacteria 6987
450 Ga0500658_0048610 3300053134 Bacteria 1725
451 Ga0500568_0005684 3300053139 Bacteria 6397
452 Ga0500577_0097501 3300053142 Bacteria 1197
453 Ga0500590_025754 3300053148 Bacteria 3054
454 Ga0500622_0025432 3300053156 Bacteria 3127
455 Ga0500627_0006860 3300053158 Bacteria 3915
456 Ga0500627_0093338 3300053158 Bacteria 1347
457 Ga0500639_015232 3300053163 Bacteria 4047
458 Ga0500636_0180149 3300053177 Bacteria 1135
459 Ga0500570_000250 3300053724 Bacteria 18136
460 Ga0500552_002615 3300053733 Unclassified 1769
461 Ga0501084_0069268 3300054114 Unclassified 2953
462 Ga0501084_1059148 3300054114 Bacteria 681
463 Ga0590077_007719 3300059426 Bacteria 2198
464 Ga0501082_0041087 3300060353 Bacteria 3987
465 Ga0501082_0073293 3300060353 Unclassified 2949
466 2512033160 2511231221 Bacteria 6846400
467 2524612099 2524023250 Bacteria 5457705
468 2585149869 2582581279 Bacteria 4980720
469 2585260718 2582581305 Bacteria 4895574
470 2643747720 2643221545 Bacteria 5083237
471 2644506897 2643221691 Bacteria 5093099
472 2821445207 2821443989 Bacteria 7658172
473 2844535710 2844533157 Bacteria 7517899
474 2849562302 2849560528 Bacteria 5393480
475 2849577224 2849573788 Bacteria 5421256
476 2851153209 2851153111 Bacteria 5542585
477 2897809088 2897803580 Bacteria 7000062
478 2898330406 2898329390 Bacteria 5168154
479 2909399874 2909399089 Bacteria 3922598
480 2919451950 2919450847 Bacteria 5631160
481 641335768 641228493 Bacteria 3999591
482 643389583 643348555 Bacteria 3914947
483 8001849962 8001845381 Bacteria 5804942
484 8054005065 8054002106 Bacteria 7987183
485 Ga0070694_100174535
486 JGI25151J46595_10000290
487 JGI25406J46586_10000203
488 JGI25160J50197_1019627
489 Ga0055526_1020555
490 Ga0055524_1005249
491 Ga0055524_1020526
492 Ga0065165_1029653
493 Ga0065715_10090252
494 Ga0070683_101213236
495 Ga0070690_100088192
496 Ga0070670_100736218
497 Ga0068869_100273420
498 Ga0070680_100229947
499 Ga0070689_100888226
500 Ga0070668_100260595
501 Ga0070668_100382120
502 Ga0070668_100483035
503 Ga0070659_100721427
504 Ga0070667_100258859
505 Ga0070703_10314368
506 Ga0070714_100006838
507 Ga0070713_101043763
508 Ga0070711_100910543
509 Ga0070694_100138513
510 Ga0070694_100157604
511 Ga0070663_100068579
512 Ga0070663_100530687
513 Ga0070681_10063655
514 Ga0070681_10231318
515 Ga0070681_10314408
516 Ga0070681_10483429
517 Ga0070681_10565666
518 Ga0070707_100038568
519 Ga0070698_100522312
520 Ga0070699_100056824
521 Ga0070679_100009479
522 Ga0070679_100119245
523 Ga0070684_100914562
524 Ga0068853_100056940
525 Ga0068853_100243936
526 Ga0070695_100010028
527 Ga0070695_100487565
528 Ga0070696_100101640
529 Ga0070665_100228709
530 Ga0070704_100399688
531 Ga0070704_100647372
532 Ga0068855_100029866
533 Ga0068855_101978909
534 Ga0068857_100220025
535 Ga0068854_101045831
536 Ga0068856_101262293
537 Ga0068856_101555285
538 Ga0070702_100620467
539 Ga0068859_100011274
540 Ga0068864_100087146
541 Ga0068864_100472236
542 Ga0068861_101547913
543 Ga0068863_100001219
544 Ga0068863_101058516
545 Ga0068860_100002421
546 Ga0068860_100090911
547 Ga0068862_100014126
548 Ga0068862_101199858
549 Ga0081455_10658205
550 Ga0081540_1098798
551 Ga0081539_10000240
552 Ga0081539_10287221
553 Ga0075363_100143284
554 Ga0070712_100349411
555 Ga0075362_10004762
556 Ga0075362_10008245
557 Ga0075367_10070953
558 Ga0075369_10102382
559 Ga0075369_10127467
560 Ga0075428_100264117
561 Ga0075428_100461464
562 Ga0075430_100026572
563 Ga0075430_100514165
564 Ga0075431_100020317
565 Ga0075431_100176678
566 Ga0075433_10276859
567 Ga0075433_10297904
568 Ga0075433_11296898
569 Ga0075434_100031611
570 Ga0075434_100091834
571 Ga0075429_100701935
572 Ga0075436_100517028
573 Ga0097620_100011274
574 Ga0075435_101356130
575 Ga0105240_10038581
576 Ga0105240_10127988
577 Ga0105240_10193242
578 Ga0105240_10225836
579 Ga0105240_10610109
580 Ga0105240_11436077
581 Ga0111539_10445470
582 Ga0111539_12412486
583 Ga0105245_11127068
584 Ga0114129_10017466
585 Ga0114129_10231220
586 Ga0114129_10266601
587 Ga0114129_10313623
588 Ga0114129_10883231
589 Ga0114129_10897158
590 Ga0105243_10268901
591 Ga0105241_10640951
592 Ga0105242_11242917
593 Ga0105248_10023607
594 Ga0105248_10102363
595 Ga0105237_10248099
596 Ga0105238_10094908
597 Ga0105033_126277
598 Ga0105035_119217
599 Ga0105035_120154
600 Ga0105239_10214746
601 Ga0157370_10020853
602 Ga0157515_139265
603 Ga0163163_10174711
604 Ga0163163_11269821
605 Ga0182008_10179016
606 Ga0157379_11004604
607 Ga0157379_11778487
608 Ga0157379_12553023
609 Ga0213873_10020680
610 Ga0213872_10020081
611 Ga0213872_10031988
612 Ga0213872_10058748
613 Ga0213872_10087404
614 Ga0213872_10088235
615 Ga0213872_10117407
616 Ga0213872_10170918
617 Ga0213876_10003623
618 Ga0213875_10000963
619 Ga0213875_10011250
620 Ga0213875_10053107
621 Ga0213875_10063930
622 Ga0213875_10121669
623 Ga0213871_10006952
624 Ga0224712_10226626
625 Ga0209130_1001424
626 Ga0209675_1004932
627 Ga0209025_1000212
628 Ga0209564_1000397
629 Ga0209564_1016064
630 Ga0209758_1046356
631 Ga0209256_1002646
632 Ga0207426_1000102
633 Ga0207707_10023240
634 Ga0207707_10478086
635 Ga0207707_11265441
636 Ga0207695_10029349
637 Ga0207695_10076630
638 Ga0207695_10576421
639 Ga0207671_10293044
640 Ga0207693_10389020
641 Ga0207652_10099699
642 Ga0207652_10245085
643 Ga0207646_10168113
644 Ga0207681_11030295
645 Ga0207694_10204899
646 Ga0207659_11566467
647 Ga0207687_11299333
648 Ga0207700_11195431
649 Ga0207706_10233846
650 Ga0207706_10337294
651 Ga0207669_10893247
652 Ga0207704_10633167
653 Ga0207711_10028131
654 Ga0207711_10949272
655 Ga0207667_10126575
656 Ga0207668_10549578
657 Ga0207668_10565227
658 Ga0207658_10173059
659 Ga0207639_10052456
660 Ga0207678_10063138
661 Ga0207641_10004476
662 Ga0207674_10333792
663 Ga0207675_100903619
664 Ga0209984_1024093
665 Ga0209998_10007683
666 Ga0209974_10030814
667 Ga0209974_10037050
668 Ga0268266_10465002
669 Ga0268264_10000820
670 Ga0268264_10626736
671 Ga0265318_10107233
672 Ga0265318_10158054
673 Ga0307515_10011587
674 Ga0265338_10041844
675 Ga0265324_10001043
676 Ga0265324_10131328
677 Ga0265324_10144088
678 Ga0265328_10071262
679 Ga0265320_10003923
680 Ga0265331_10000194
681 Ga0265331_10080632
682 Ga0265331_10502578
683 Ga0265327_10000928
684 Ga0307408_100310302
685 Ga0265313_10002979
686 Ga0265314_10055814
687 Ga0265314_10090743
688 Ga0316576_10024571
689 Ga0307405_10994117
690 Ga0316577_10078367
691 Ga0307406_10977132
692 Ga0307416_100224163
693 Ga0307416_100234523
694 Ga0307416_101560502
695 Ga0307411_10897306
696 Ga0316583_10282648
697 Ga0373923_0029770
698 Ga0373943_0263390
699 Ga0316574_0006048
700 Ga0373935_0532339
701 Ga0373927_0218525
702 Ga0373927_0241667
703 Ga0373933_0485704
704 Ga0373937_0019631
705 Ga0316584_0009353
706 Ga0373925_0086519
707 Ga0373925_0693664
708 Ga0395899_0010644
709 Ga0395900_0060839
710 Ga0395898_0005108
711 Ga0395898_0156637
712 Ga0436364_0217969
713 Ga0436364_0757094
714 Ga0436364_0979303
715 Ga0436364_1216742
716 Ga0436364_1564687
717 Ga0395901_0010632
718 Ga0395901_0054446
719 Ga0395901_0517455
720 Ga0395901_0569394
721 Ga0436365_0054759
722 Ga0436365_0895402
723 Ga0436360_0546151
724 Ga0436360_0649673
725 Ga0436360_0824855
726 Ga0436360_0871572
727 Ga0436360_1097959
728 Ga0436361_0014192
729 Ga0436361_0078045
730 Ga0436361_0134486
731 Ga0436361_0210234
732 Ga0436361_0226184
733 Ga0436361_0284853
734 Ga0436361_0326992
735 Ga0436361_0372157
736 Ga0436361_0518557
737 Ga0436361_0575585
738 Ga0436361_0598340
739 Ga0436361_0675233
740 Ga0436361_0726868
741 Ga0436361_0903096
742 Ga0436361_1049896
743 Ga0436361_1082774
744 Ga0436363_0162544
745 Ga0436362_0614989
746 Ga0436362_1225684
747 Ga0439465_0023693
748 Ga0451787_152004
749 Ga0451849_0252292
750 Ga0439437_025691
751 Ga0450907_012402
752 Ga0439446_0023768
753 Ga0451577_0029282
754 Ga0451577_0138832
755 Ga0453683_0205672
756 Ga0453684_0009034
757 Ga0453684_0051971
758 Ga0453684_0142629
759 Ga0453684_1754454
760 Ga0466968_0412818
761 Ga0466957_0005329
762 Ga0451576_0001471
763 Ga0451576_0001637
764 Ga0451576_0084524
765 Ga0451576_0110429
766 Ga0451576_0424848
767 Ga0451576_1602195
768 Ga0466967_0977328
769 Ga0466967_1106842
770 Ga0495638_0000639
771 Ga0495638_0000972
772 Ga0495650_0000468
773 Ga0495650_0033744
774 Ga0495664_0065809
775 Ga0495606_0034256
776 Ga0495610_0000663
777 Ga0495610_0069343
778 Ga0495620_0025962
779 Ga0495620_0223050
780 Ga0495631_0047264
781 Ga0495632_0140521
782 Ga0495637_0003037
783 Ga0495643_0072895
784 Ga0495643_0103399
785 Ga0495644_0214678
786 Ga0495648_0034597
787 Ga0495654_0010175
788 Ga0495654_0072550
789 Ga0495609_0031379
790 Ga0495633_0105974
791 Ga0495668_0029995
792 Ga0495668_0077976
793 Ga0495625_0000152
794 Ga0495625_0009565
795 Ga0495625_0014695
796 Ga0495635_0198788
797 Ga0495670_0536228
798 Ga0495649_0421234
799 Ga0495672_0001471
800 Ga0495679_009455
801 Ga0495673_0002747
802 Ga0495686_0161473
803 Ga0495602_0100116
804 Ga0495602_0828815
805 Ga0496101_0513947
806 Ga0496102_0525737
807 Ga0496103_0552780
808 Ga0496106_0233140
809 Ga0496107_0000209
810 Ga0496107_0065922
811 Ga0496108_0422038
812 Ga0496109_0273832
813 Ga0496109_1057845
814 Ga0496110_0555911
815 Ga0496111_0382611
816 Ga0496112_0775261
817 Ga0496115_0016590
818 Ga0496115_0081961
819 Ga0496121_0003463
820 Ga0496121_0394489
821 Ga0496121_0628756
822 Ga0496123_0037534
823 Ga0496124_0106664
824 Ga0496125_0263118
825 Ga0496125_0380688
826 Ga0501290_000181
827 Ga0501292_000065
828 Ga0501293_015394
829 Ga0501294_004572
830 Ga0501032_0171879
831 Ga0501033_0027509
832 Ga0501033_0561715
833 Ga0501034_0236396
834 Ga0501034_0256602
835 Ga0501034_0444602
836 Ga0501034_0943322
837 Ga0501036_0571826
838 Ga0501037_0904521
839 Ga0501038_0039918
840 Ga0501039_0147352
841 Ga0501040_0002576
842 Ga0501041_0002803
843 Ga0501042_0239019
844 Ga0501043_0165470
845 Ga0501046_0005678
846 Ga0501047_0169721
847 Ga0501047_0320093
848 Ga0501047_0417702
849 Ga0501048_0012365
850 Ga0501048_0525071
851 Ga0501067_0192916
852 Ga0501067_0311026
853 Ga0501069_0089114
854 Ga0501070_0275162
855 Ga0501070_1127872
856 Ga0501071_0046923
857 Ga0501072_0106801
858 Ga0501072_0344559
859 Ga0501072_0800967
860 Ga0501074_0800907
861 Ga0501075_0006258
862 Ga0501076_0010384
863 Ga0501076_0463071
864 Ga0501076_0680544
865 Ga0501206_000963
866 Ga0501222_002643
867 Ga0501223_021642
868 Ga0501224_001910
869 Ga0501227_045168
870 Ga0501233_044143
871 Ga0501238_000522
872 Ga0501238_002142
873 Ga0501261_000083
874 Ga0501225_0002881
875 Ga0501245_000315
876 Ga0501079_0007638
877 Ga0501080_0047243
878 Ga0501080_0563214
879 Ga0501080_0600673
880 Ga0501080_0608809
881 Ga0501080_0925378
882 Ga0501081_0003618
883 Ga0501083_0012684
884 Ga0501279_000010
885 Ga0501280_000132
886 Ga0501281_00065
887 Ga0501282_000304
888 Ga0501283_015981
889 Ga0501035_0107876
890 Ga0501035_0223887
891 Ga0501035_0569368
892 Ga0501044_0015554
893 Ga0501044_0164145
894 Ga0501044_0189712
895 Ga0501044_0630013
896 Ga0501045_0051529
897 nmdc:mga03683_22435_c1
898 nmdc:mga03683_8293_c1
899 nmdc:mga03n38_505587_c1
900 nmdc:mga00v17_316875_c1
901 nmdc:mga0yw44_280612_c1
902 nmdc:mga05p37_1138404_c1
903 nmdc:mga05p37_235594_c1
904 nmdc:mga05p37_322729_c1
905 nmdc:mga05p37_328843_c1
906 nmdc:mga05p37_429865_c1
907 nmdc:mga0qj67_68328_c1
908 nmdc:mga06r32_163687_c1
909 nmdc:mga06r32_28144_c1
910 nmdc:mga08y16_441535_c1
911 nmdc:mga0n895_240619_c1
912 nmdc:mga0n895_401717_c1
913 nmdc:mga0n895_80872_c1
914 nmdc:mga0a205_182036_c1
915 nmdc:mga0a205_368328_c1
916 Ga0500578_0053719
917 Ga0500643_000195
918 Ga0500643_018024
919 Ga0500643_018789
920 Ga0500644_0410424
921 Ga0500651_0197459
922 Ga0500641_0083514
923 Ga0500554_000867
924 Ga0500555_033290
925 Ga0500556_0000300
926 Ga0500556_0235040
927 Ga0500592_000112
928 Ga0500592_003159
929 Ga0500614_049042
930 Ga0500618_000205
931 Ga0500655_002261
932 Ga0500655_128248
933 Ga0500658_0002593
934 Ga0500658_0048610
935 Ga0500568_0005684
936 Ga0500577_0097501
937 Ga0500590_025754
938 Ga0500622_0025432
939 Ga0500627_0006860
940 Ga0500627_0093338
941 Ga0500639_015232
942 Ga0500636_0180149
943 Ga0500570_000250
944 Ga0500552_002615
945 Ga0501084_0069268
946 Ga0501084_1059148
947 Ga0590077_007719
948 Ga0501082_0041087
949 Ga0501082_0073293
950 2512033160
951 2524612099
952 2585149869
953 2585260718
954 2643747720
955 2644506897
956 2821445207
957 2844535710
958 2849562302
959 2849577224
960 2851153209
961 2897809088
962 2898330406
963 2909399874
964 2919451950
965 641335768
966 643389583
967 8001849962
968 8054005065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

4

129

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9727 3 148
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9674 3 124
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9661 2 126
1nvj-assembly3.cif.gz_E deletion mutant (delta 141) of molybdopterin synthase 0.9599 3 123
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9543 3 124
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9662 3 148 3.90.1170.40
5mpoC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9633 2 128 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9543 3 124 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9444 3 137 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9439 5 137 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A2E3EXB0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.993 3 149 GO:0006777
GO:0030366
AF-A0A2E5BTF8-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9922 3 148 GO:0006777
GO:0030366
AF-A0A2E2VP04-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9915 5 148 GO:0006777
GO:0030366
AF-A0A235CEM6-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9903 3 148 GO:0006777
GO:0030366
AF-A0A520NUL0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9899 1 148 GO:0006777
GO:0030366

Map