F452617

General Info

Members Datasets Scaffolds Average Seq Length
482 268 474 125

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_11640620|Ga0206353_116406202
Length 143
Sequence MARDKGQSKGQKRNLKIKKGDVVRVIAGKDRGAEGKVIAVLSDQDRVIVEGVNRIKRHTKVVNQGGRAGSTGGIITQEAAIHASNVMLLVDAPKDGDGKSAKGGKVTTRVGYRRDEVTKRRSDGSTYSALRSTRVARKSGEEI

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
4 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
5 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
6 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
7 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
8 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
9 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
115 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
116 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
117 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
118 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
145 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
197 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.95
Metatranscriptomes 16.39
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 7.88
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c011035 3300000041 Bacteria 771
2 JGI24740J21852_10008892 3300001979 Bacteria 3971
3 JGI24737J22298_10012287 3300001990 Bacteria 2791
4 JGI24737J22298_10126469 3300001990 Bacteria 755
5 Ga0006778J45830_1033640 3300003162 Bacteria 701
6 Ga0006759J45824_1061080 3300003163 Bacteria 732
7 JGI25407J50210_10003808 3300003373 Bacteria 3646
8 Ga0007410J51695_1035240 3300003574 Bacteria 933
9 Ga0007410J51695_1042358 3300003574 Bacteria 1618
10 Ga0007429J51699_1104597 3300003579 Bacteria 604
11 Ga0032354_1021131 3300003693 Bacteria 1498
12 JGI25405J52794_10053414 3300003911 Bacteria 868
13 Ga0058861_11895946 3300004800 Bacteria 1830
14 Ga0070658_10508990 3300005327 Bacteria 1040
15 Ga0070682_100361579 3300005337 Bacteria 1085
16 Ga0070682_100909988 3300005337 Bacteria 723
17 Ga0070691_10159210 3300005341 Bacteria 1163
18 Ga0070668_100882389 3300005347 Bacteria 799
19 Ga0070669_101501183 3300005353 Bacteria 586
20 Ga0070659_101455687 3300005366 Bacteria 610
21 Ga0070714_100035855 3300005435 Bacteria 4158
22 Ga0070701_11092936 3300005438 Bacteria 561
23 Ga0070700_100197231 3300005441 Bacteria 1412
24 Ga0070700_100582617 3300005441 Bacteria 874
25 Ga0070694_101618392 3300005444 Bacteria 550
26 Ga0070708_100151355 3300005445 Bacteria 2158
27 Ga0070663_100273135 3300005455 Bacteria 1344
28 Ga0070678_101817714 3300005456 Bacteria 575
29 Ga0070678_101966495 3300005456 Bacteria 553
30 Ga0070706_101040320 3300005467 Bacteria 755
31 Ga0070698_100011467 3300005471 Bacteria 9406
32 Ga0070679_100047460 3300005530 Bacteria 4280
33 Ga0070684_100147325 3300005535 Bacteria 2131
34 Ga0070684_101022578 3300005535 Bacteria 776
35 Ga0070672_100049439 3300005543 Bacteria 3271
36 Ga0070695_101091600 3300005545 Bacteria 653
37 Ga0068856_100217906 3300005614 Bacteria 1924
38 Ga0068856_100321310 3300005614 Bacteria 1565
39 Ga0070702_100461810 3300005615 Bacteria 923
40 Ga0068852_101678796 3300005616 Bacteria 658
41 Ga0068866_10148691 3300005718 Bacteria 1354
42 Ga0068861_100050932 3300005719 Bacteria 3142
43 Ga0068870_10845555 3300005840 Bacteria 643
44 Ga0068863_102400322 3300005841 Bacteria 537
45 Ga0081455_10000409 3300005937 Bacteria 56312
46 Ga0081455_10009428 3300005937 Bacteria 10043
47 Ga0081455_10740939 3300005937 Bacteria 622
48 Ga0081538_10000088 3300005981 Bacteria 88922
49 Ga0081538_10092359 3300005981 Bacteria 1559
50 Ga0075365_10010269 3300006038 Bacteria 5441
51 Ga0075364_10086362 3300006051 Bacteria 2078
52 Ga0075432_10110025 3300006058 Bacteria 1026
53 Ga0075428_100002072 3300006844 Bacteria 21635
54 Ga0075428_101162860 3300006844 Bacteria 814
55 Ga0075430_100028829 3300006846 Bacteria 4715
56 Ga0075430_100376480 3300006846 Bacteria 1172
57 Ga0075431_100004313 3300006847 Bacteria 13937
58 Ga0075431_100038721 3300006847 Bacteria 4911
59 Ga0075433_10475634 3300006852 Bacteria 1101
60 Ga0075434_100428737 3300006871 Bacteria 1343
61 Ga0075429_100010921 3300006880 Bacteria 7856
62 Ga0075429_101253842 3300006880 Bacteria 647
63 Ga0068865_100432253 3300006881 Bacteria 1085
64 Ga0111539_10041331 3300009094 Bacteria 5544
65 Ga0111539_10324979 3300009094 Bacteria 1790
66 Ga0111539_10520194 3300009094 Bacteria 1386
67 Ga0111539_10925055 3300009094 Bacteria 1014
68 Ga0114129_10006606 3300009147 Bacteria 16463
69 Ga0114129_10824430 3300009147 Bacteria 1181
70 Ga0105243_10773428 3300009148 Bacteria 944
71 Ga0105243_11861059 3300009148 Bacteria 634
72 Ga0105238_10157037 3300009551 Bacteria 2250
73 Ga0105238_10275283 3300009551 Bacteria 1664
74 Ga0105246_10732665 3300011119 Bacteria 870
75 Ga0105246_10872464 3300011119 Bacteria 805
76 Ga0157313_1029794 3300012503 Bacteria 612
77 Ga0157371_10297736 3300013102 Bacteria 1167
78 Ga0157370_10860253 3300013104 Bacteria 824
79 Ga0157369_11069187 3300013105 Bacteria 825
80 Ga0157374_10357795 3300013296 Bacteria 1451
81 Ga0163162_13222510 3300013306 Bacteria 523
82 Ga0157372_10067801 3300013307 Bacteria 4010
83 Ga0157372_10226194 3300013307 Bacteria 2169
84 Ga0157372_10295637 3300013307 Bacteria 1883
85 Ga0157372_10513493 3300013307 Bacteria 1397
86 Ga0157372_12076381 3300013307 Bacteria 653
87 Ga0157372_13000236 3300013307 Bacteria 540
88 Ga0157372_13404764 3300013307 Bacteria 506
89 Ga0157375_11693248 3300013308 Bacteria 749
90 Ga0157375_12379371 3300013308 Bacteria 632
91 Ga0157375_13070749 3300013308 Bacteria 557
92 Ga0157380_10693270 3300014326 Bacteria 1022
93 Ga0182008_10131020 3300014497 Bacteria 1250
94 Ga0182008_10624906 3300014497 Bacteria 607
95 Ga0197907_10192508 3300020069 Bacteria 1464
96 Ga0206356_10143644 3300020070 Bacteria 1173
97 Ga0206356_10152300 3300020070 Bacteria 556
98 Ga0206356_11105166 3300020070 Bacteria 570
99 Ga0206349_1728845 3300020075 Bacteria 953
100 Ga0206355_1160034 3300020076 Bacteria 863
101 Ga0206351_10585592 3300020077 Bacteria 875
102 Ga0206352_10923546 3300020078 Bacteria 964
103 Ga0206350_10162975 3300020080 Bacteria 1113
104 Ga0206350_10630256 3300020080 Bacteria 500
105 Ga0206354_10259773 3300020081 Bacteria 912
106 Ga0206354_10389959 3300020081 Bacteria 638
107 Ga0206354_10486322 3300020081 Bacteria 823
108 Ga0206353_11640620 3300020082 Bacteria 627
109 Ga0207697_10354411 3300025315 Bacteria 651
110 Ga0207642_10126227 3300025899 Bacteria 1328
111 Ga0207642_10489173 3300025899 Bacteria 752
112 Ga0207688_10049806 3300025901 Bacteria 2342
113 Ga0207647_10430116 3300025904 Bacteria 741
114 Ga0207643_10841414 3300025908 Bacteria 595
115 Ga0207684_10998473 3300025910 Bacteria 700
116 Ga0207707_10492083 3300025912 Bacteria 1047
117 Ga0207662_10149782 3300025918 Bacteria 1483
118 Ga0207657_10334528 3300025919 Bacteria 1196
119 Ga0207652_10090598 3300025921 Bacteria 2688
120 Ga0207646_10133214 3300025922 Bacteria 2237
121 Ga0207664_10030840 3300025929 Bacteria 4098
122 Ga0207706_11168765 3300025933 Bacteria 640
123 Ga0207709_10804890 3300025935 Bacteria 759
124 Ga0207704_10089458 3300025938 Bacteria 2017
125 Ga0207689_10629775 3300025942 Bacteria 903
126 Ga0207661_10108564 3300025944 Bacteria 2343
127 Ga0207661_10303699 3300025944 Bacteria 1431
128 Ga0207679_10406346 3300025945 Bacteria 1199
129 Ga0207651_11033470 3300025960 Bacteria 735
130 Ga0207668_10358642 3300025972 Bacteria 1221
131 Ga0207640_11246215 3300025981 Bacteria 663
132 Ga0207677_10153044 3300026023 Bacteria 1782
133 Ga0207678_10584440 3300026067 Bacteria 978
134 Ga0207708_10212661 3300026075 Bacteria 1546
135 Ga0207702_10153626 3300026078 Bacteria 2096
136 Ga0207676_10955284 3300026095 Bacteria 843
137 Ga0207675_100039815 3300026118 Bacteria 4386
138 Ga0207675_100145970 3300026118 Bacteria 2250
139 Ga0207675_100211184 3300026118 Bacteria 1867
140 Ga0207683_10106374 3300026121 Bacteria 2509
141 Ga0207683_10294499 3300026121 Bacteria 1484
142 Ga0207683_10774332 3300026121 Bacteria 890
143 Ga0207683_10964040 3300026121 Bacteria 792
144 Ga0209974_10038524 3300027876 Bacteria 1589
145 Ga0209974_10054922 3300027876 Bacteria 1343
146 Ga0207428_10010526 3300027907 Bacteria 8256
147 Ga0311001_1009267 3300029277 Bacteria 700
148 Ga0316177_1153746 3300030731 Bacteria 728
149 Ga0314311_1073478 3300030733 Bacteria 753
150 Ga0314311_1149735 3300030733 Bacteria 1413
151 Ga0316180_1156357 3300030736 Bacteria 638
152 Ga0316183_1010534 3300030742 Bacteria 1031
153 Ga0316181_1075096 3300030744 Bacteria 1735
154 Ga0316181_1215462 3300030744 Bacteria 3793
155 Ga0316182_1254280 3300030745 Bacteria 757
156 Ga0307408_100651024 3300031548 Bacteria 942
157 Ga0307408_100999177 3300031548 Bacteria 771
158 Ga0307405_10537185 3300031731 Bacteria 944
159 Ga0307405_10720537 3300031731 Bacteria 828
160 Ga0307413_10067749 3300031824 Bacteria 2233
161 Ga0307413_10611375 3300031824 Bacteria 893
162 Ga0307410_10184010 3300031852 Bacteria 1584
163 Ga0307406_10652116 3300031901 Bacteria 874
164 Ga0307406_11678331 3300031901 Bacteria 563
165 Ga0307406_11752378 3300031901 Bacteria 551
166 Ga0307407_10083148 3300031903 Bacteria 1942
167 Ga0307412_10039499 3300031911 Bacteria 3047
168 Ga0307409_100151413 3300031995 Bacteria 2014
169 Ga0307409_100222898 3300031995 Bacteria 1703
170 Ga0307409_100571600 3300031995 Bacteria 1113
171 Ga0307409_101685438 3300031995 Bacteria 663
172 Ga0307409_101970167 3300031995 Bacteria 614
173 Ga0307416_100569983 3300032002 Bacteria 1208
174 Ga0307416_100594595 3300032002 Bacteria 1185
175 Ga0307416_101339257 3300032002 Bacteria 822
176 Ga0307416_101446523 3300032002 Bacteria 793
177 Ga0307416_102098915 3300032002 Bacteria 667
178 Ga0307414_10045651 3300032004 Bacteria 3002
179 Ga0307414_10554788 3300032004 Bacteria 1024
180 Ga0307411_10042433 3300032005 Bacteria 2902
181 Ga0307411_11283950 3300032005 Bacteria 666
182 Ga0307415_100599409 3300032126 Bacteria 980
183 Ga0373940_0090719 3300035088 Bacteria 915
184 Ga0373949_0091153 3300035090 Bacteria 825
185 Ga0373949_0182458 3300035090 Bacteria 622
186 Ga0373942_0041272 3300035207 Bacteria 1261
187 Ga0373931_0347792 3300035691 Bacteria 927
188 Ga0395898_0243734 3300037466 Bacteria 1714
189 Ga0395905_0034499 3300037471 Bacteria 4751
190 Ga0395901_0370953 3300038443 Bacteria 1474
191 Ga0439438_012318 3300041405 Bacteria 2625
192 Ga0439438_089792 3300041405 Bacteria 749
193 Ga0439461_0017877 3300041410 Bacteria 1382
194 Ga0439465_0024760 3300041413 Bacteria 1892
195 Ga0439465_0183044 3300041413 Bacteria 759
196 Ga0451790_09494 3300041444 Bacteria 754
197 Ga0451790_39612 3300041444 Bacteria 517
198 Ga0451802_1641578 3300041460 Bacteria 720
199 Ga0451837_1597447 3300041494 Bacteria 1245
200 Ga0451840_04961 3300041497 Bacteria 600
201 Ga0451847_0587709 3300041503 Bacteria 594
202 Ga0451853_3993736 3300041512 Bacteria 1580
203 Ga0439431_0000819 3300041997 Bacteria 6715
204 Ga0439442_023602 3300042002 Bacteria 1278
205 Ga0439442_090583 3300042002 Bacteria 658
206 Ga0439445_0057794 3300042004 Bacteria 1056
207 Ga0439449_0038001 3300042007 Bacteria 1791
208 Ga0439462_0216744 3300042015 Bacteria 547
209 Ga0439446_0003732 3300042156 Bacteria 3805
210 Ga0450909_047524 3300042185 Bacteria 667
211 Ga0439434_0000725 3300042435 Bacteria 9435
212 Ga0466972_0077032 3300044658 Bacteria 1588
213 Ga0466972_0142557 3300044658 Bacteria 1127
214 Ga0466965_0086225 3300044683 Bacteria 1592
215 Ga0466965_0309122 3300044683 Bacteria 859
216 Ga0466966_0193016 3300044684 Bacteria 1233
217 Ga0466961_0177210 3300044693 Bacteria 1324
218 Ga0466961_0284189 3300044693 Bacteria 1012
219 Ga0466961_0364585 3300044693 Bacteria 878
220 Ga0466963_0123506 3300044694 Bacteria 1783
221 Ga0466964_0067997 3300044706 Bacteria 1499
222 Ga0466971_0050354 3300044719 Bacteria 1874
223 Ga0466971_0497165 3300044719 Bacteria 602
224 Ga0466968_0018610 3300044735 Bacteria 2788
225 Ga0466968_0230384 3300044735 Bacteria 875
226 Ga0466970_0024640 3300044765 Bacteria 3147
227 Ga0466970_0044578 3300044765 Bacteria 2361
228 Ga0466970_0400183 3300044765 Bacteria 783
229 Ga0466970_0495013 3300044765 Bacteria 703
230 Ga0466970_0553534 3300044765 Bacteria 665
231 Ga0466957_0041425 3300044842 Bacteria 2785
232 Ga0466957_0687044 3300044842 Bacteria 721
233 Ga0466960_0088713 3300044901 Bacteria 1572
234 Ga0466960_0109980 3300044901 Bacteria 1430
235 Ga0466960_0135516 3300044901 Bacteria 1303
236 Ga0466960_0239863 3300044901 Bacteria 1003
237 Ga0466960_0431722 3300044901 Bacteria 763
238 Ga0466959_0449311 3300045049 Bacteria 874
239 Ga0466958_0125691 3300045836 Bacteria 1608
240 Ga0466958_0522913 3300045836 Bacteria 770
241 Ga0466967_0004906 3300045976 Bacteria 9140
242 Ga0466967_0376227 3300045976 Bacteria 1378
243 Ga0466967_0526888 3300045976 Bacteria 1161
244 Ga0466967_0915247 3300045976 Bacteria 872
245 Ga0466967_1551026 3300045976 Bacteria 660
246 Ga0495596_0115425 3300046500 Bacteria 1043
247 Ga0495635_0144740 3300046663 Bacteria 1618
248 Ga0495635_0873000 3300046663 Bacteria 577
249 Ga0495599_0236070 3300046678 Bacteria 1116
250 Ga0495670_0417221 3300046691 Bacteria 726
251 Ga0495614_0101552 3300048089 Bacteria 1258
252 Ga0496100_0022214 3300048903 Bacteria 3836
253 Ga0496100_0171045 3300048903 Bacteria 1565
254 Ga0496100_0206460 3300048903 Bacteria 1435
255 Ga0496101_0011272 3300048904 Bacteria 5925
256 Ga0496102_0004268 3300048905 Bacteria 12085
257 Ga0496102_0296020 3300048905 Bacteria 1525
258 Ga0496103_0002413 3300048906 Bacteria 11762
259 Ga0496103_0124836 3300048906 Bacteria 1641
260 Ga0496104_0052043 3300048907 Bacteria 3867
261 Ga0496106_0009361 3300048909 Bacteria 7242
262 Ga0496106_0330310 3300048909 Bacteria 1224
263 Ga0496107_0016953 3300048910 Bacteria 5122
264 Ga0496108_0026274 3300048911 Bacteria 4801
265 Ga0496108_0374356 3300048911 Bacteria 1243
266 Ga0496109_0029975 3300048912 Bacteria 4875
267 Ga0496109_0654700 3300048912 Bacteria 987
268 Ga0496109_0992763 3300048912 Bacteria 777
269 Ga0496109_1065009 3300048912 Bacteria 746
270 Ga0496110_0003020 3300048913 Bacteria 12767
271 Ga0496110_0168420 3300048913 Bacteria 1987
272 Ga0496110_0379169 3300048913 Bacteria 1289
273 Ga0496110_0983490 3300048913 Bacteria 751
274 Ga0496110_1873019 3300048913 Bacteria 510
275 Ga0496111_0024069 3300048914 Bacteria 4282
276 Ga0496111_0280427 3300048914 Bacteria 1236
277 Ga0496111_0631105 3300048914 Bacteria 783
278 Ga0496112_0012650 3300048915 Bacteria 7758
279 Ga0496112_1239930 3300048915 Bacteria 662
280 Ga0496113_0015568 3300048916 Bacteria 5232
281 Ga0496114_0264366 3300048917 Bacteria 1515
282 Ga0496114_0478775 3300048917 Bacteria 1101
283 Ga0496114_0590074 3300048917 Bacteria 980
284 Ga0496114_0839083 3300048917 Bacteria 799
285 Ga0496115_0076142 3300048918 Bacteria 2727
286 Ga0496115_0780498 3300048918 Bacteria 745
287 Ga0501306_013778 3300049127 Bacteria 1059
288 Ga0501306_025188 3300049127 Bacteria 855
289 Ga0501306_057801 3300049127 Bacteria 634
290 Ga0501308_042512 3300049128 Bacteria 644
291 Ga0501308_048031 3300049128 Bacteria 618
292 Ga0501309_002625 3300049129 Bacteria 1959
293 Ga0501309_052244 3300049129 Bacteria 644
294 Ga0501309_069700 3300049129 Bacteria 576
295 Ga0501310_001576 3300049130 Bacteria 2081
296 Ga0501341_09098 3300049131 Bacteria 641
297 Ga0501305_060609 3300049161 Bacteria 650
298 Ga0501305_061275 3300049161 Bacteria 648
299 Ga0501305_076760 3300049161 Bacteria 595
300 Ga0501307_082083 3300049162 Bacteria 528
301 Ga0501307_085661 3300049162 Bacteria 520
302 Ga0501291_024209 3300049514 Bacteria 986
303 Ga0501311_010495 3300049527 Bacteria 1125
304 Ga0501311_026480 3300049527 Bacteria 817
305 Ga0501312_071475 3300049528 Bacteria 616
306 Ga0501315_026197 3300049531 Bacteria 816
307 Ga0501315_042283 3300049531 Bacteria 693
308 Ga0501315_060227 3300049531 Bacteria 613
309 Ga0501316_003666 3300049532 Bacteria 1506
310 Ga0501316_015679 3300049532 Bacteria 914
311 Ga0501316_068605 3300049532 Bacteria 534
312 Ga0501317_026522 3300049533 Bacteria 818
313 Ga0501317_035171 3300049533 Bacteria 744
314 Ga0501317_040314 3300049533 Bacteria 711
315 Ga0501317_062745 3300049533 Bacteria 613
316 Ga0501317_085957 3300049533 Bacteria 550
317 Ga0501318_000290 3300049534 Bacteria 2923
318 Ga0501318_037506 3300049534 Bacteria 682
319 Ga0501321_006115 3300049537 Bacteria 1214
320 Ga0501322_030989 3300049538 Bacteria 505
321 Ga0501323_038205 3300049539 Bacteria 696
322 Ga0501323_039714 3300049539 Bacteria 686
323 Ga0501323_043347 3300049539 Bacteria 666
324 Ga0501031_0026809 3300049568 Bacteria 3756
325 Ga0501031_0048743 3300049568 Bacteria 2760
326 Ga0501031_0119959 3300049568 Bacteria 1718
327 Ga0501031_0255928 3300049568 Bacteria 1138
328 Ga0501031_0596866 3300049568 Bacteria 710
329 Ga0501032_0588327 3300049569 Bacteria 708
330 Ga0501033_0087418 3300049570 Bacteria 2281
331 Ga0501033_0145147 3300049570 Bacteria 1714
332 Ga0501034_0040203 3300049571 Bacteria 4735
333 Ga0501034_0326539 3300049571 Bacteria 1466
334 Ga0501034_0599091 3300049571 Bacteria 1008
335 Ga0501034_0605455 3300049571 Bacteria 1001
336 Ga0501036_0053426 3300049572 Bacteria 3421
337 Ga0501036_0287575 3300049572 Bacteria 1375
338 Ga0501036_0475958 3300049572 Bacteria 1040
339 Ga0501036_0966372 3300049572 Bacteria 698
340 Ga0501036_1364696 3300049572 Bacteria 575
341 Ga0501038_0090109 3300049574 Bacteria 2571
342 Ga0501038_0106411 3300049574 Bacteria 2328
343 Ga0501038_0144848 3300049574 Bacteria 1941
344 Ga0501038_0147944 3300049574 Bacteria 1916
345 Ga0501038_0151350 3300049574 Bacteria 1891
346 Ga0501038_0470270 3300049574 Bacteria 965
347 Ga0501039_0058108 3300049575 Bacteria 2995
348 Ga0501039_0158024 3300049575 Bacteria 1781
349 Ga0501039_0470857 3300049575 Bacteria 986
350 Ga0501039_0515577 3300049575 Bacteria 939
351 Ga0501039_0526207 3300049575 Bacteria 928
352 Ga0501040_0044216 3300049576 Bacteria 3036
353 Ga0501040_0102624 3300049576 Bacteria 1996
354 Ga0501040_0218040 3300049576 Bacteria 1357
355 Ga0501040_0280634 3300049576 Bacteria 1190
356 Ga0501040_0340971 3300049576 Bacteria 1073
357 Ga0501040_0557368 3300049576 Bacteria 827
358 Ga0501040_1239454 3300049576 Bacteria 541
359 Ga0501041_0006740 3300049577 Bacteria 6731
360 Ga0501041_0525536 3300049577 Bacteria 753
361 Ga0501042_0034939 3300049578 Bacteria 3566
362 Ga0501042_0255734 3300049578 Bacteria 1264
363 Ga0501042_0273541 3300049578 Bacteria 1219
364 Ga0501043_0029097 3300049579 Bacteria 4339
365 Ga0501043_0511795 3300049579 Bacteria 896
366 Ga0501043_0674391 3300049579 Bacteria 757
367 Ga0501043_0743726 3300049579 Bacteria 713
368 Ga0501043_0884379 3300049579 Bacteria 641
369 Ga0501046_0050632 3300049580 Bacteria 3280
370 Ga0501046_0156452 3300049580 Bacteria 1716
371 Ga0501046_0429942 3300049580 Bacteria 951
372 Ga0501046_0575584 3300049580 Bacteria 801
373 Ga0501047_0023921 3300049581 Bacteria 5865
374 Ga0501047_0033441 3300049581 Bacteria 4963
375 Ga0501048_0015873 3300049582 Bacteria 5557
376 Ga0501048_0033481 3300049582 Bacteria 3712
377 Ga0501048_0165013 3300049582 Bacteria 1568
378 Ga0501048_0170534 3300049582 Bacteria 1541
379 Ga0501048_0195212 3300049582 Bacteria 1435
380 Ga0501067_0331615 3300049583 Bacteria 847
381 Ga0501068_0564225 3300049584 Bacteria 741
382 Ga0501068_0588477 3300049584 Bacteria 725
383 Ga0501069_0114126 3300049585 Bacteria 1540
384 Ga0501069_0587778 3300049585 Bacteria 668
385 Ga0501071_0067819 3300049587 Bacteria 2595
386 Ga0501071_0119659 3300049587 Bacteria 1952
387 Ga0501071_0224876 3300049587 Bacteria 1413
388 Ga0501072_0096794 3300049588 Bacteria 2345
389 Ga0501072_0231577 3300049588 Bacteria 1472
390 Ga0501072_0254096 3300049588 Bacteria 1399
391 Ga0501072_0575251 3300049588 Bacteria 889
392 Ga0501072_0738919 3300049588 Bacteria 772
393 Ga0501072_0847073 3300049588 Bacteria 715
394 Ga0501073_0109952 3300049589 Bacteria 1912
395 Ga0501074_0100768 3300049590 Bacteria 2067
396 Ga0501074_0296326 3300049590 Bacteria 1149
397 Ga0501074_0397711 3300049590 Bacteria 977
398 Ga0501074_0748582 3300049590 Bacteria 689
399 Ga0501075_0394472 3300049591 Bacteria 1055
400 Ga0501075_0726304 3300049591 Bacteria 756
401 Ga0501075_0876887 3300049591 Bacteria 682
402 Ga0501076_0101880 3300049592 Bacteria 2314
403 Ga0501076_0816347 3300049592 Bacteria 769
404 Ga0501076_1072418 3300049592 Bacteria 663
405 Ga0501076_1694790 3300049592 Bacteria 518
406 Ga0501077_0003693 3300049593 Bacteria 9204
407 Ga0501077_0377458 3300049593 Bacteria 906
408 Ga0501077_0651395 3300049593 Bacteria 677
409 Ga0501079_0050969 3300049741 Bacteria 3194
410 Ga0501079_0300130 3300049741 Bacteria 1257
411 Ga0501080_0107570 3300049742 Bacteria 2585
412 Ga0501080_1212911 3300049742 Bacteria 648
413 Ga0501081_0107003 3300049743 Bacteria 1983
414 Ga0501083_0435062 3300049744 Bacteria 854
415 Ga0501283_081287 3300049779 Bacteria 610
416 Ga0501035_0015444 3300049822 Bacteria 7044
417 Ga0501035_0045368 3300049822 Bacteria 3954
418 Ga0501035_0058251 3300049822 Bacteria 3443
419 Ga0501035_0204322 3300049822 Bacteria 1693
420 Ga0501044_0004036 3300049823 Bacteria 16463
421 Ga0501045_0009893 3300049824 Bacteria 6672
422 Ga0501045_0136422 3300049824 Bacteria 1824
423 Ga0501045_0284429 3300049824 Bacteria 1231
424 Ga0501045_0341315 3300049824 Bacteria 1115
425 Ga0501045_0464572 3300049824 Bacteria 940
426 Ga0501045_0585775 3300049824 Bacteria 826
427 nmdc:mga00v17_180307_c1 3300050491 Bacteria 1363
428 nmdc:mga0yw44_1197_c1 3300050492 Bacteria 10147
429 nmdc:mga05p37_10660_c1 3300050507 Bacteria 10905
430 nmdc:mga09592_1341425_c1 3300050508 Bacteria 587
431 nmdc:mga09592_2299_c1 3300050508 Bacteria 15408
432 nmdc:mga0qj67_10084_c1 3300050509 Bacteria 7050
433 nmdc:mga0qj67_366001_c1 3300050509 Bacteria 1165
434 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
435 nmdc:mga06r32_5565_c1 3300050510 Bacteria 11347
436 nmdc:mga08y16_1311497_c1 3300050511 Bacteria 690
437 nmdc:mga08y16_3501_c1 3300050511 Bacteria 16300
438 nmdc:mga08y16_528315_c1 3300050511 Bacteria 1196
439 nmdc:mga08y16_708052_c1 3300050511 Bacteria 1006
440 nmdc:mga08x19_537882_c1 3300050514 Bacteria 826
441 nmdc:mga0a205_301832_c1 3300050515 Bacteria 1474
442 Ga0495601_0008187 3300053077 Bacteria 6166
443 Ga0501084_0319807 3300054114 Bacteria 1311
444 Ga0501084_0402166 3300054114 Bacteria 1157
445 Ga0501084_1072714 3300054114 Bacteria 676
446 Ga0590071_045252 3300059421 Bacteria 1062
447 Ga0590075_087404 3300059424 Bacteria 809
448 Ga0590077_051128 3300059426 Bacteria 928
449 Ga0587084_034571 3300059477 Bacteria 831
450 Ga0587066_058573 3300059490 Bacteria 780
451 Ga0587073_0066457 3300059492 Bacteria 860
452 Ga0587080_115173 3300059503 Bacteria 590
453 Ga0587088_121034 3300059508 Bacteria 606
454 Ga0587090_019187 3300059510 Bacteria 1052
455 Ga0587098_002379 3300059604 Bacteria 1581
456 Ga0587098_009797 3300059604 Bacteria 1048
457 Ga0587106_046755 3300059605 Bacteria 754
458 Ga0587101_038367 3300059623 Bacteria 780
459 Ga0587122_002384 3300059628 Bacteria 1349
460 Ga0587128_097359 3300059630 Bacteria 612
461 Ga0587078_012119 3300059646 Bacteria 1008
462 Ga0587079_003817 3300059647 Bacteria 1999
463 Ga0587079_034140 3300059647 Bacteria 994
464 Ga0587107_001080 3300059652 Bacteria 2095
465 Ga0587071_013879 3300060344 Bacteria 1394
466 Ga0587071_126492 3300060344 Bacteria 616
467 Ga0501082_0153707 3300060353 Bacteria 1999
468 Ga0501082_0353459 3300060353 Bacteria 1281
469 Ga0501082_0565583 3300060353 Bacteria 995
470 Ga0501082_1139659 3300060353 Bacteria 682
471 Ga0501082_1438826 3300060353 Bacteria 602
472 Ga0530510_0166551 3300061734 Bacteria 1631
473 Ga0530510_0311865 3300061734 Bacteria 1178
474 Ga0530510_0316452 3300061734 Bacteria 1169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_1364696 Ga0501036_1364696_16_378 107
2 3300059646 Ga0587078_012119 Ga0587078_012119_11_358 112
3 3300041497 Ga0451840_04961 Ga0451840_04961_249_590 113
4 3300025912 Ga0207707_10492083 Ga0207707_104920832 114
5 iso_pu_bacteria 2773857762 2774396400 115
6 iso_pu_bacteria 2808606439 2809198056 115
7 iso_pu_bacteria 2811994878 2812353253 115
8 iso_pu_bacteria 2891968417 2891969119 115
9 3300049129 Ga0501309_069700 Ga0501309_069700_24_374 116
10 3300059492 Ga0587073_0066457 Ga0587073_0066457_51_401 116
11 3300006051 Ga0075364_10086362 Ga0075364_100863622 117
12 3300020076 Ga0206355_1160034 Ga0206355_11600342 117
13 3300025904 Ga0207647_10430116 Ga0207647_104301162 117
14 3300030733 Ga0314311_1149735 Ga0314311_11497352 117
15 3300030736 Ga0316180_1156357 Ga0316180_11563572 117
16 3300030742 Ga0316183_1010534 Ga0316183_10105342 117
17 3300030744 Ga0316181_1075096 Ga0316181_10750962 117
18 3300031548 Ga0307408_100651024 Ga0307408_1006510242 117
19 3300032005 Ga0307411_11283950 Ga0307411_112839502 117
20 3300041405 Ga0439438_089792 Ga0439438_089792_41_394 117
21 3300041413 Ga0439465_0183044 Ga0439465_0183044_22_375 117
22 3300042002 Ga0439442_090583 Ga0439442_090583_11_364 117
23 3300042015 Ga0439462_0216744 Ga0439462_0216744_106_459 117
24 3300042185 Ga0450909_047524 Ga0450909_047524_221_574 117
25 3300049531 Ga0501315_026197 Ga0501315_026197_280_633 117
26 3300049533 Ga0501317_062745 Ga0501317_062745_239_592 117
27 3300049539 Ga0501323_038205 Ga0501323_038205_36_389 117
28 3300049568 Ga0501031_0119959 Ga0501031_0119959_900_1253 117
29 3300049569 Ga0501032_0588327 Ga0501032_0588327_190_543 117
30 3300049570 Ga0501033_0087418 Ga0501033_0087418_876_1229 117
31 3300049571 Ga0501034_0326539 Ga0501034_0326539_676_1029 117
32 3300049571 Ga0501034_0605455 Ga0501034_0605455_215_568 117
33 3300049572 Ga0501036_0053426 Ga0501036_0053426_2656_3009 117
34 3300049574 Ga0501038_0090109 Ga0501038_0090109_415_768 117
35 3300049574 Ga0501038_0106411 Ga0501038_0106411_1655_2008 117
36 3300049575 Ga0501039_0058108 Ga0501039_0058108_1638_1991 117
37 3300049575 Ga0501039_0158024 Ga0501039_0158024_223_576 117
38 3300049575 Ga0501039_0470857 Ga0501039_0470857_308_661 117
39 3300049576 Ga0501040_1239454 Ga0501040_1239454_35_388 117
40 3300049577 Ga0501041_0525536 Ga0501041_0525536_91_444 117
41 3300049578 Ga0501042_0273541 Ga0501042_0273541_579_932 117
42 3300049579 Ga0501043_0884379 Ga0501043_0884379_58_411 117
43 3300049580 Ga0501046_0156452 Ga0501046_0156452_1132_1485 117
44 3300049581 Ga0501047_0033441 Ga0501047_0033441_1594_1947 117
45 3300049582 Ga0501048_0015873 Ga0501048_0015873_2388_2741 117
46 3300049582 Ga0501048_0195212 Ga0501048_0195212_105_458 117
47 3300049584 Ga0501068_0564225 Ga0501068_0564225_229_582 117
48 3300049584 Ga0501068_0588477 Ga0501068_0588477_47_400 117
49 3300049590 Ga0501074_0397711 Ga0501074_0397711_207_560 117
50 3300049591 Ga0501075_0394472 Ga0501075_0394472_179_532 117
51 3300049592 Ga0501076_1072418 Ga0501076_1072418_121_474 117
52 3300049744 Ga0501083_0435062 Ga0501083_0435062_339_692 117
53 3300049822 Ga0501035_0045368 Ga0501035_0045368_3119_3472 117
54 3300049823 Ga0501044_0004036 Ga0501044_0004036_7295_7648 117
55 3300049824 Ga0501045_0464572 Ga0501045_0464572_427_780 117
56 3300050491 nmdc:mga00v17_180307_c1 nmdc:mga00v17_180307_c1_925_1278 117
57 3300054114 Ga0501084_1072714 Ga0501084_1072714_201_554 117
58 3300059604 Ga0587098_002379 Ga0587098_002379_1105_1458 117
59 3300059630 Ga0587128_097359 Ga0587128_097359_19_372 117
60 3300035090 Ga0373949_0091153 Ga0373949_0091153_454_810 118
61 3300045976 Ga0466967_0915247 Ga0466967_0915247_357_716 118
62 3300045976 Ga0466967_1551026 Ga0466967_1551026_217_576 118
63 3300049533 Ga0501317_026522 Ga0501317_026522_113_469 118
64 3300049539 Ga0501323_039714 Ga0501323_039714_32_391 118
65 3300059490 Ga0587066_058573 Ga0587066_058573_114_470 118
66 3300059503 Ga0587080_115173 Ga0587080_115173_37_393 118
67 3300059510 Ga0587090_019187 Ga0587090_019187_113_469 118
68 3300059628 Ga0587122_002384 Ga0587122_002384_82_438 118
69 3300013306 Ga0163162_13222510 Ga0163162_132225101 119
70 3300013308 Ga0157375_13070749 Ga0157375_130707491 119
71 3300029277 Ga0311001_1009267 Ga0311001_10092672 119
72 3300030733 Ga0314311_1073478 Ga0314311_10734781 119
73 3300030744 Ga0316181_1215462 Ga0316181_12154626 119
74 3300030745 Ga0316182_1254280 Ga0316182_12542802 119
75 3300031824 Ga0307413_10611375 Ga0307413_106113752 119
76 3300031852 Ga0307410_10184010 Ga0307410_101840103 119
77 3300031995 Ga0307409_100151413 Ga0307409_1001514135 119
78 3300032002 Ga0307416_102098915 Ga0307416_1020989152 119
79 3300032004 Ga0307414_10554788 Ga0307414_105547882 119
80 3300041444 Ga0451790_39612 Ga0451790_39612_128_487 119
81 3300049127 Ga0501306_057801 Ga0501306_057801_200_559 119
82 3300049129 Ga0501309_052244 Ga0501309_052244_110_469 119
83 3300049162 Ga0501307_082083 Ga0501307_082083_90_449 119
84 3300049531 Ga0501315_060227 Ga0501315_060227_48_407 119
85 3300049534 Ga0501318_037506 Ga0501318_037506_25_384 119
86 iso_pu_bacteria 2675903058 2676476381 119
87 iso_pu_bacteria 2827628540 2827632189 119
88 3300001990 JGI24737J22298_10012287 JGI24737J22298_100122872 120
89 3300003574 Ga0007410J51695_1035240 Ga0007410J51695_10352402 120
90 3300005337 Ga0070682_100909988 Ga0070682_1009099881 120
91 3300005441 Ga0070700_100197231 Ga0070700_1001972312 120
92 3300006038 Ga0075365_10010269 Ga0075365_100102698 120
93 3300020075 Ga0206349_1728845 Ga0206349_17288452 120
94 3300020078 Ga0206352_10923546 Ga0206352_109235462 120
95 3300020080 Ga0206350_10162975 Ga0206350_101629752 120
96 3300020081 Ga0206354_10259773 Ga0206354_102597732 120
97 3300025899 Ga0207642_10489173 Ga0207642_104891731 120
98 3300025960 Ga0207651_11033470 Ga0207651_110334702 120
99 3300026075 Ga0207708_10212661 Ga0207708_102126613 120
100 3300026121 Ga0207683_10294499 Ga0207683_102944992 120
101 3300027876 Ga0209974_10038524 Ga0209974_100385245 120
102 3300031901 Ga0307406_10652116 Ga0307406_106521162 120
103 3300031903 Ga0307407_10083148 Ga0307407_100831484 120
104 3300031995 Ga0307409_101685438 Ga0307409_1016854381 120
105 3300032002 Ga0307416_101446523 Ga0307416_1014465232 120
106 3300041460 Ga0451802_1641578 Ga0451802_1641578_166_534 120
107 3300041494 Ga0451837_1597447 Ga0451837_1597447_243_611 120
108 3300041503 Ga0451847_0587709 Ga0451847_0587709_155_523 120
109 3300041512 Ga0451853_3993736 Ga0451853_3993736_354_722 120
110 3300044684 Ga0466966_0193016 Ga0466966_0193016_735_1097 120
111 3300044693 Ga0466961_0177210 Ga0466961_0177210_760_1122 120
112 3300044735 Ga0466968_0018610 Ga0466968_0018610_2172_2534 120
113 3300044735 Ga0466968_0230384 Ga0466968_0230384_413_775 120
114 3300044842 Ga0466957_0687044 Ga0466957_0687044_163_525 120
115 3300044901 Ga0466960_0239863 Ga0466960_0239863_372_734 120
116 3300045836 Ga0466958_0522913 Ga0466958_0522913_88_450 120
117 3300045976 Ga0466967_0526888 Ga0466967_0526888_337_699 120
118 3300046500 Ga0495596_0115425 Ga0495596_0115425_248_610 120
119 3300046691 Ga0495670_0417221 Ga0495670_0417221_50_412 120
120 3300048913 Ga0496110_0168420 Ga0496110_0168420_324_686 120
121 3300048917 Ga0496114_0590074 Ga0496114_0590074_271_633 120
122 3300049127 Ga0501306_013778 Ga0501306_013778_330_692 120
123 3300049129 Ga0501309_002625 Ga0501309_002625_1230_1592 120
124 3300049130 Ga0501310_001576 Ga0501310_001576_1497_1859 120
125 3300049161 Ga0501305_076760 Ga0501305_076760_11_373 120
126 3300049527 Ga0501311_010495 Ga0501311_010495_464_826 120
127 3300049528 Ga0501312_071475 Ga0501312_071475_169_531 120
128 3300049531 Ga0501315_042283 Ga0501315_042283_84_446 120
129 3300049532 Ga0501316_015679 Ga0501316_015679_238_600 120
130 3300049534 Ga0501318_000290 Ga0501318_000290_2259_2621 120
131 3300049539 Ga0501323_043347 Ga0501323_043347_64_426 120
132 3300049585 Ga0501069_0114126 Ga0501069_0114126_270_632 120
133 3300049585 Ga0501069_0587778 Ga0501069_0587778_159_521 120
134 3300049779 Ga0501283_081287 Ga0501283_081287_37_399 120
135 3300050492 nmdc:mga0yw44_1197_c1 nmdc:mga0yw44_1197_c1_4041_4403 120
136 3300050511 nmdc:mga08y16_1311497_c1 nmdc:mga08y16_1311497_c1_163_525 120
137 3300054114 Ga0501084_0319807 Ga0501084_0319807_929_1291 120
138 3300059623 Ga0587101_038367 Ga0587101_038367_26_388 120
139 3300060344 Ga0587071_013879 Ga0587071_013879_253_615 120
140 3300001979 JGI24740J21852_10008892 JGI24740J21852_100088925 121
141 3300001990 JGI24737J22298_10126469 JGI24737J22298_101264692 121
142 3300005327 Ga0070658_10508990 Ga0070658_105089902 121
143 3300005347 Ga0070668_100882389 Ga0070668_1008823892 121
144 3300005353 Ga0070669_101501183 Ga0070669_1015011831 121
145 3300005718 Ga0068866_10148691 Ga0068866_101486913 121
146 3300005719 Ga0068861_100050932 Ga0068861_1000509326 121
147 3300009094 Ga0111539_10925055 Ga0111539_109250552 121
148 3300009148 Ga0105243_11861059 Ga0105243_118610592 121
149 3300014326 Ga0157380_10693270 Ga0157380_106932702 121
150 3300025315 Ga0207697_10354411 Ga0207697_103544112 121
151 3300025918 Ga0207662_10149782 Ga0207662_101497823 121
152 3300025938 Ga0207704_10089458 Ga0207704_100894582 121
153 3300025972 Ga0207668_10358642 Ga0207668_103586422 121
154 3300026118 Ga0207675_100039815 Ga0207675_1000398156 121
155 3300026118 Ga0207675_100145970 Ga0207675_1001459701 121
156 3300027876 Ga0209974_10054922 Ga0209974_100549221 121
157 3300031824 Ga0307413_10067749 Ga0307413_100677495 121
158 3300031901 Ga0307406_11752378 Ga0307406_117523782 121
159 3300031995 Ga0307409_100222898 Ga0307409_1002228984 121
160 3300031995 Ga0307409_100571600 Ga0307409_1005716002 121
161 3300032002 Ga0307416_101339257 Ga0307416_1013392572 121
162 3300032004 Ga0307414_10045651 Ga0307414_100456514 121
163 3300032005 Ga0307411_10042433 Ga0307411_100424332 121
164 3300044658 Ga0466972_0142557 Ga0466972_0142557_191_559 121
165 3300044683 Ga0466965_0086225 Ga0466965_0086225_615_983 121
166 3300044765 Ga0466970_0044578 Ga0466970_0044578_421_789 121
167 3300044901 Ga0466960_0135516 Ga0466960_0135516_237_605 121
168 3300048903 Ga0496100_0171045 Ga0496100_0171045_1185_1553 121
169 3300048905 Ga0496102_0296020 Ga0496102_0296020_1108_1473 121
170 3300048906 Ga0496103_0124836 Ga0496103_0124836_122_487 121
171 3300048913 Ga0496110_0379169 Ga0496110_0379169_22_387 121
172 3300048913 Ga0496110_1873019 Ga0496110_1873019_91_459 121
173 3300049128 Ga0501308_042512 Ga0501308_042512_129_494 121
174 3300049128 Ga0501308_048031 Ga0501308_048031_226_594 121
175 3300049131 Ga0501341_09098 Ga0501341_09098_263_628 121
176 3300049161 Ga0501305_060609 Ga0501305_060609_111_476 121
177 3300049514 Ga0501291_024209 Ga0501291_024209_532_897 121
178 3300049527 Ga0501311_026480 Ga0501311_026480_135_500 121
179 3300049532 Ga0501316_003666 Ga0501316_003666_947_1312 121
180 3300049533 Ga0501317_085957 Ga0501317_085957_56_421 121
181 3300049537 Ga0501321_006115 Ga0501321_006115_766_1131 121
182 3300049538 Ga0501322_030989 Ga0501322_030989_85_450 121
183 3300049824 Ga0501045_0284429 Ga0501045_0284429_203_568 121
184 3300050511 nmdc:mga08y16_708052_c1 nmdc:mga08y16_708052_c1_377_742 121
185 3300059508 Ga0587088_121034 Ga0587088_121034_215_583 121
186 3300059604 Ga0587098_009797 Ga0587098_009797_500_868 121
187 3300059647 Ga0587079_003817 Ga0587079_003817_157_528 121
188 3300059647 Ga0587079_034140 Ga0587079_034140_179_547 121
189 3300003911 JGI25405J52794_10053414 JGI25405J52794_100534142 122
190 3300005937 Ga0081455_10000409 Ga0081455_1000040912 122
191 3300005937 Ga0081455_10009428 Ga0081455_1000942814 122
192 3300005937 Ga0081455_10740939 Ga0081455_107409391 122
193 3300005981 Ga0081538_10092359 Ga0081538_100923592 122
194 3300006058 Ga0075432_10110025 Ga0075432_101100252 122
195 3300006844 Ga0075428_100002072 Ga0075428_10000207213 122
196 3300006846 Ga0075430_100028829 Ga0075430_1000288299 122
197 3300006846 Ga0075430_100376480 Ga0075430_1003764801 122
198 3300006847 Ga0075431_100004313 Ga0075431_10000431316 122
199 3300006847 Ga0075431_100038721 Ga0075431_1000387219 122
200 3300006871 Ga0075434_100428737 Ga0075434_1004287372 122
201 3300006880 Ga0075429_100010921 Ga0075429_1000109215 122
202 3300006880 Ga0075429_101253842 Ga0075429_1012538422 122
203 3300009094 Ga0111539_10041331 Ga0111539_100413319 122
204 3300009147 Ga0114129_10006606 Ga0114129_1000660618 122
205 3300027907 Ga0207428_10010526 Ga0207428_1001052610 122
206 3300037471 Ga0395905_0034499 Ga0395905_0034499_2776_3147 122
207 3300041405 Ga0439438_012318 Ga0439438_012318_1933_2301 122
208 3300041413 Ga0439465_0024760 Ga0439465_0024760_668_1036 122
209 3300042002 Ga0439442_023602 Ga0439442_023602_299_667 122
210 3300042004 Ga0439445_0057794 Ga0439445_0057794_413_781 122
211 3300042007 Ga0439449_0038001 Ga0439449_0038001_101_469 122
212 3300044658 Ga0466972_0077032 Ga0466972_0077032_484_855 122
213 3300044693 Ga0466961_0364585 Ga0466961_0364585_207_578 122
214 3300044706 Ga0466964_0067997 Ga0466964_0067997_979_1350 122
215 3300044719 Ga0466971_0497165 Ga0466971_0497165_79_450 122
216 3300044765 Ga0466970_0400183 Ga0466970_0400183_255_626 122
217 3300044765 Ga0466970_0495013 Ga0466970_0495013_320_691 122
218 3300045049 Ga0466959_0449311 Ga0466959_0449311_443_814 122
219 3300050507 nmdc:mga05p37_10660_c1 nmdc:mga05p37_10660_c1_4023_4394 122
220 3300050508 nmdc:mga09592_1341425_c1 nmdc:mga09592_1341425_c1_97_468 122
221 3300050508 nmdc:mga09592_2299_c1 nmdc:mga09592_2299_c1_446_817 122
222 3300050509 nmdc:mga0qj67_10084_c1 nmdc:mga0qj67_10084_c1_5483_5854 122
223 3300050509 nmdc:mga0qj67_366001_c1 nmdc:mga0qj67_366001_c1_768_1139 122
224 3300050510 nmdc:mga06r32_130_c1 nmdc:mga06r32_130_c1_46165_46536 122
225 3300050510 nmdc:mga06r32_5565_c1 nmdc:mga06r32_5565_c1_10091_10462 122
226 3300050511 nmdc:mga08y16_3501_c1 nmdc:mga08y16_3501_c1_10225_10596 122
227 3300050514 nmdc:mga08x19_537882_c1 nmdc:mga08x19_537882_c1_106_477 122
228 3300059477 Ga0587084_034571 Ga0587084_034571_226_597 122
229 3300059605 Ga0587106_046755 Ga0587106_046755_153_524 122
230 3300059652 Ga0587107_001080 Ga0587107_001080_1586_1957 122
231 3300060344 Ga0587071_126492 Ga0587071_126492_163_534 122
232 iso_pu_bacteria 2515154155 2515851624 122
233 3300003373 JGI25407J50210_10003808 JGI25407J50210_100038086 123
234 3300005341 Ga0070691_10159210 Ga0070691_101592102 123
235 3300005445 Ga0070708_100151355 Ga0070708_1001513555 123
236 3300005467 Ga0070706_101040320 Ga0070706_1010403202 123
237 3300005471 Ga0070698_100011467 Ga0070698_10001146714 123
238 3300005535 Ga0070684_101022578 Ga0070684_1010225781 123
239 3300005614 Ga0068856_100321310 Ga0068856_1003213103 123
240 3300005841 Ga0068863_102400322 Ga0068863_1024003222 123
241 3300005981 Ga0081538_10000088 Ga0081538_1000008855 123
242 3300009551 Ga0105238_10275283 Ga0105238_102752834 123
243 3300013307 Ga0157372_12076381 Ga0157372_120763811 123
244 3300013308 Ga0157375_11693248 Ga0157375_116932482 123
245 3300025910 Ga0207684_10998473 Ga0207684_109984732 123
246 3300025922 Ga0207646_10133214 Ga0207646_101332143 123
247 3300025933 Ga0207706_11168765 Ga0207706_111687652 123
248 3300025944 Ga0207661_10303699 Ga0207661_103036993 123
249 3300030731 Ga0316177_1153746 Ga0316177_11537461 123
250 3300031548 Ga0307408_100999177 Ga0307408_1009991772 123
251 3300031731 Ga0307405_10537185 Ga0307405_105371852 123
252 3300031911 Ga0307412_10039499 Ga0307412_100394996 123
253 3300031995 Ga0307409_101970167 Ga0307409_1019701671 123
254 3300032002 Ga0307416_100594595 Ga0307416_1005945952 123
255 3300041410 Ga0439461_0017877 Ga0439461_0017877_302_673 123
256 3300041444 Ga0451790_09494 Ga0451790_09494_342_716 123
257 3300041997 Ga0439431_0000819 Ga0439431_0000819_33_404 123
258 3300042156 Ga0439446_0003732 Ga0439446_0003732_1990_2361 123
259 3300042435 Ga0439434_0000725 Ga0439434_0000725_6031_6402 123
260 3300048903 Ga0496100_0206460 Ga0496100_0206460_430_804 123
261 3300048911 Ga0496108_0374356 Ga0496108_0374356_807_1181 123
262 3300048912 Ga0496109_0654700 Ga0496109_0654700_313_687 123
263 3300048912 Ga0496109_0992763 Ga0496109_0992763_362_736 123
264 3300048912 Ga0496109_1065009 Ga0496109_1065009_187_561 123
265 3300048913 Ga0496110_0983490 Ga0496110_0983490_366_740 123
266 3300048914 Ga0496111_0280427 Ga0496111_0280427_382_756 123
267 3300048914 Ga0496111_0631105 Ga0496111_0631105_152_529 123
268 3300048915 Ga0496112_1239930 Ga0496112_1239930_90_464 123
269 3300049127 Ga0501306_025188 Ga0501306_025188_220_594 123
270 3300049161 Ga0501305_061275 Ga0501305_061275_115_492 123
271 3300049532 Ga0501316_068605 Ga0501316_068605_58_432 123
272 3300049568 Ga0501031_0048743 Ga0501031_0048743_1530_1904 123
273 3300049570 Ga0501033_0145147 Ga0501033_0145147_298_675 123
274 3300049571 Ga0501034_0040203 Ga0501034_0040203_172_549 123
275 3300049571 Ga0501034_0599091 Ga0501034_0599091_406_780 123
276 3300049572 Ga0501036_0287575 Ga0501036_0287575_770_1144 123
277 3300049572 Ga0501036_0475958 Ga0501036_0475958_123_497 123
278 3300049574 Ga0501038_0147944 Ga0501038_0147944_1464_1841 123
279 3300049574 Ga0501038_0151350 Ga0501038_0151350_706_1080 123
280 3300049575 Ga0501039_0515577 Ga0501039_0515577_358_732 123
281 3300049576 Ga0501040_0044216 Ga0501040_0044216_1507_1881 123
282 3300049576 Ga0501040_0280634 Ga0501040_0280634_29_403 123
283 3300049577 Ga0501041_0006740 Ga0501041_0006740_2889_3263 123
284 3300049578 Ga0501042_0034939 Ga0501042_0034939_2667_3041 123
285 3300049579 Ga0501043_0029097 Ga0501043_0029097_768_1142 123
286 3300049579 Ga0501043_0511795 Ga0501043_0511795_232_606 123
287 3300049579 Ga0501043_0743726 Ga0501043_0743726_138_515 123
288 3300049580 Ga0501046_0050632 Ga0501046_0050632_1220_1594 123
289 3300049580 Ga0501046_0575584 Ga0501046_0575584_188_562 123
290 3300049581 Ga0501047_0023921 Ga0501047_0023921_2440_2817 123
291 3300049582 Ga0501048_0033481 Ga0501048_0033481_1574_1948 123
292 3300049587 Ga0501071_0067819 Ga0501071_0067819_1651_2025 123
293 3300049587 Ga0501071_0224876 Ga0501071_0224876_564_935 123
294 3300049588 Ga0501072_0231577 Ga0501072_0231577_580_951 123
295 3300049588 Ga0501072_0254096 Ga0501072_0254096_636_1010 123
296 3300049588 Ga0501072_0738919 Ga0501072_0738919_107_481 123
297 3300049589 Ga0501073_0109952 Ga0501073_0109952_439_816 123
298 3300049590 Ga0501074_0100768 Ga0501074_0100768_512_886 123
299 3300049591 Ga0501075_0876887 Ga0501075_0876887_222_596 123
300 3300049592 Ga0501076_0101880 Ga0501076_0101880_417_791 123
301 3300049593 Ga0501077_0003693 Ga0501077_0003693_3376_3750 123
302 3300049741 Ga0501079_0050969 Ga0501079_0050969_1264_1638 123
303 3300049742 Ga0501080_0107570 Ga0501080_0107570_2153_2527 123
304 3300049742 Ga0501080_1212911 Ga0501080_1212911_263_637 123
305 3300049743 Ga0501081_0107003 Ga0501081_0107003_694_1068 123
306 3300049822 Ga0501035_0015444 Ga0501035_0015444_6288_6662 123
307 3300049822 Ga0501035_0058251 Ga0501035_0058251_1735_2112 123
308 3300049822 Ga0501035_0204322 Ga0501035_0204322_434_808 123
309 3300049824 Ga0501045_0009893 Ga0501045_0009893_4915_5289 123
310 3300049824 Ga0501045_0341315 Ga0501045_0341315_660_1034 123
311 3300054114 Ga0501084_0402166 Ga0501084_0402166_219_593 123
312 3300060353 Ga0501082_0153707 Ga0501082_0153707_901_1275 123
313 3300060353 Ga0501082_0565583 Ga0501082_0565583_478_855 123
314 3300061734 Ga0530510_0166551 Ga0530510_0166551_233_607 123
315 iso_pu_bacteria 2855386786 2855389967 123
316 3300005366 Ga0070659_101455687 Ga0070659_1014556871 124
317 3300005456 Ga0070678_101966495 Ga0070678_1019664951 124
318 3300005543 Ga0070672_100049439 Ga0070672_1000494392 124
319 3300006881 Ga0068865_100432253 Ga0068865_1004322532 124
320 3300009094 Ga0111539_10324979 Ga0111539_103249792 124
321 3300026121 Ga0207683_10774332 Ga0207683_107743322 124
322 3300031731 Ga0307405_10720537 Ga0307405_107205372 124
323 3300031901 Ga0307406_11678331 Ga0307406_116783312 124
324 3300032002 Ga0307416_100569983 Ga0307416_1005699832 124
325 3300032126 Ga0307415_100599409 Ga0307415_1005994091 124
326 3300049162 Ga0501307_085661 Ga0501307_085661_23_403 124
327 3300049533 Ga0501317_040314 Ga0501317_040314_306_686 124
328 3300049568 Ga0501031_0255928 Ga0501031_0255928_133_516 124
329 3300049572 Ga0501036_0966372 Ga0501036_0966372_301_684 124
330 3300049574 Ga0501038_0470270 Ga0501038_0470270_465_848 124
331 3300049576 Ga0501040_0340971 Ga0501040_0340971_78_461 124
332 3300049588 Ga0501072_0096794 Ga0501072_0096794_207_590 124
333 3300049590 Ga0501074_0748582 Ga0501074_0748582_266_649 124
334 3300049593 Ga0501077_0651395 Ga0501077_0651395_42_425 124
335 3300050511 nmdc:mga08y16_528315_c1 nmdc:mga08y16_528315_c1_723_1106 124
336 3300059421 Ga0590071_045252 Ga0590071_045252_232_612 124
337 3300059426 Ga0590077_051128 Ga0590077_051128_21_401 124
338 3300060353 Ga0501082_0353459 Ga0501082_0353459_222_605 124
339 3300013105 Ga0157369_11069187 Ga0157369_110691872 125
340 3300044693 Ga0466961_0284189 Ga0466961_0284189_328_714 125
341 3300049590 Ga0501074_0296326 Ga0501074_0296326_322_699 125
342 3300046678 Ga0495599_0236070 Ga0495599_0236070_686_1066 126
343 3300012503 Ga0157313_1029794 Ga0157313_10297942 127
344 3300046663 Ga0495635_0873000 Ga0495635_0873000_26_433 127
345 3300049576 Ga0501040_0557368 Ga0501040_0557368_421_804 127
346 3300013307 Ga0157372_13404764 Ga0157372_134047642 128
347 3300025981 Ga0207640_11246215 Ga0207640_112462151 128
348 3300005435 Ga0070714_100035855 Ga0070714_1000358559 129
349 3300013307 Ga0157372_10513493 Ga0157372_105134934 129
350 3300020070 Ga0206356_10152300 Ga0206356_101523001 129
351 3300020081 Ga0206354_10389959 Ga0206354_103899591 129
352 3300025929 Ga0207664_10030840 Ga0207664_100308409 129
353 3300046663 Ga0495635_0144740 Ga0495635_0144740_1176_1565 129
354 3300049533 Ga0501317_035171 Ga0501317_035171_270_659 129
355 3300049578 Ga0501042_0255734 Ga0501042_0255734_774_1163 129
356 3300049580 Ga0501046_0429942 Ga0501046_0429942_129_518 129
357 3300049824 Ga0501045_0585775 Ga0501045_0585775_97_486 129
358 3300053077 Ga0495601_0008187 Ga0495601_0008187_588_977 129
359 3300059424 Ga0590075_087404 Ga0590075_087404_155_544 129
360 3300060353 Ga0501082_1139659 Ga0501082_1139659_22_411 129
361 3300003162 Ga0006778J45830_1033640 Ga0006778J45830_10336402 130
362 3300013104 Ga0157370_10860253 Ga0157370_108602532 130
363 3300013307 Ga0157372_10226194 Ga0157372_102261946 130
364 3300003163 Ga0006759J45824_1061080 Ga0006759J45824_10610802 131
365 3300003574 Ga0007410J51695_1042358 Ga0007410J51695_10423582 131
366 3300003579 Ga0007429J51699_1104597 Ga0007429J51699_11045972 131
367 3300003693 Ga0032354_1021131 Ga0032354_10211314 131
368 3300004800 Ga0058861_11895946 Ga0058861_118959465 131
369 3300005441 Ga0070700_100582617 Ga0070700_1005826172 131
370 3300005444 Ga0070694_101618392 Ga0070694_1016183921 131
371 3300005456 Ga0070678_101817714 Ga0070678_1018177141 131
372 3300005530 Ga0070679_100047460 Ga0070679_1000474608 131
373 3300005535 Ga0070684_100147325 Ga0070684_1001473255 131
374 3300005545 Ga0070695_101091600 Ga0070695_1010916001 131
375 3300005615 Ga0070702_100461810 Ga0070702_1004618101 131
376 3300006844 Ga0075428_101162860 Ga0075428_1011628602 131
377 3300006852 Ga0075433_10475634 Ga0075433_104756342 131
378 3300009147 Ga0114129_10824430 Ga0114129_108244302 131
379 3300009148 Ga0105243_10773428 Ga0105243_107734282 131
380 3300011119 Ga0105246_10732665 Ga0105246_107326652 131
381 3300011119 Ga0105246_10872464 Ga0105246_108724642 131
382 3300013102 Ga0157371_10297736 Ga0157371_102977362 131
383 3300013307 Ga0157372_10295637 Ga0157372_102956374 131
384 3300013307 Ga0157372_13000236 Ga0157372_130002362 131
385 3300013308 Ga0157375_12379371 Ga0157375_123793712 131
386 3300020070 Ga0206356_10143644 Ga0206356_101436442 131
387 3300020077 Ga0206351_10585592 Ga0206351_105855923 131
388 3300020081 Ga0206354_10486322 Ga0206354_104863222 131
389 3300025899 Ga0207642_10126227 Ga0207642_101262273 131
390 3300025908 Ga0207643_10841414 Ga0207643_108414142 131
391 3300025919 Ga0207657_10334528 Ga0207657_103345282 131
392 3300025921 Ga0207652_10090598 Ga0207652_100905986 131
393 3300025935 Ga0207709_10804890 Ga0207709_108048902 131
394 3300025942 Ga0207689_10629775 Ga0207689_106297752 131
395 3300025944 Ga0207661_10108564 Ga0207661_101085642 131
396 3300025945 Ga0207679_10406346 Ga0207679_104063462 131
397 3300026095 Ga0207676_10955284 Ga0207676_109552841 131
398 3300026118 Ga0207675_100211184 Ga0207675_1002111842 131
399 3300026121 Ga0207683_10106374 Ga0207683_101063745 131
400 3300026121 Ga0207683_10964040 Ga0207683_109640402 131
401 3300035088 Ga0373940_0090719 Ga0373940_0090719_387_782 131
402 3300035090 Ga0373949_0182458 Ga0373949_0182458_196_591 131
403 3300035207 Ga0373942_0041272 Ga0373942_0041272_693_1088 131
404 3300035691 Ga0373931_0347792 Ga0373931_0347792_148_543 131
405 3300037466 Ga0395898_0243734 Ga0395898_0243734_785_1192 131
406 3300038443 Ga0395901_0370953 Ga0395901_0370953_492_899 131
407 3300044683 Ga0466965_0309122 Ga0466965_0309122_262_657 131
408 3300044694 Ga0466963_0123506 Ga0466963_0123506_786_1202 131
409 3300044719 Ga0466971_0050354 Ga0466971_0050354_1325_1738 131
410 3300044765 Ga0466970_0024640 Ga0466970_0024640_1425_1838 131
411 3300044765 Ga0466970_0553534 Ga0466970_0553534_176_571 131
412 3300044842 Ga0466957_0041425 Ga0466957_0041425_1723_2139 131
413 3300044901 Ga0466960_0088713 Ga0466960_0088713_513_926 131
414 3300044901 Ga0466960_0109980 Ga0466960_0109980_319_723 131
415 3300045836 Ga0466958_0125691 Ga0466958_0125691_383_799 131
416 3300049568 Ga0501031_0026809 Ga0501031_0026809_2445_2840 131
417 3300049568 Ga0501031_0596866 Ga0501031_0596866_237_641 131
418 3300049574 Ga0501038_0144848 Ga0501038_0144848_494_889 131
419 3300049575 Ga0501039_0526207 Ga0501039_0526207_22_426 131
420 3300049576 Ga0501040_0102624 Ga0501040_0102624_815_1210 131
421 3300049576 Ga0501040_0218040 Ga0501040_0218040_551_961 131
422 3300049579 Ga0501043_0674391 Ga0501043_0674391_331_735 131
423 3300049582 Ga0501048_0165013 Ga0501048_0165013_593_988 131
424 3300049582 Ga0501048_0170534 Ga0501048_0170534_1035_1439 131
425 3300049583 Ga0501067_0331615 Ga0501067_0331615_121_516 131
426 3300049587 Ga0501071_0119659 Ga0501071_0119659_639_1034 131
427 3300049588 Ga0501072_0575251 Ga0501072_0575251_213_608 131
428 3300049588 Ga0501072_0847073 Ga0501072_0847073_64_468 131
429 3300049591 Ga0501075_0726304 Ga0501075_0726304_165_560 131
430 3300049592 Ga0501076_0816347 Ga0501076_0816347_152_556 131
431 3300049592 Ga0501076_1694790 Ga0501076_1694790_52_447 131
432 3300049593 Ga0501077_0377458 Ga0501077_0377458_19_414 131
433 3300049741 Ga0501079_0300130 Ga0501079_0300130_743_1150 131
434 3300049824 Ga0501045_0136422 Ga0501045_0136422_504_899 131
435 3300060353 Ga0501082_1438826 Ga0501082_1438826_48_443 131
436 3300061734 Ga0530510_0311865 Ga0530510_0311865_374_769 131
437 3300005840 Ga0068870_10845555 Ga0068870_108455551 132
438 3300014497 Ga0182008_10131020 Ga0182008_101310203 132
439 3300014497 Ga0182008_10624906 Ga0182008_106249061 132
440 3300048909 Ga0496106_0330310 Ga0496106_0330310_415_885 132
441 3300048917 Ga0496114_0478775 Ga0496114_0478775_482_880 132
442 3300048918 Ga0496115_0076142 Ga0496115_0076142_1129_1599 132
443 3300000041 ARcpr5oldR_c011035 ARcpr5oldR_0110352 133
444 3300005337 Ga0070682_100361579 Ga0070682_1003615791 133
445 3300005438 Ga0070701_11092936 Ga0070701_110929361 133
446 3300005455 Ga0070663_100273135 Ga0070663_1002731352 133
447 3300005614 Ga0068856_100217906 Ga0068856_1002179065 133
448 3300005616 Ga0068852_101678796 Ga0068852_1016787962 133
449 3300009094 Ga0111539_10520194 Ga0111539_105201942 133
450 3300009551 Ga0105238_10157037 Ga0105238_101570372 133
451 3300013296 Ga0157374_10357795 Ga0157374_103577952 133
452 3300013307 Ga0157372_10067801 Ga0157372_100678012 133
453 3300020069 Ga0197907_10192508 Ga0197907_101925082 133
454 3300020070 Ga0206356_11105166 Ga0206356_111051662 133
455 3300020080 Ga0206350_10630256 Ga0206350_106302562 133
456 3300020082 Ga0206353_11640620 Ga0206353_116406202 133
457 3300025901 Ga0207688_10049806 Ga0207688_100498063 133
458 3300026023 Ga0207677_10153044 Ga0207677_101530443 133
459 3300026067 Ga0207678_10584440 Ga0207678_105844402 133
460 3300026078 Ga0207702_10153626 Ga0207702_101536265 133
461 3300044901 Ga0466960_0431722 Ga0466960_0431722_123_527 133
462 3300045976 Ga0466967_0004906 Ga0466967_0004906_2074_2478 133
463 3300045976 Ga0466967_0376227 Ga0466967_0376227_708_1115 133
464 3300048089 Ga0495614_0101552 Ga0495614_0101552_744_1148 133
465 3300048903 Ga0496100_0022214 Ga0496100_0022214_1813_2214 133
466 3300048904 Ga0496101_0011272 Ga0496101_0011272_1219_1620 133
467 3300048905 Ga0496102_0004268 Ga0496102_0004268_9257_9658 133
468 3300048906 Ga0496103_0002413 Ga0496103_0002413_8056_8457 133
469 3300048907 Ga0496104_0052043 Ga0496104_0052043_211_612 133
470 3300048909 Ga0496106_0009361 Ga0496106_0009361_6548_6949 133
471 3300048910 Ga0496107_0016953 Ga0496107_0016953_2623_3024 133
472 3300048911 Ga0496108_0026274 Ga0496108_0026274_4285_4686 133
473 3300048912 Ga0496109_0029975 Ga0496109_0029975_3309_3710 133
474 3300048913 Ga0496110_0003020 Ga0496110_0003020_9069_9470 133
475 3300048914 Ga0496111_0024069 Ga0496111_0024069_1972_2373 133
476 3300048915 Ga0496112_0012650 Ga0496112_0012650_3190_3591 133
477 3300048916 Ga0496113_0015568 Ga0496113_0015568_1645_2046 133
478 3300048917 Ga0496114_0264366 Ga0496114_0264366_105_506 133
479 3300048917 Ga0496114_0839083 Ga0496114_0839083_324_725 133
480 3300048918 Ga0496115_0780498 Ga0496115_0780498_329_730 133
481 3300050515 nmdc:mga0a205_301832_c1 nmdc:mga0a205_301832_c1_25_426 133
482 3300061734 Ga0530510_0316452 Ga0530510_0316452_131_532 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

19

50

0.98

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

52

143

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9464 9 82
6xyw-assembly1.cif.gz_Au structure of the plant mitochondrial ribosome 0.9077 8 82
5x8t-assembly1.cif.gz_V structure of the 50s large subunit of chloroplast ribosome from spinach 0.9061 11 133
6ddg-assembly1.cif.gz_G structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.886 11 133
5h1s-assembly1.cif.gz_W structure of the large subunit of the chloro-ribosome 0.8789 10 133
ID Description Score Start End Superfamily
3kbgA03 Mainly Beta;Roll;SH3 type barrels.; 0.8643 12 44 2.30.30.30
af_C6KSV4_613_667_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8532 11 82 2.30.30.30
4ytlB01 Mainly Beta;Roll;SH3 type barrels.; 0.8495 11 82 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8493 7 131 2.30.30.30
af_A0A1D6LUW6_481_531_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8371 12 82 2.30.30.30
ID Description Score Start End GO Terms
AF-Q3API4-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9553 6 82 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1L2F1P5-F1-model_v4 Large ribosomal subunit protein uL24c 0.9549 9 82 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904
AF-A0A7V2G658-F1-model_v4 Large ribosomal subunit protein uL24 0.9502 9 82 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6P0U3M8-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9497 9 82 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A432AU85-F1-model_v4 Large ribosomal subunit protein uL24 0.9487 9 82 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
80.22 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map