F451987

General Info

Members Datasets Scaffolds Average Seq Length
479 278 447 215

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10014596|Ga0055531_100145965
Length 252
Sequence MKVGAPHGRELFLPNPLRKPVQNLAPTRRSYTRPDMSQNEAKRLAAEKAIEYVEDGMIVGVGTGSTVAFFIDALARIKHRIAGAVSSSDQSTERLRAHGIEVMELNNTGDLALYVDGADECDPHKRLIKGGGAALTREKIIAEASRKFVCIIDPIKQVPVLGRFPLPVEVIPMARSLAARQILALTGGQPVWRDGVVTDNGNVIIDVHGLSIVDPVAMERELSQIPGVVSVGLFARRPADVVIVGGEPPVVL

Samples

Sample ID Description Type Environment
1 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
15 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
16 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
17 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
18 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
21 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
22 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
23 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
24 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
25 2928963466 Dyella japonica 1073 Isolate Unclassified
26 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
27 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
28 2941471342 Luteibacter sp. 621 Isolate Unclassified
29 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
30 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
31 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
83 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
152 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
153 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
173 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
174 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
265 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
266 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
277 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
278 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.11
Metatranscriptomes 0.21
Isolates 6.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0
Rhizoplane 4.8
Rhizosphere 68.06
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001578 3300001904 Bacteria 4153
2 JGI24740J21852_10040373 3300001979 Bacteria 1415
3 JGI24738J21930_10000012 3300002075 Bacteria 36302
4 JGI25162J39368_1003181 3300002737 Bacteria 5117
5 JGI25157J39369_1000680 3300002741 Bacteria 18559
6 JGI25164J39214_1011555 3300002772 Bacteria 844
7 JGI25151J46595_10000116 3300003187 Bacteria 107172
8 JGI25151J46595_10079667 3300003187 Bacteria 954
9 rootH1_10017020 3300003316 Bacteria 2821
10 rootH2_10191190 3300003320 Bacteria 1681
11 rootH2_10304705 3300003320 Bacteria 1078
12 Ga0055542_1003204 3300003762 Bacteria 4595
13 Ga0055524_1011809 3300003775 Bacteria 3387
14 Ga0055536_1001527 3300003781 Bacteria 13876
15 Ga0055536_1008245 3300003781 Bacteria 4514
16 Ga0055536_1009818 3300003781 Bacteria 3896
17 Ga0055536_1014126 3300003781 Bacteria 2828
18 Ga0055530_10001387 3300003791 Bacteria 17936
19 Ga0055531_10002056 3300003794 Bacteria 13876
20 Ga0055531_10012741 3300003794 Bacteria 3929
21 Ga0055531_10013009 3300003794 Bacteria 3869
22 Ga0055531_10014596 3300003794 Bacteria 3526
23 Ga0055531_10020691 3300003794 Bacteria 2589
24 Ga0065165_1005913 3300005262 Bacteria 6637
25 Ga0065714_10099633 3300005288 Bacteria 1682
26 Ga0065704_10000819 3300005289 Bacteria 23112
27 Ga0065704_10101469 3300005289 Bacteria 2236
28 Ga0065715_10012881 3300005293 Bacteria 3459
29 Ga0065715_10101061 3300005293 Bacteria 3241
30 Ga0065715_10247666 3300005293 Bacteria 1178
31 Ga0070683_100954254 3300005329 Bacteria 823
32 Ga0070670_100026589 3300005331 Bacteria 4978
33 Ga0070670_100162976 3300005331 Bacteria 1933
34 Ga0070666_10496087 3300005335 Bacteria 885
35 Ga0070660_100564256 3300005339 Bacteria 950
36 Ga0070689_100003694 3300005340 Bacteria 10225
37 Ga0070668_100007597 3300005347 Bacteria 8047
38 Ga0070669_100122576 3300005353 Bacteria 1985
39 Ga0070675_100354365 3300005354 Bacteria 1302
40 Ga0070671_100019167 3300005355 Bacteria 5565
41 Ga0070671_100177377 3300005355 Bacteria 1803
42 Ga0070674_100025257 3300005356 Bacteria 3866
43 Ga0070673_100265398 3300005364 Bacteria 1501
44 Ga0070673_100675715 3300005364 Bacteria 947
45 Ga0070667_100258096 3300005367 Bacteria 1560
46 Ga0070713_100001431 3300005436 Bacteria 15308
47 Ga0070710_10099902 3300005437 Bacteria 1726
48 Ga0070679_100427001 3300005530 Bacteria 1270
49 Ga0068853_100632618 3300005539 Bacteria 1017
50 Ga0070672_100061192 3300005543 Bacteria 2967
51 Ga0068855_100022053 3300005563 Bacteria 7634
52 Ga0070664_100460941 3300005564 Bacteria 1168
53 Ga0068857_100238494 3300005577 Bacteria 1664
54 Ga0068856_100463038 3300005614 Bacteria 1289
55 Ga0068864_100038345 3300005618 Bacteria 4092
56 Ga0068861_100243507 3300005719 Bacteria 1531
57 Ga0068870_10040489 3300005840 Unclassified 2416
58 Ga0068860_100033574 3300005843 Bacteria 4923
59 Ga0068862_100119895 3300005844 Bacteria 2318
60 Ga0075365_10106405 3300006038 Bacteria 1925
61 Ga0075365_10381778 3300006038 Bacteria 994
62 Ga0105244_10170084 3300009036 Bacteria 1037
63 Ga0105240_10603465 3300009093 Bacteria 1208
64 Ga0105247_10007364 3300009101 Bacteria 6763
65 Ga0105242_10120837 3300009176 Bacteria 2248
66 Ga0105248_10243142 3300009177 Bacteria 2026
67 Ga0105238_10014165 3300009551 Bacteria 8064
68 Ga0105028_101393 3300009993 Bacteria 2553
69 Ga0105028_101755 3300009993 Bacteria 2273
70 Ga0157318_1003931 3300012482 Bacteria 884
71 Ga0157373_10173577 3300013100 Bacteria 1517
72 Ga0157371_10000184 3300013102 Bacteria 92100
73 Ga0157371_10012570 3300013102 Bacteria 6467
74 Ga0157371_10028784 3300013102 Bacteria 4021
75 Ga0157371_10100030 3300013102 Bacteria 2056
76 Ga0157370_10004081 3300013104 Bacteria 16932
77 Ga0157370_10041258 3300013104 Bacteria 4454
78 Ga0157370_10176456 3300013104 Bacteria 1986
79 Ga0157369_10011591 3300013105 Bacteria 10009
80 Ga0157369_10022776 3300013105 Bacteria 6985
81 Ga0163162_10117995 3300013306 Bacteria 2755
82 Ga0163162_10213689 3300013306 Bacteria 2059
83 Ga0163162_10309047 3300013306 Bacteria 1713
84 Ga0157372_10097701 3300013307 Bacteria 3349
85 Ga0157372_10431720 3300013307 Bacteria 1535
86 Ga0157380_10020180 3300014326 Bacteria 4979
87 Ga0182008_10000939 3300014497 Bacteria 20309
88 Ga0182008_10043757 3300014497 Bacteria 2229
89 Ga0182008_10070910 3300014497 Bacteria 1714
90 Ga0182006_1006571 3300015261 Bacteria 5390
91 Ga0182006_1018874 3300015261 Bacteria 2909
92 Ga0182006_1033551 3300015261 Bacteria 2057
93 Ga0182007_10000118 3300015262 Bacteria 54536
94 Ga0182007_10015286 3300015262 Bacteria 2867
95 Ga0182005_1000268 3300015265 Bacteria 32952
96 Ga0182005_1017460 3300015265 Bacteria 1986
97 Ga0182005_1057370 3300015265 Bacteria 1062
98 Ga0163161_10000766 3300017792 Bacteria 25292
99 Ga0163161_10078295 3300017792 Bacteria 2430
100 Ga0163161_10200901 3300017792 Bacteria 1536
101 Ga0209672_101302 3300025228 Bacteria 9622
102 Ga0209147_104663 3300025229 Bacteria 2214
103 Ga0207427_103199 3300025231 Bacteria 3610
104 Ga0209437_100141 3300025233 Bacteria 166553
105 Ga0209258_103456 3300025242 Bacteria 3401
106 Ga0207425_1001522 3300025245 Bacteria 9524
107 Ga0209646_1010018 3300025246 Bacteria 1493
108 Ga0209148_1000002 3300025254 Bacteria 2399500
109 Ga0209233_1020570 3300025261 Bacteria 1727
110 Ga0209455_1007088 3300025272 Bacteria 3211
111 Ga0209673_1004508 3300025273 Bacteria 7419
112 Ga0209130_1004089 3300025284 Bacteria 5750
113 Ga0209130_1009164 3300025284 Bacteria 2850
114 Ga0209675_1008699 3300025291 Bacteria 3684
115 Ga0209676_1000027 3300025292 Bacteria 560222
116 Ga0209676_1000796 3300025292 Bacteria 41705
117 Ga0209676_1008927 3300025292 Bacteria 4401
118 Ga0209676_1009833 3300025292 Bacteria 4068
119 Ga0209676_1009939 3300025292 Bacteria 4030
120 Ga0209676_1010242 3300025292 Bacteria 3938
121 Ga0209025_1000023 3300025294 Bacteria 541307
122 Ga0209025_1030426 3300025294 Bacteria 2585
123 Ga0209025_1045514 3300025294 Bacteria 1818
124 Ga0209564_1009492 3300025295 Bacteria 4622
125 Ga0209758_1007000 3300025297 Bacteria 7846
126 Ga0209758_1032943 3300025297 Bacteria 2093
127 Ga0209050_1002178 3300025298 Bacteria 17699
128 Ga0209050_1041499 3300025298 Bacteria 1268
129 Ga0209256_1000825 3300025299 Bacteria 39320
130 Ga0209256_1001572 3300025299 Bacteria 22464
131 Ga0209257_1000046 3300025304 Bacteria 477765
132 Ga0209257_1000198 3300025304 Bacteria 149013
133 Ga0209257_1002904 3300025304 Bacteria 15851
134 Ga0209257_1010645 3300025304 Bacteria 4606
135 Ga0209257_1012481 3300025304 Bacteria 3916
136 Ga0209257_1012637 3300025304 Bacteria 3872
137 Ga0207692_10173327 3300025898 Bacteria 1252
138 Ga0207647_10000005 3300025904 Bacteria 223490
139 Ga0207643_10053842 3300025908 Unclassified 2286
140 Ga0207643_10425327 3300025908 Bacteria 842
141 Ga0207707_10063244 3300025912 Bacteria 3221
142 Ga0207695_10330715 3300025913 Bacteria 1412
143 Ga0207693_10265031 3300025915 Bacteria 1347
144 Ga0207657_10088666 3300025919 Bacteria 2585
145 Ga0207657_10486106 3300025919 Bacteria 967
146 Ga0207652_10257611 3300025921 Bacteria 1574
147 Ga0207652_10556032 3300025921 Bacteria 1031
148 Ga0207681_10125321 3300025923 Bacteria 1890
149 Ga0207694_10011437 3300025924 Bacteria 6697
150 Ga0207694_10030416 3300025924 Bacteria 4124
151 Ga0207694_11024817 3300025924 Bacteria 698
152 Ga0207650_10098513 3300025925 Bacteria 2246
153 Ga0207650_10170327 3300025925 Bacteria 1730
154 Ga0207664_10001014 3300025929 Bacteria 18830
155 Ga0207644_10012724 3300025931 Bacteria 5594
156 Ga0207670_10002104 3300025936 Bacteria 10403
157 Ga0207669_10043720 3300025937 Bacteria 2626
158 Ga0207691_10052571 3300025940 Bacteria 3720
159 Ga0207679_10258838 3300025945 Bacteria 1483
160 Ga0207667_10014308 3300025949 Bacteria 9049
161 Ga0207651_10317708 3300025960 Bacteria 1301
162 Ga0207668_10005933 3300025972 Bacteria 7197
163 Ga0207639_10004309 3300026041 Bacteria 9584
164 Ga0207678_10308272 3300026067 Bacteria 1361
165 Ga0207702_10211717 3300026078 Bacteria 1802
166 Ga0207641_10401155 3300026088 Bacteria 1317
167 Ga0207641_10956052 3300026088 Bacteria 852
168 Ga0207674_10103505 3300026116 Bacteria 2826
169 Ga0209969_1009644 3300027360 Bacteria 1377
170 Ga0210000_1001273 3300027462 Bacteria 3547
171 Ga0209968_1036384 3300027526 Bacteria 833
172 Ga0209982_1009860 3300027552 Bacteria 1414
173 Ga0209983_1002456 3300027665 Bacteria 4061
174 Ga0209971_1004124 3300027682 Bacteria 3442
175 Ga0209974_10011227 3300027876 Bacteria 3015
176 Ga0209974_10016927 3300027876 Bacteria 2420
177 Ga0268266_10226626 3300028379 Bacteria 1720
178 Ga0268264_10034678 3300028381 Bacteria 4152
179 Ga0316177_1175300 3300030731 Bacteria 1788
180 Ga0316176_1023789 3300030732 Bacteria 6457
181 Ga0314311_1000677 3300030733 Bacteria 6629
182 Ga0314311_1232034 3300030733 Bacteria 2068
183 Ga0316181_1178398 3300030744 Bacteria 1090
184 Ga0307513_10027272 3300031456 Bacteria 6562
185 Ga0307513_10295518 3300031456 Bacteria 1389
186 Ga0307408_100023984 3300031548 Bacteria 4160
187 Ga0307408_100063368 3300031548 Bacteria 2704
188 Ga0307408_100273830 3300031548 Bacteria 1403
189 Ga0307408_100405045 3300031548 Bacteria 1172
190 Ga0307405_10043761 3300031731 Bacteria 2734
191 Ga0307405_10691062 3300031731 Bacteria 844
192 Ga0307405_10766118 3300031731 Bacteria 805
193 Ga0307405_10903611 3300031731 Bacteria 747
194 Ga0307413_10019020 3300031824 Bacteria 3618
195 Ga0307413_10071304 3300031824 Bacteria 2189
196 Ga0307413_10134892 3300031824 Bacteria 1696
197 Ga0307413_10177546 3300031824 Bacteria 1514
198 Ga0307413_10196475 3300031824 Bacteria 1453
199 Ga0307413_10691213 3300031824 Bacteria 846
200 Ga0307410_10045344 3300031852 Bacteria 2927
201 Ga0307410_10087531 3300031852 Bacteria 2203
202 Ga0307410_10374562 3300031852 Bacteria 1144
203 Ga0307410_10459374 3300031852 Bacteria 1040
204 Ga0307406_10074879 3300031901 Bacteria 2231
205 Ga0307406_10099739 3300031901 Bacteria 1975
206 Ga0307406_10107524 3300031901 Bacteria 1913
207 Ga0307412_10126628 3300031911 Bacteria 1848
208 Ga0307412_10135404 3300031911 Bacteria 1796
209 Ga0307412_10361636 3300031911 Bacteria 1169
210 Ga0307409_100542174 3300031995 Bacteria 1140
211 Ga0307416_100424312 3300032002 Bacteria 1375
212 Ga0307416_100712612 3300032002 Bacteria 1093
213 Ga0307414_10005380 3300032004 Bacteria 7048
214 Ga0307414_10068551 3300032004 Bacteria 2546
215 Ga0307414_10083964 3300032004 Bacteria 2340
216 Ga0307414_10096892 3300032004 Bacteria 2208
217 Ga0307414_10101919 3300032004 Bacteria 2162
218 Ga0307414_10131613 3300032004 Bacteria 1943
219 Ga0307414_10155702 3300032004 Bacteria 1808
220 Ga0307414_10182223 3300032004 Bacteria 1690
221 Ga0307414_10515459 3300032004 Bacteria 1060
222 Ga0307414_10763553 3300032004 Bacteria 879
223 Ga0307411_10095763 3300032005 Bacteria 2085
224 Ga0307411_10202849 3300032005 Bacteria 1525
225 Ga0307411_10365438 3300032005 Bacteria 1181
226 Ga0307411_10550477 3300032005 Bacteria 984
227 Ga0307415_100311801 3300032126 Bacteria 1308
228 Ga0316593_10010814 3300032168 Bacteria 2633
229 Ga0395899_0027423 3300037312 Bacteria 4295
230 Ga0395899_0031315 3300037312 Bacteria 3998
231 Ga0395899_0050700 3300037312 Bacteria 3081
232 Ga0395899_0076738 3300037312 Bacteria 2438
233 Ga0395899_0090731 3300037312 Bacteria 2215
234 Ga0395899_0382239 3300037312 Bacteria 935
235 Ga0395900_0000049 3300037418 Bacteria 226847
236 Ga0395900_0001940 3300037418 Bacteria 23425
237 Ga0395900_0059445 3300037418 Bacteria 3935
238 Ga0395900_0108099 3300037418 Bacteria 2857
239 Ga0395900_0109820 3300037418 Bacteria 2833
240 Ga0395900_0119331 3300037418 Bacteria 2707
241 Ga0395898_0000110 3300037466 Bacteria 217100
242 Ga0395898_0024295 3300037466 Bacteria 6112
243 Ga0395898_0027286 3300037466 Bacteria 5734
244 Ga0395898_0059238 3300037466 Bacteria 3726
245 Ga0395898_0107788 3300037466 Bacteria 2671
246 Ga0395905_0075455 3300037471 Bacteria 3160
247 Ga0395905_0140970 3300037471 Bacteria 2267
248 Ga0395905_0208059 3300037471 Bacteria 1833
249 Ga0395901_0000267 3300038443 Bacteria 64966
250 Ga0395901_0045587 3300038443 Bacteria 4551
251 Ga0395901_0112681 3300038443 Bacteria 2856
252 Ga0400485_20364 3300038735 Bacteria 4256
253 Ga0400483_067590 3300039062 Bacteria 70090
254 Ga0237816_00156 3300039145 Bacteria 5355
255 Ga0439436_0002225 3300041404 Bacteria 5810
256 Ga0439436_0007475 3300041404 Bacteria 3362
257 Ga0439436_0050021 3300041404 Bacteria 1183
258 Ga0439439_0009285 3300041406 Bacteria 2337
259 Ga0439465_0001585 3300041413 Bacteria 7399
260 Ga0439465_0008517 3300041413 Bacteria 3235
261 Ga0439465_0019240 3300041413 Bacteria 2134
262 Ga0451791_0575675 3300041451 Bacteria 910
263 Ga0451791_1051936 3300041451 Bacteria 1628
264 Ga0451791_1563583 3300041451 Bacteria 960
265 Ga0451797_0868495 3300041453 Bacteria 2379
266 Ga0451795_0931470 3300041456 Bacteria 3313
267 Ga0451800_1094257 3300041459 Bacteria 821
268 Ga0451802_0888962 3300041460 Bacteria 2206
269 Ga0451837_0286247 3300041494 Bacteria 3560
270 Ga0451837_0287319 3300041494 Bacteria 3250
271 Ga0451837_0715346 3300041494 Bacteria 992
272 Ga0451837_1425707 3300041494 Bacteria 1310
273 Ga0451837_1433119 3300041494 Bacteria 736
274 Ga0451843_0668074 3300041509 Bacteria 4548
275 Ga0451843_0797652 3300041509 Bacteria 2577
276 Ga0439433_0037296 3300041999 Bacteria 1125
277 Ga0439445_0003037 3300042004 Bacteria 3757
278 Ga0439432_006342 3300042006 Bacteria 4232
279 Ga0439432_007168 3300042006 Bacteria 3961
280 Ga0439432_043705 3300042006 Bacteria 1413
281 Ga0439432_061718 3300042006 Bacteria 1155
282 Ga0439449_0000013 3300042007 Bacteria 51317
283 Ga0439449_0009784 3300042007 Bacteria 3628
284 Ga0439449_0015477 3300042007 Bacteria 2866
285 Ga0439449_0038828 3300042007 Bacteria 1769
286 Ga0439449_0040042 3300042007 Bacteria 1742
287 Ga0439452_053195 3300042010 Bacteria 922
288 Ga0439452_076503 3300042010 Bacteria 733
289 Ga0439462_0018807 3300042015 Bacteria 1796
290 Ga0439462_0023620 3300042015 Bacteria 1612
291 Ga0451577_0003004 3300042876 Bacteria 19220
292 Ga0466982_0000001 3300044672 Bacteria 514662
293 Ga0466965_0011261 3300044683 Bacteria 4187
294 Ga0466966_0002059 3300044684 Bacteria 13053
295 Ga0466963_0348606 3300044694 Bacteria 1043
296 Ga0466964_0000320 3300044706 Bacteria 14280
297 Ga0466971_0003669 3300044719 Bacteria 6567
298 Ga0466971_0161085 3300044719 Bacteria 1050
299 Ga0466968_0007097 3300044735 Bacteria 4250
300 Ga0466970_0003526 3300044765 Bacteria 7623
301 Ga0466960_0003961 3300044901 Bacteria 5751
302 Ga0466959_0051653 3300045049 Bacteria 3014
303 Ga0466958_0070620 3300045836 Bacteria 2137
304 Ga0495617_000040 3300046452 Bacteria 126637
305 Ga0495638_0001816 3300046460 Bacteria 18521
306 Ga0495638_0003661 3300046460 Bacteria 11979
307 Ga0495650_0000112 3300046471 Bacteria 197339
308 Ga0495585_0000024 3300046492 Bacteria 148384
309 Ga0495606_0001013 3300046507 Bacteria 40827
310 Ga0495620_0000117 3300046515 Bacteria 63752
311 Ga0495631_0000202 3300046518 Bacteria 40810
312 Ga0495648_0002357 3300046524 Bacteria 17541
313 Ga0495663_0000689 3300046525 Bacteria 11637
314 Ga0495663_0028079 3300046525 Bacteria 1654
315 Ga0495663_0055143 3300046525 Bacteria 1239
316 Ga0495663_0083635 3300046525 Bacteria 1031
317 Ga0495654_0046514 3300046530 Bacteria 2137
318 Ga0495598_0001993 3300046537 Bacteria 4150
319 Ga0495621_0000437 3300046539 Bacteria 10313
320 Ga0495621_0022469 3300046539 Bacteria 2091
321 Ga0495633_0055952 3300046558 Bacteria 1854
322 Ga0495656_0001709 3300046615 Bacteria 7191
323 Ga0495656_0027980 3300046615 Bacteria 2257
324 Ga0495656_0071264 3300046615 Bacteria 1544
325 Ga0495668_0054653 3300046616 Bacteria 2206
326 Ga0495625_0099515 3300046660 Bacteria 1999
327 Ga0495661_0000383 3300046665 Bacteria 47361
328 Ga0495671_0004581 3300046692 Bacteria 8228
329 Ga0495636_0050249 3300047318 Bacteria 1745
330 Ga0495636_0252778 3300047318 Bacteria 815
331 Ga0495686_0000050 3300047472 Bacteria 269010
332 Ga0495686_0000320 3300047472 Bacteria 79875
333 Ga0496101_0124030 3300048904 Bacteria 1956
334 Ga0496101_0172797 3300048904 Bacteria 1661
335 Ga0496102_0304792 3300048905 Bacteria 1501
336 Ga0496105_0020620 3300048908 Bacteria 5327
337 Ga0496106_0087678 3300048909 Bacteria 2398
338 Ga0496107_0201275 3300048910 Bacteria 1480
339 Ga0496108_0105710 3300048911 Bacteria 2403
340 Ga0496108_0344610 3300048911 Bacteria 1300
341 Ga0496109_0095371 3300048912 Bacteria 2754
342 Ga0496110_0379460 3300048913 Bacteria 1288
343 Ga0496111_0038768 3300048914 Bacteria 3414
344 Ga0496111_0295568 3300048914 Bacteria 1201
345 Ga0496112_0053999 3300048915 Bacteria 3947
346 Ga0496112_0317481 3300048915 Bacteria 1502
347 Ga0496114_0054716 3300048917 Bacteria 3328
348 Ga0496115_0031719 3300048918 Bacteria 4164
349 Ga0496116_0065659 3300048919 Bacteria 2326
350 Ga0496117_0000854 3300048920 Bacteria 47114
351 Ga0496117_0001593 3300048920 Bacteria 32105
352 Ga0496117_0009897 3300048920 Bacteria 8776
353 Ga0496117_0053884 3300048920 Bacteria 2822
354 Ga0496118_0000383 3300048921 Bacteria 74507
355 Ga0496118_0000815 3300048921 Bacteria 49685
356 Ga0496118_0001532 3300048921 Bacteria 34388
357 Ga0496118_0002149 3300048921 Bacteria 27507
358 Ga0496118_0010293 3300048921 Bacteria 9276
359 Ga0496119_0000069 3300048922 Bacteria 155265
360 Ga0496119_0000743 3300048922 Bacteria 43872
361 Ga0496120_0000110 3300048923 Bacteria 137494
362 Ga0496120_0000884 3300048923 Bacteria 42219
363 Ga0496121_0000914 3300048924 Bacteria 53289
364 Ga0496121_0017800 3300048924 Bacteria 7219
365 Ga0496121_0026661 3300048924 Bacteria 5434
366 Ga0496121_0027250 3300048924 Bacteria 5352
367 Ga0496122_0000710 3300048925 Bacteria 65728
368 Ga0496122_0007903 3300048925 Bacteria 11665
369 Ga0496122_0020535 3300048925 Bacteria 5960
370 Ga0496122_0047232 3300048925 Bacteria 3325
371 Ga0496122_0077200 3300048925 Bacteria 2340
372 Ga0496123_0000104 3300048926 Bacteria 168230
373 Ga0496123_0027054 3300048926 Bacteria 4280
374 Ga0496123_0027476 3300048926 Bacteria 4237
375 Ga0496124_0002024 3300048927 Bacteria 27560
376 Ga0496124_0076186 3300048927 Bacteria 2769
377 Ga0496124_0282352 3300048927 Bacteria 1209
378 Ga0496125_0001475 3300048928 Bacteria 34001
379 Ga0496125_0007560 3300048928 Bacteria 11542
380 Ga0496125_0009029 3300048928 Bacteria 10324
381 Ga0496126_0000913 3300048929 Bacteria 51086
382 Ga0496126_0015474 3300048929 Bacteria 7672
383 Ga0496126_0028614 3300048929 Bacteria 5307
384 Ga0496126_0118664 3300048929 Bacteria 2296
385 Ga0496126_0751526 3300048929 Bacteria 753
386 Ga0495678_032012 3300049459 Bacteria 2186
387 Ga0495682_0013382 3300049460 Bacteria 3125
388 Ga0501031_0102351 3300049568 Bacteria 1869
389 Ga0501031_0177667 3300049568 Bacteria 1391
390 Ga0501032_0085366 3300049569 Bacteria 2099
391 Ga0501033_0002068 3300049570 Bacteria 17441
392 Ga0501033_0057532 3300049570 Bacteria 2873
393 Ga0501033_0063951 3300049570 Bacteria 2707
394 Ga0501033_0211860 3300049570 Bacteria 1381
395 Ga0501033_0387983 3300049570 Bacteria 975
396 Ga0501034_0001232 3300049571 Bacteria 34779
397 Ga0501034_0001659 3300049571 Bacteria 28693
398 Ga0501034_0006335 3300049571 Bacteria 12743
399 Ga0501034_0019480 3300049571 Bacteria 6940
400 Ga0501034_0046067 3300049571 Bacteria 4406
401 Ga0501034_0070243 3300049571 Bacteria 3513
402 Ga0501036_0003593 3300049572 Bacteria 12398
403 Ga0501036_0411325 3300049572 Bacteria 1128
404 Ga0501036_0733381 3300049572 Bacteria 815
405 Ga0501037_0001197 3300049573 Bacteria 19151
406 Ga0501037_0090227 3300049573 Bacteria 2217
407 Ga0501038_0211709 3300049574 Bacteria 1550
408 Ga0501039_0011954 3300049575 Bacteria 6616
409 Ga0501039_0367322 3300049575 Bacteria 1130
410 Ga0501042_0235764 3300049578 Bacteria 1320
411 Ga0501043_0002746 3300049579 Bacteria 14723
412 Ga0501043_0011163 3300049579 Bacteria 7036
413 Ga0501043_0024440 3300049579 Bacteria 4741
414 Ga0501043_0040374 3300049579 Bacteria 3667
415 Ga0501046_0180725 3300049580 Bacteria 1577
416 Ga0501047_0003107 3300049581 Bacteria 15756
417 Ga0501047_0006742 3300049581 Bacteria 10794
418 Ga0501047_0007855 3300049581 Bacteria 10053
419 Ga0501047_0705886 3300049581 Bacteria 826
420 Ga0501048_0089217 3300049582 Bacteria 2175
421 Ga0501069_0111344 3300049585 Bacteria 1559
422 Ga0501070_0012714 3300049586 Bacteria 7099
423 Ga0501070_0035195 3300049586 Bacteria 4185
424 Ga0501070_0070149 3300049586 Bacteria 2902
425 Ga0501073_0075928 3300049589 Bacteria 2339
426 Ga0501216_011467 3300049660 Bacteria 1441
427 Ga0501250_014170 3300049680 Bacteria 965
428 Ga0501225_0004364 3300049705 Bacteria 4223
429 Ga0501079_0838458 3300049741 Bacteria 724
430 Ga0501080_0070855 3300049742 Bacteria 3242
431 Ga0501080_0087953 3300049742 Bacteria 2886
432 Ga0501080_0640139 3300049742 Bacteria 941
433 Ga0501275_002503 3300049772 Bacteria 1695
434 Ga0501035_0002247 3300049822 Bacteria 19119
435 Ga0501035_0021140 3300049822 Bacteria 5981
436 Ga0501035_0075685 3300049822 Bacteria 2977
437 Ga0501044_0002685 3300049823 Bacteria 20231
438 Ga0501044_0011081 3300049823 Bacteria 9779
439 Ga0501044_0374907 3300049823 Bacteria 1339
440 Ga0501044_0639605 3300049823 Bacteria 953
441 Ga0501044_0946717 3300049823 Bacteria 734
442 Ga0501045_0713473 3300049824 Bacteria 740
443 nmdc:mga00v17_37422_c1 3300050491 Bacteria 2898
444 nmdc:mga0yw44_229821_c1 3300050492 Bacteria 1231
445 Ga0500645_000260 3300053730 Bacteria 38177
446 Ga0466962_0039122 3300061719 Bacteria 2271
447 Ga0466962_0040549 3300061719 Bacteria 2228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10176456 Ga0157370_101764561 198
2 3300049570 Ga0501033_0057532 Ga0501033_0057532_890_1531 198
3 3300049571 Ga0501034_0019480 Ga0501034_0019480_1775_2416 198
4 3300049572 Ga0501036_0733381 Ga0501036_0733381_68_709 198
5 3300049575 Ga0501039_0011954 Ga0501039_0011954_3497_4138 198
6 3300049578 Ga0501042_0235764 Ga0501042_0235764_102_743 198
7 3300049580 Ga0501046_0180725 Ga0501046_0180725_90_731 198
8 3300049586 Ga0501070_0035195 Ga0501070_0035195_380_1021 198
9 3300049589 Ga0501073_0075928 Ga0501073_0075928_151_792 198
10 3300049741 Ga0501079_0838458 Ga0501079_0838458_68_709 198
11 3300049823 Ga0501044_0639605 Ga0501044_0639605_93_734 198
12 3300049824 Ga0501045_0713473 Ga0501045_0713473_13_654 198
13 iso_pu_bacteria 2643221559 2643815418 206
14 iso_pu_bacteria 2643221573 2643881902 206
15 iso_pu_bacteria 2643221586 2643941293 206
16 iso_pu_bacteria 2643221612 2644079643 206
17 iso_pu_bacteria 2643221720 2644662942 206
18 iso_pu_bacteria 2643221727 2644696207 206
19 iso_pu_bacteria 2643221728 2644699900 206
20 iso_pu_bacteria 2571042365 2572254985 207
21 iso_pu_bacteria 2576861471 2578457139 207
22 iso_pu_bacteria 2643221579 2643909270 207
23 iso_pu_bacteria 2643221593 2643973736 207
24 iso_pu_bacteria 2643221695 2644530704 207
25 iso_pu_bacteria 2687453130 2687584536 207
26 iso_pu_bacteria 2852649853 2852652280 207
27 iso_pu_bacteria 2857442823 2857445719 207
28 iso_pu_bacteria 2894414249 2894414735 207
29 iso_pu_bacteria 2923516293 2923517314 207
30 iso_pu_bacteria 2939622612 2939624259 207
31 iso_pu_bacteria 2941475908 2941478897 207
32 iso_pu_bacteria 2987605356 2987608626 207
33 iso_pu_bacteria 8002869464 8002871055 207
34 iso_pu_bacteria 8003014200 8003017033 207
35 3300005347 Ga0070668_100007597 Ga0070668_1000075977 208
36 3300025972 Ga0207668_10005933 Ga0207668_1000593310 208
37 iso_pu_bacteria 2565956521 2566036479 208
38 iso_pu_bacteria 2648501241 2649121321 208
39 iso_pu_bacteria 2651869818 2652974562 208
40 iso_pu_bacteria 2928963466 2928965378 208
41 3300042007 Ga0439449_0040042 Ga0439449_0040042_1073_1720 209
42 iso_pu_bacteria 2939611941 2939613114 209
43 3300003187 JGI25151J46595_10000116 JGI25151J46595_1000011688 210
44 3300003187 JGI25151J46595_10079667 JGI25151J46595_100796671 210
45 3300003320 rootH2_10191190 rootH2_101911902 210
46 3300003775 Ga0055524_1011809 Ga0055524_10118093 210
47 3300003781 Ga0055536_1001527 Ga0055536_10015274 210
48 3300003781 Ga0055536_1008245 Ga0055536_10082454 210
49 3300003781 Ga0055536_1009818 Ga0055536_10098183 210
50 3300003781 Ga0055536_1014126 Ga0055536_10141262 210
51 3300003791 Ga0055530_10001387 Ga0055530_100013874 210
52 3300003794 Ga0055531_10002056 Ga0055531_1000205614 210
53 3300003794 Ga0055531_10012741 Ga0055531_100127414 210
54 3300003794 Ga0055531_10013009 Ga0055531_100130093 210
55 3300003794 Ga0055531_10014596 Ga0055531_100145965 210
56 3300003794 Ga0055531_10020691 Ga0055531_100206911 210
57 3300005288 Ga0065714_10099633 Ga0065714_100996333 210
58 3300005289 Ga0065704_10000819 Ga0065704_100008191 210
59 3300005289 Ga0065704_10101469 Ga0065704_101014692 210
60 3300005293 Ga0065715_10012881 Ga0065715_100128813 210
61 3300005293 Ga0065715_10101061 Ga0065715_101010613 210
62 3300005293 Ga0065715_10247666 Ga0065715_102476662 210
63 3300005331 Ga0070670_100026589 Ga0070670_1000265893 210
64 3300005331 Ga0070670_100162976 Ga0070670_1001629762 210
65 3300005335 Ga0070666_10496087 Ga0070666_104960871 210
66 3300005339 Ga0070660_100564256 Ga0070660_1005642561 210
67 3300005353 Ga0070669_100122576 Ga0070669_1001225763 210
68 3300005354 Ga0070675_100354365 Ga0070675_1003543651 210
69 3300005355 Ga0070671_100019167 Ga0070671_1000191671 210
70 3300005355 Ga0070671_100177377 Ga0070671_1001773772 210
71 3300005356 Ga0070674_100025257 Ga0070674_1000252573 210
72 3300005364 Ga0070673_100265398 Ga0070673_1002653982 210
73 3300005364 Ga0070673_100675715 Ga0070673_1006757151 210
74 3300005367 Ga0070667_100258096 Ga0070667_1002580963 210
75 3300005530 Ga0070679_100427001 Ga0070679_1004270011 210
76 3300005543 Ga0070672_100061192 Ga0070672_1000611922 210
77 3300005564 Ga0070664_100460941 Ga0070664_1004609411 210
78 3300005618 Ga0068864_100038345 Ga0068864_1000383453 210
79 3300005719 Ga0068861_100243507 Ga0068861_1002435073 210
80 3300006038 Ga0075365_10106405 Ga0075365_101064052 210
81 3300006038 Ga0075365_10381778 Ga0075365_103817781 210
82 3300009036 Ga0105244_10170084 Ga0105244_101700842 210
83 3300009176 Ga0105242_10120837 Ga0105242_101208373 210
84 3300009177 Ga0105248_10243142 Ga0105248_102431422 210
85 3300009993 Ga0105028_101393 Ga0105028_1013932 210
86 3300012482 Ga0157318_1003931 Ga0157318_10039312 210
87 3300013102 Ga0157371_10000184 Ga0157371_1000018439 210
88 3300013102 Ga0157371_10012570 Ga0157371_100125706 210
89 3300013102 Ga0157371_10100030 Ga0157371_101000301 210
90 3300013104 Ga0157370_10004081 Ga0157370_1000408111 210
91 3300013105 Ga0157369_10022776 Ga0157369_100227766 210
92 3300013306 Ga0163162_10213689 Ga0163162_102136893 210
93 3300013306 Ga0163162_10309047 Ga0163162_103090471 210
94 3300013307 Ga0157372_10431720 Ga0157372_104317203 210
95 3300014326 Ga0157380_10020180 Ga0157380_100201806 210
96 3300014497 Ga0182008_10000939 Ga0182008_1000093918 210
97 3300014497 Ga0182008_10043757 Ga0182008_100437572 210
98 3300015261 Ga0182006_1006571 Ga0182006_10065716 210
99 3300015261 Ga0182006_1033551 Ga0182006_10335511 210
100 3300015262 Ga0182007_10000118 Ga0182007_1000011823 210
101 3300015265 Ga0182005_1000268 Ga0182005_100026815 210
102 3300017792 Ga0163161_10000766 Ga0163161_1000076625 210
103 3300017792 Ga0163161_10078295 Ga0163161_100782952 210
104 3300017792 Ga0163161_10200901 Ga0163161_102009012 210
105 3300025245 Ga0207425_1001522 Ga0207425_10015223 210
106 3300025273 Ga0209673_1004508 Ga0209673_10045086 210
107 3300025284 Ga0209130_1004089 Ga0209130_10040892 210
108 3300025284 Ga0209130_1009164 Ga0209130_10091645 210
109 3300025291 Ga0209675_1008699 Ga0209675_10086993 210
110 3300025292 Ga0209676_1000027 Ga0209676_1000027418 210
111 3300025292 Ga0209676_1000796 Ga0209676_100079617 210
112 3300025292 Ga0209676_1008927 Ga0209676_10089275 210
113 3300025292 Ga0209676_1009833 Ga0209676_10098333 210
114 3300025292 Ga0209676_1009939 Ga0209676_10099393 210
115 3300025292 Ga0209676_1010242 Ga0209676_10102424 210
116 3300025294 Ga0209025_1000023 Ga0209025_1000023440 210
117 3300025294 Ga0209025_1030426 Ga0209025_10304263 210
118 3300025294 Ga0209025_1045514 Ga0209025_10455142 210
119 3300025295 Ga0209564_1009492 Ga0209564_10094924 210
120 3300025297 Ga0209758_1007000 Ga0209758_10070005 210
121 3300025297 Ga0209758_1032943 Ga0209758_10329433 210
122 3300025298 Ga0209050_1002178 Ga0209050_10021783 210
123 3300025298 Ga0209050_1041499 Ga0209050_10414992 210
124 3300025299 Ga0209256_1000825 Ga0209256_100082535 210
125 3300025299 Ga0209256_1001572 Ga0209256_10015727 210
126 3300025304 Ga0209257_1000046 Ga0209257_1000046136 210
127 3300025304 Ga0209257_1000198 Ga0209257_10001983 210
128 3300025304 Ga0209257_1002904 Ga0209257_10029044 210
129 3300025304 Ga0209257_1010645 Ga0209257_10106453 210
130 3300025304 Ga0209257_1012481 Ga0209257_10124813 210
131 3300025304 Ga0209257_1012637 Ga0209257_10126373 210
132 3300025908 Ga0207643_10425327 Ga0207643_104253271 210
133 3300025919 Ga0207657_10088666 Ga0207657_100886664 210
134 3300025919 Ga0207657_10486106 Ga0207657_104861061 210
135 3300025921 Ga0207652_10257611 Ga0207652_102576111 210
136 3300025923 Ga0207681_10125321 Ga0207681_101253213 210
137 3300025925 Ga0207650_10098513 Ga0207650_100985133 210
138 3300025925 Ga0207650_10170327 Ga0207650_101703272 210
139 3300025931 Ga0207644_10012724 Ga0207644_100127243 210
140 3300025937 Ga0207669_10043720 Ga0207669_100437204 210
141 3300025940 Ga0207691_10052571 Ga0207691_100525713 210
142 3300025945 Ga0207679_10258838 Ga0207679_102588382 210
143 3300025960 Ga0207651_10317708 Ga0207651_103177082 210
144 3300026088 Ga0207641_10401155 Ga0207641_104011552 210
145 3300027360 Ga0209969_1009644 Ga0209969_10096441 210
146 3300027462 Ga0210000_1001273 Ga0210000_10012731 210
147 3300027526 Ga0209968_1036384 Ga0209968_10363842 210
148 3300027552 Ga0209982_1009860 Ga0209982_10098603 210
149 3300027665 Ga0209983_1002456 Ga0209983_10024566 210
150 3300027682 Ga0209971_1004124 Ga0209971_10041241 210
151 3300027876 Ga0209974_10011227 Ga0209974_100112273 210
152 3300027876 Ga0209974_10016927 Ga0209974_100169273 210
153 3300028379 Ga0268266_10226626 Ga0268266_102266262 210
154 3300030731 Ga0316177_1175300 Ga0316177_11753003 210
155 3300030732 Ga0316176_1023789 Ga0316176_10237892 210
156 3300030733 Ga0314311_1000677 Ga0314311_10006779 210
157 3300030733 Ga0314311_1232034 Ga0314311_12320343 210
158 3300030744 Ga0316181_1178398 Ga0316181_11783981 210
159 3300031456 Ga0307513_10027272 Ga0307513_100272723 210
160 3300031456 Ga0307513_10295518 Ga0307513_102955183 210
161 3300031548 Ga0307408_100023984 Ga0307408_1000239846 210
162 3300031548 Ga0307408_100063368 Ga0307408_1000633681 210
163 3300031548 Ga0307408_100273830 Ga0307408_1002738303 210
164 3300031548 Ga0307408_100405045 Ga0307408_1004050451 210
165 3300031731 Ga0307405_10043761 Ga0307405_100437615 210
166 3300031731 Ga0307405_10691062 Ga0307405_106910622 210
167 3300031731 Ga0307405_10766118 Ga0307405_107661182 210
168 3300031731 Ga0307405_10903611 Ga0307405_109036111 210
169 3300031824 Ga0307413_10019020 Ga0307413_100190206 210
170 3300031824 Ga0307413_10071304 Ga0307413_100713042 210
171 3300031824 Ga0307413_10134892 Ga0307413_101348923 210
172 3300031824 Ga0307413_10177546 Ga0307413_101775461 210
173 3300031824 Ga0307413_10196475 Ga0307413_101964753 210
174 3300031824 Ga0307413_10691213 Ga0307413_106912132 210
175 3300031852 Ga0307410_10045344 Ga0307410_100453444 210
176 3300031852 Ga0307410_10087531 Ga0307410_100875312 210
177 3300031852 Ga0307410_10374562 Ga0307410_103745622 210
178 3300031852 Ga0307410_10459374 Ga0307410_104593741 210
179 3300031901 Ga0307406_10074879 Ga0307406_100748791 210
180 3300031901 Ga0307406_10099739 Ga0307406_100997392 210
181 3300031901 Ga0307406_10107524 Ga0307406_101075244 210
182 3300031911 Ga0307412_10126628 Ga0307412_101266282 210
183 3300031911 Ga0307412_10135404 Ga0307412_101354041 210
184 3300031911 Ga0307412_10361636 Ga0307412_103616362 210
185 3300031995 Ga0307409_100542174 Ga0307409_1005421742 210
186 3300032002 Ga0307416_100424312 Ga0307416_1004243122 210
187 3300032002 Ga0307416_100712612 Ga0307416_1007126122 210
188 3300032004 Ga0307414_10005380 Ga0307414_100053803 210
189 3300032004 Ga0307414_10068551 Ga0307414_100685513 210
190 3300032004 Ga0307414_10083964 Ga0307414_100839642 210
191 3300032004 Ga0307414_10096892 Ga0307414_100968921 210
192 3300032004 Ga0307414_10101919 Ga0307414_101019194 210
193 3300032004 Ga0307414_10131613 Ga0307414_101316132 210
194 3300032004 Ga0307414_10155702 Ga0307414_101557023 210
195 3300032004 Ga0307414_10182223 Ga0307414_101822233 210
196 3300032004 Ga0307414_10515459 Ga0307414_105154592 210
197 3300032004 Ga0307414_10763553 Ga0307414_107635531 210
198 3300032005 Ga0307411_10095763 Ga0307411_100957631 210
199 3300032005 Ga0307411_10202849 Ga0307411_102028491 210
200 3300032005 Ga0307411_10365438 Ga0307411_103654382 210
201 3300032005 Ga0307411_10550477 Ga0307411_105504772 210
202 3300032126 Ga0307415_100311801 Ga0307415_1003118012 210
203 3300032168 Ga0316593_10010814 Ga0316593_100108142 210
204 3300037312 Ga0395899_0090731 Ga0395899_0090731_208_858 210
205 3300037418 Ga0395900_0059445 Ga0395900_0059445_2506_3153 210
206 3300037418 Ga0395900_0119331 Ga0395900_0119331_1547_2197 210
207 3300037471 Ga0395905_0140970 Ga0395905_0140970_1256_1906 210
208 3300037471 Ga0395905_0208059 Ga0395905_0208059_1154_1801 210
209 3300039062 Ga0400483_067590 Ga0400483_067590_47244_47900 210
210 3300041404 Ga0439436_0002225 Ga0439436_0002225_2146_2793 210
211 3300041404 Ga0439436_0007475 Ga0439436_0007475_2503_3165 210
212 3300041404 Ga0439436_0050021 Ga0439436_0050021_452_1099 210
213 3300041406 Ga0439439_0009285 Ga0439439_0009285_498_1145 210
214 3300041413 Ga0439465_0001585 Ga0439465_0001585_1332_1985 210
215 3300041413 Ga0439465_0008517 Ga0439465_0008517_2550_3203 210
216 3300041413 Ga0439465_0019240 Ga0439465_0019240_592_1254 210
217 3300041451 Ga0451791_0575675 Ga0451791_0575675_193_846 210
218 3300041451 Ga0451791_1051936 Ga0451791_1051936_180_833 210
219 3300041451 Ga0451791_1563583 Ga0451791_1563583_179_826 210
220 3300041453 Ga0451797_0868495 Ga0451797_0868495_1358_2005 210
221 3300041456 Ga0451795_0931470 Ga0451795_0931470_762_1415 210
222 3300041459 Ga0451800_1094257 Ga0451800_1094257_11_664 210
223 3300041460 Ga0451802_0888962 Ga0451802_0888962_159_812 210
224 3300041494 Ga0451837_0286247 Ga0451837_0286247_1640_2287 210
225 3300041494 Ga0451837_0287319 Ga0451837_0287319_1330_1977 210
226 3300041494 Ga0451837_0715346 Ga0451837_0715346_310_963 210
227 3300041494 Ga0451837_1425707 Ga0451837_1425707_12_659 210
228 3300041494 Ga0451837_1433119 Ga0451837_1433119_73_720 210
229 3300041509 Ga0451843_0668074 Ga0451843_0668074_1214_1861 210
230 3300041509 Ga0451843_0797652 Ga0451843_0797652_490_1161 210
231 3300041999 Ga0439433_0037296 Ga0439433_0037296_392_1045 210
232 3300042004 Ga0439445_0003037 Ga0439445_0003037_2520_3188 210
233 3300042006 Ga0439432_006342 Ga0439432_006342_2501_3148 210
234 3300042006 Ga0439432_007168 Ga0439432_007168_2477_3124 210
235 3300042006 Ga0439432_043705 Ga0439432_043705_316_963 210
236 3300042006 Ga0439432_061718 Ga0439432_061718_314_961 210
237 3300042007 Ga0439449_0000013 Ga0439449_0000013_32665_33318 210
238 3300042007 Ga0439449_0009784 Ga0439449_0009784_2832_3479 210
239 3300042007 Ga0439449_0015477 Ga0439449_0015477_1525_2172 210
240 3300042007 Ga0439449_0038828 Ga0439449_0038828_473_1126 210
241 3300042010 Ga0439452_053195 Ga0439452_053195_52_714 210
242 3300042015 Ga0439462_0018807 Ga0439462_0018807_393_1055 210
243 3300042015 Ga0439462_0023620 Ga0439462_0023620_447_1094 210
244 3300042876 Ga0451577_0003004 Ga0451577_0003004_10863_11510 210
245 3300046460 Ga0495638_0001816 Ga0495638_0001816_3171_3818 210
246 3300046525 Ga0495663_0000689 Ga0495663_0000689_7987_8640 210
247 3300046525 Ga0495663_0028079 Ga0495663_0028079_334_981 210
248 3300046525 Ga0495663_0055143 Ga0495663_0055143_436_1083 210
249 3300046525 Ga0495663_0083635 Ga0495663_0083635_231_878 210
250 3300046537 Ga0495598_0001993 Ga0495598_0001993_771_1418 210
251 3300046539 Ga0495621_0000437 Ga0495621_0000437_4202_4849 210
252 3300046539 Ga0495621_0022469 Ga0495621_0022469_574_1221 210
253 3300046558 Ga0495633_0055952 Ga0495633_0055952_692_1339 210
254 3300046615 Ga0495656_0001709 Ga0495656_0001709_2801_3448 210
255 3300046615 Ga0495656_0027980 Ga0495656_0027980_986_1648 210
256 3300046615 Ga0495656_0071264 Ga0495656_0071264_717_1364 210
257 3300046616 Ga0495668_0054653 Ga0495668_0054653_574_1221 210
258 3300046692 Ga0495671_0004581 Ga0495671_0004581_2276_2929 210
259 3300047318 Ga0495636_0050249 Ga0495636_0050249_981_1628 210
260 3300047318 Ga0495636_0252778 Ga0495636_0252778_142_804 210
261 3300048904 Ga0496101_0124030 Ga0496101_0124030_1224_1874 210
262 3300048904 Ga0496101_0172797 Ga0496101_0172797_888_1535 210
263 3300048910 Ga0496107_0201275 Ga0496107_0201275_814_1461 210
264 3300048911 Ga0496108_0105710 Ga0496108_0105710_689_1336 210
265 3300048911 Ga0496108_0344610 Ga0496108_0344610_160_816 210
266 3300048912 Ga0496109_0095371 Ga0496109_0095371_965_1615 210
267 3300048913 Ga0496110_0379460 Ga0496110_0379460_284_934 210
268 3300048914 Ga0496111_0038768 Ga0496111_0038768_83_730 210
269 3300048914 Ga0496111_0295568 Ga0496111_0295568_350_997 210
270 3300048915 Ga0496112_0053999 Ga0496112_0053999_2148_2795 210
271 3300048915 Ga0496112_0317481 Ga0496112_0317481_140_796 210
272 3300048919 Ga0496116_0065659 Ga0496116_0065659_279_926 210
273 3300048920 Ga0496117_0000854 Ga0496117_0000854_31697_32344 210
274 3300048920 Ga0496117_0001593 Ga0496117_0001593_12392_13039 210
275 3300048921 Ga0496118_0000383 Ga0496118_0000383_59082_59729 210
276 3300048921 Ga0496118_0002149 Ga0496118_0002149_7794_8441 210
277 3300048921 Ga0496118_0010293 Ga0496118_0010293_1265_1912 210
278 3300048922 Ga0496119_0000069 Ga0496119_0000069_11993_12640 210
279 3300048923 Ga0496120_0000884 Ga0496120_0000884_20953_21600 210
280 3300048924 Ga0496121_0026661 Ga0496121_0026661_3281_3928 210
281 3300048924 Ga0496121_0027250 Ga0496121_0027250_2782_3429 210
282 3300048925 Ga0496122_0000710 Ga0496122_0000710_30647_31294 210
283 3300048925 Ga0496122_0007903 Ga0496122_0007903_180_827 210
284 3300048925 Ga0496122_0020535 Ga0496122_0020535_2421_3074 210
285 3300048925 Ga0496122_0077200 Ga0496122_0077200_589_1236 210
286 3300048926 Ga0496123_0000104 Ga0496123_0000104_136930_137577 210
287 3300048926 Ga0496123_0027054 Ga0496123_0027054_98_745 210
288 3300048926 Ga0496123_0027476 Ga0496123_0027476_430_1077 210
289 3300048927 Ga0496124_0002024 Ga0496124_0002024_20533_21180 210
290 3300048927 Ga0496124_0076186 Ga0496124_0076186_712_1359 210
291 3300048927 Ga0496124_0282352 Ga0496124_0282352_55_702 210
292 3300048928 Ga0496125_0001475 Ga0496125_0001475_14092_14739 210
293 3300048928 Ga0496125_0009029 Ga0496125_0009029_2533_3180 210
294 3300048929 Ga0496126_0000913 Ga0496126_0000913_20959_21606 210
295 3300048929 Ga0496126_0751526 Ga0496126_0751526_38_685 210
296 3300049568 Ga0501031_0102351 Ga0501031_0102351_409_1056 210
297 3300049568 Ga0501031_0177667 Ga0501031_0177667_244_891 210
298 3300049569 Ga0501032_0085366 Ga0501032_0085366_279_926 210
299 3300049570 Ga0501033_0002068 Ga0501033_0002068_1422_2069 210
300 3300049570 Ga0501033_0211860 Ga0501033_0211860_589_1236 210
301 3300049570 Ga0501033_0387983 Ga0501033_0387983_301_936 210
302 3300049571 Ga0501034_0001232 Ga0501034_0001232_817_1464 210
303 3300049571 Ga0501034_0001659 Ga0501034_0001659_11066_11716 210
304 3300049571 Ga0501034_0006335 Ga0501034_0006335_10219_10866 210
305 3300049571 Ga0501034_0046067 Ga0501034_0046067_3363_4010 210
306 3300049571 Ga0501034_0070243 Ga0501034_0070243_502_1149 210
307 3300049572 Ga0501036_0003593 Ga0501036_0003593_11686_12333 210
308 3300049573 Ga0501037_0001197 Ga0501037_0001197_1783_2430 210
309 3300049575 Ga0501039_0367322 Ga0501039_0367322_389_1036 210
310 3300049579 Ga0501043_0002746 Ga0501043_0002746_13498_14160 210
311 3300049579 Ga0501043_0024440 Ga0501043_0024440_149_796 210
312 3300049581 Ga0501047_0003107 Ga0501047_0003107_1369_2016 210
313 3300049581 Ga0501047_0705886 Ga0501047_0705886_154_801 210
314 3300049582 Ga0501048_0089217 Ga0501048_0089217_477_1112 210
315 3300049586 Ga0501070_0070149 Ga0501070_0070149_1300_1959 210
316 3300049660 Ga0501216_011467 Ga0501216_011467_297_944 210
317 3300049680 Ga0501250_014170 Ga0501250_014170_83_730 210
318 3300049705 Ga0501225_0004364 Ga0501225_0004364_980_1648 210
319 3300049742 Ga0501080_0070855 Ga0501080_0070855_1311_1970 210
320 3300049742 Ga0501080_0087953 Ga0501080_0087953_149_796 210
321 3300049772 Ga0501275_002503 Ga0501275_002503_76_723 210
322 3300049822 Ga0501035_0002247 Ga0501035_0002247_18261_18908 210
323 3300049822 Ga0501035_0075685 Ga0501035_0075685_860_1495 210
324 3300049823 Ga0501044_0002685 Ga0501044_0002685_1620_2267 210
325 3300049823 Ga0501044_0946717 Ga0501044_0946717_33_668 210
326 3300050491 nmdc:mga00v17_37422_c1 nmdc:mga00v17_37422_c1_959_1606 210
327 3300050492 nmdc:mga0yw44_229821_c1 nmdc:mga0yw44_229821_c1_218_865 210
328 3300003316 rootH1_10017020 rootH1_100170205 211
329 3300005262 Ga0065165_1005913 Ga0065165_10059135 211
330 3300005614 Ga0068856_100463038 Ga0068856_1004630381 211
331 3300005840 Ga0068870_10040489 Ga0068870_100404892 211
332 3300009093 Ga0105240_10603465 Ga0105240_106034652 211
333 3300025908 Ga0207643_10053842 Ga0207643_100538423 211
334 3300025913 Ga0207695_10330715 Ga0207695_103307152 211
335 3300025921 Ga0207652_10556032 Ga0207652_105560321 211
336 3300026078 Ga0207702_10211717 Ga0207702_102117173 211
337 3300037312 Ga0395899_0031315 Ga0395899_0031315_2964_3599 211
338 3300002737 JGI25162J39368_1003181 JGI25162J39368_10031816 212
339 3300002772 JGI25164J39214_1011555 JGI25164J39214_10115551 212
340 3300003320 rootH2_10304705 rootH2_103047051 212
341 3300003762 Ga0055542_1003204 Ga0055542_10032043 212
342 3300005340 Ga0070689_100003694 Ga0070689_10000369411 212
343 3300005843 Ga0068860_100033574 Ga0068860_1000335743 212
344 3300005844 Ga0068862_100119895 Ga0068862_1001198952 212
345 3300013306 Ga0163162_10117995 Ga0163162_101179952 212
346 3300013307 Ga0157372_10097701 Ga0157372_100977013 212
347 3300014497 Ga0182008_10070910 Ga0182008_100709102 212
348 3300025228 Ga0209672_101302 Ga0209672_10130210 212
349 3300025231 Ga0207427_103199 Ga0207427_1031993 212
350 3300025233 Ga0209437_100141 Ga0209437_10014186 212
351 3300025242 Ga0209258_103456 Ga0209258_1034563 212
352 3300025246 Ga0209646_1010018 Ga0209646_10100182 212
353 3300025254 Ga0209148_1000002 Ga0209148_1000002695 212
354 3300025261 Ga0209233_1020570 Ga0209233_10205702 212
355 3300025272 Ga0209455_1007088 Ga0209455_10070882 212
356 3300025912 Ga0207707_10063244 Ga0207707_100632442 212
357 3300025924 Ga0207694_10030416 Ga0207694_100304162 212
358 3300025924 Ga0207694_11024817 Ga0207694_110248171 212
359 3300025936 Ga0207670_10002104 Ga0207670_1000210411 212
360 3300028381 Ga0268264_10034678 Ga0268264_100346785 212
361 3300037312 Ga0395899_0027423 Ga0395899_0027423_997_1635 212
362 3300037312 Ga0395899_0050700 Ga0395899_0050700_1233_1871 212
363 3300037312 Ga0395899_0076738 Ga0395899_0076738_1682_2320 212
364 3300037312 Ga0395899_0382239 Ga0395899_0382239_211_849 212
365 3300037418 Ga0395900_0001940 Ga0395900_0001940_4324_4962 212
366 3300037418 Ga0395900_0108099 Ga0395900_0108099_1409_2047 212
367 3300037418 Ga0395900_0109820 Ga0395900_0109820_1560_2198 212
368 3300037466 Ga0395898_0024295 Ga0395898_0024295_5040_5678 212
369 3300037466 Ga0395898_0027286 Ga0395898_0027286_3682_4320 212
370 3300037466 Ga0395898_0059238 Ga0395898_0059238_1768_2406 212
371 3300037466 Ga0395898_0107788 Ga0395898_0107788_338_976 212
372 3300037471 Ga0395905_0075455 Ga0395905_0075455_1259_1897 212
373 3300038443 Ga0395901_0000267 Ga0395901_0000267_2394_3032 212
374 3300038443 Ga0395901_0045587 Ga0395901_0045587_835_1473 212
375 3300038443 Ga0395901_0112681 Ga0395901_0112681_810_1448 212
376 3300038735 Ga0400485_20364 Ga0400485_20364_1771_2460 212
377 3300044672 Ga0466982_0000001 Ga0466982_0000001_73117_73755 212
378 3300044683 Ga0466965_0011261 Ga0466965_0011261_2687_3325 212
379 3300044684 Ga0466966_0002059 Ga0466966_0002059_7789_8427 212
380 3300044694 Ga0466963_0348606 Ga0466963_0348606_108_746 212
381 3300044706 Ga0466964_0000320 Ga0466964_0000320_4835_5473 212
382 3300044719 Ga0466971_0003669 Ga0466971_0003669_39_677 212
383 3300044765 Ga0466970_0003526 Ga0466970_0003526_6129_6767 212
384 3300044901 Ga0466960_0003961 Ga0466960_0003961_2115_2753 212
385 3300045049 Ga0466959_0051653 Ga0466959_0051653_1355_1993 212
386 3300046460 Ga0495638_0003661 Ga0495638_0003661_2278_2916 212
387 3300046471 Ga0495650_0000112 Ga0495650_0000112_84441_85079 212
388 3300048908 Ga0496105_0020620 Ga0496105_0020620_4514_5155 212
389 3300048917 Ga0496114_0054716 Ga0496114_0054716_1695_2333 212
390 3300048918 Ga0496115_0031719 Ga0496115_0031719_2253_2891 212
391 3300048922 Ga0496119_0000743 Ga0496119_0000743_4685_5326 212
392 3300048923 Ga0496120_0000110 Ga0496120_0000110_4522_5163 212
393 3300048929 Ga0496126_0015474 Ga0496126_0015474_6445_7083 212
394 3300048929 Ga0496126_0028614 Ga0496126_0028614_1415_2053 212
395 3300049459 Ga0495678_032012 Ga0495678_032012_388_1026 212
396 3300049570 Ga0501033_0063951 Ga0501033_0063951_183_821 212
397 3300049572 Ga0501036_0411325 Ga0501036_0411325_130_768 212
398 3300049573 Ga0501037_0090227 Ga0501037_0090227_597_1235 212
399 3300049574 Ga0501038_0211709 Ga0501038_0211709_723_1361 212
400 3300049579 Ga0501043_0011163 Ga0501043_0011163_4830_5468 212
401 3300049581 Ga0501047_0006742 Ga0501047_0006742_5403_6047 212
402 3300049581 Ga0501047_0007855 Ga0501047_0007855_7104_7742 212
403 3300049822 Ga0501035_0021140 Ga0501035_0021140_1135_1773 212
404 3300049823 Ga0501044_0011081 Ga0501044_0011081_4074_4712 212
405 3300061719 Ga0466962_0039122 Ga0466962_0039122_832_1470 212
406 3300002741 JGI25157J39369_1000680 JGI25157J39369_10006805 213
407 3300005329 Ga0070683_100954254 Ga0070683_1009542541 213
408 3300005436 Ga0070713_100001431 Ga0070713_10000143113 213
409 3300005437 Ga0070710_10099902 Ga0070710_100999022 213
410 3300005539 Ga0068853_100632618 Ga0068853_1006326181 213
411 3300005563 Ga0068855_100022053 Ga0068855_1000220537 213
412 3300005577 Ga0068857_100238494 Ga0068857_1002384942 213
413 3300009551 Ga0105238_10014165 Ga0105238_100141655 213
414 3300009993 Ga0105028_101755 Ga0105028_1017553 213
415 3300013100 Ga0157373_10173577 Ga0157373_101735772 213
416 3300013102 Ga0157371_10028784 Ga0157371_100287842 213
417 3300013104 Ga0157370_10041258 Ga0157370_100412583 213
418 3300015261 Ga0182006_1018874 Ga0182006_10188742 213
419 3300015262 Ga0182007_10015286 Ga0182007_100152862 213
420 3300025898 Ga0207692_10173327 Ga0207692_101733272 213
421 3300025915 Ga0207693_10265031 Ga0207693_102650313 213
422 3300025924 Ga0207694_10011437 Ga0207694_100114372 213
423 3300025929 Ga0207664_10001014 Ga0207664_1000101415 213
424 3300025949 Ga0207667_10014308 Ga0207667_100143086 213
425 3300026041 Ga0207639_10004309 Ga0207639_100043096 213
426 3300026088 Ga0207641_10956052 Ga0207641_109560521 213
427 3300026116 Ga0207674_10103505 Ga0207674_101035052 213
428 3300037418 Ga0395900_0000049 Ga0395900_0000049_3726_4424 213
429 3300037466 Ga0395898_0000110 Ga0395898_0000110_119972_120685 213
430 3300039145 Ga0237816_00156 Ga0237816_00156_533_1195 213
431 3300042010 Ga0439452_076503 Ga0439452_076503_29_679 213
432 3300044719 Ga0466971_0161085 Ga0466971_0161085_84_725 213
433 3300045836 Ga0466958_0070620 Ga0466958_0070620_535_1248 213
434 3300046530 Ga0495654_0046514 Ga0495654_0046514_1205_1864 213
435 3300049579 Ga0501043_0040374 Ga0501043_0040374_1674_2372 213
436 3300049585 Ga0501069_0111344 Ga0501069_0111344_745_1389 213
437 3300049586 Ga0501070_0012714 Ga0501070_0012714_2509_3153 213
438 3300049742 Ga0501080_0640139 Ga0501080_0640139_49_693 213
439 3300049823 Ga0501044_0374907 Ga0501044_0374907_16_657 213
440 3300061719 Ga0466962_0040549 Ga0466962_0040549_1460_2101 213
441 iso_pu_bacteria 2718218334 2721029107 213
442 iso_pu_bacteria 2818991440 2819565035 213
443 iso_pu_bacteria 2884338543 2884342297 213
444 iso_pu_bacteria 2904463128 2904465440 213
445 iso_pu_bacteria 2941471342 2941474758 213
446 3300001904 JGI24736J21556_1001578 JGI24736J21556_10015785 217
447 3300001979 JGI24740J21852_10040373 JGI24740J21852_100403731 217
448 3300002075 JGI24738J21930_10000012 JGI24738J21930_1000001240 217
449 3300009101 Ga0105247_10007364 Ga0105247_100073643 217
450 3300013105 Ga0157369_10011591 Ga0157369_100115917 217
451 3300015265 Ga0182005_1017460 Ga0182005_10174603 217
452 3300015265 Ga0182005_1057370 Ga0182005_10573702 217
453 3300025229 Ga0209147_104663 Ga0209147_1046632 217
454 3300025904 Ga0207647_10000005 Ga0207647_10000005163 217
455 3300026067 Ga0207678_10308272 Ga0207678_103082721 217
456 3300044735 Ga0466968_0007097 Ga0466968_0007097_1395_2054 217
457 3300046452 Ga0495617_000040 Ga0495617_000040_36128_36784 217
458 3300046492 Ga0495585_0000024 Ga0495585_0000024_74029_74685 217
459 3300046507 Ga0495606_0001013 Ga0495606_0001013_13208_13864 217
460 3300046515 Ga0495620_0000117 Ga0495620_0000117_56374_57030 217
461 3300046518 Ga0495631_0000202 Ga0495631_0000202_8291_8947 217
462 3300046524 Ga0495648_0002357 Ga0495648_0002357_15610_16266 217
463 3300046660 Ga0495625_0099515 Ga0495625_0099515_160_816 217
464 3300046665 Ga0495661_0000383 Ga0495661_0000383_11001_11657 217
465 3300047472 Ga0495686_0000050 Ga0495686_0000050_79524_80177 217
466 3300047472 Ga0495686_0000320 Ga0495686_0000320_32462_33118 217
467 3300048905 Ga0496102_0304792 Ga0496102_0304792_608_1261 217
468 3300048909 Ga0496106_0087678 Ga0496106_0087678_1179_1832 217
469 3300048920 Ga0496117_0009897 Ga0496117_0009897_6089_6742 217
470 3300048920 Ga0496117_0053884 Ga0496117_0053884_1250_1903 217
471 3300048921 Ga0496118_0000815 Ga0496118_0000815_5799_6452 217
472 3300048921 Ga0496118_0001532 Ga0496118_0001532_33047_33700 217
473 3300048924 Ga0496121_0000914 Ga0496121_0000914_8967_9620 217
474 3300048924 Ga0496121_0017800 Ga0496121_0017800_570_1226 217
475 3300048925 Ga0496122_0047232 Ga0496122_0047232_2634_3287 217
476 3300048928 Ga0496125_0007560 Ga0496125_0007560_1963_2616 217
477 3300048929 Ga0496126_0118664 Ga0496126_0118664_1090_1743 217
478 3300049460 Ga0495682_0013382 Ga0495682_0013382_1087_1743 217
479 3300053730 Ga0500645_000260 Ga0500645_000260_16105_16761 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06026

Rib_5-P_isom_A

Ribose 5-phosphate isomerase A (phosphoriboisomerase A)

83

248

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kwm-assembly2.cif.gz_C crystal structure of ribose-5-isomerase a 0.992 1 210
4x84-assembly1.cif.gz_D crystal structure of ribose-5-phosphate isomerase a from pseudomonas aeruginosa 0.9828 2 213
3uw1-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase a from burkholderia thailandensis with ribose-5-phosphate 0.982 1 213
6mc0-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from legionella pneumophila with bound substrate ribose-5-phosphate and product ribulose-5-phosphate 0.9763 3 210
7lda-assembly1.cif.gz_A crystal structure of a ribose-5-phosphate isomerase from stenotrophomonas maltophilia k279a 0.9653 4 217
ID Description Score Start End Superfamily
4m8lB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 1.002 130 200 3.30.70.260
4m8lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9756 3 128 3.40.50.1360
4m8lB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9748 130 200 3.30.70.260
2pjmA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9631 132 200 3.30.70.260
1xtzA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9512 134 200 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A1G4AKQ8-F1-model_v4 deleted 0.998 68 210
AF-A0A350LL73-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9973 91 210 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A259D9D1-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9972 56 210 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A1Z9H498-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9943 86 210 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A381WMJ0-F1-model_v4 ribose-5-phosphate isomerase (EC 5.3.1.6) (Phosphoriboisomerase) 0.9941 58 213 GO:0004751
GO:0005829
GO:0006014
GO:0009052

Feature Viewer

pLDDT pTM Quality
96.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map