F451675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 477 | 278 | 477 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_101111839|Ga0075428_1011118391 |
| Length | 164 |
| Sequence | VLATSRRWLRAAIAIAVTLALVAILVLWRPSGLYPWLKALHVIAIIAWMAGMLYLPRLFVYHCDAEPGSKQSETFKLMERRLLTVIINPAMVLSWALGLWAAGWLQAKVVLVLMLSALQGFFVRWVRDFANDANRHSPKFYRIVNEVPTILMIGIVILAVVKPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 154 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 155 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 156 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 182 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 183 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 184 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 185 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 248 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 258 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 261 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.79 |
| Metatranscriptomes | 0.21 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.24 |
| Nodule | 0 |
| Rhizoplane | 7.55 |
| Rhizosphere | 83.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10003399 | 3300001989 | Bacteria | 6073 |
| 2 | JGI24737J22298_10000493 | 3300001990 | Bacteria | 13715 |
| 3 | JGI24735J21928_10018703 | 3300002067 | Bacteria | 2135 |
| 4 | JGI25153J46596_10104910 | 3300003215 | Bacteria | 658 |
| 5 | Ga0070658_10071586 | 3300005327 | Bacteria | 2840 |
| 6 | Ga0070683_100082697 | 3300005329 | Bacteria | 3007 |
| 7 | Ga0070683_101009581 | 3300005329 | Bacteria | 799 |
| 8 | Ga0070690_100168043 | 3300005330 | Bacteria | 1508 |
| 9 | Ga0070680_100011100 | 3300005336 | Bacteria | 6964 |
| 10 | Ga0070680_100101410 | 3300005336 | Bacteria | 2389 |
| 11 | Ga0070680_100139162 | 3300005336 | Bacteria | 2035 |
| 12 | Ga0070682_100018296 | 3300005337 | Bacteria | 4093 |
| 13 | Ga0070660_100098180 | 3300005339 | Bacteria | 2318 |
| 14 | Ga0070691_10083610 | 3300005341 | Bacteria | 1566 |
| 15 | Ga0070691_10267268 | 3300005341 | Bacteria | 923 |
| 16 | Ga0070659_100131525 | 3300005366 | Bacteria | 2033 |
| 17 | Ga0070659_101202664 | 3300005366 | Bacteria | 670 |
| 18 | Ga0070709_10072463 | 3300005434 | Bacteria | 2227 |
| 19 | Ga0070714_100051084 | 3300005435 | Bacteria | 3524 |
| 20 | Ga0070714_100068153 | 3300005435 | Bacteria | 3070 |
| 21 | Ga0070713_100007994 | 3300005436 | Bacteria | 7475 |
| 22 | Ga0070713_100012129 | 3300005436 | Bacteria | 6310 |
| 23 | Ga0070713_100029489 | 3300005436 | Bacteria | 4347 |
| 24 | Ga0070713_100103151 | 3300005436 | Bacteria | 2475 |
| 25 | Ga0070713_100267088 | 3300005436 | Bacteria | 1565 |
| 26 | Ga0070713_100382378 | 3300005436 | Bacteria | 1312 |
| 27 | Ga0070710_10184651 | 3300005437 | Bacteria | 1308 |
| 28 | Ga0070710_10303376 | 3300005437 | Bacteria | 1043 |
| 29 | Ga0070701_10542958 | 3300005438 | Bacteria | 761 |
| 30 | Ga0070711_100003792 | 3300005439 | Bacteria | 8870 |
| 31 | Ga0070711_100053458 | 3300005439 | Bacteria | 2783 |
| 32 | Ga0070711_100117333 | 3300005439 | Bacteria | 1963 |
| 33 | Ga0070711_100126406 | 3300005439 | Bacteria | 1898 |
| 34 | Ga0070711_100139447 | 3300005439 | Bacteria | 1816 |
| 35 | Ga0070705_100994677 | 3300005440 | Bacteria | 680 |
| 36 | Ga0070700_100182443 | 3300005441 | Bacteria | 1462 |
| 37 | Ga0070700_101202722 | 3300005441 | Bacteria | 633 |
| 38 | Ga0070708_100081054 | 3300005445 | Bacteria | 2938 |
| 39 | Ga0070678_100271787 | 3300005456 | Bacteria | 1430 |
| 40 | Ga0070678_100532120 | 3300005456 | Bacteria | 1041 |
| 41 | Ga0070662_100155691 | 3300005457 | Bacteria | 1784 |
| 42 | Ga0070662_100461749 | 3300005457 | Bacteria | 1055 |
| 43 | Ga0070681_10041750 | 3300005458 | Bacteria | 4598 |
| 44 | Ga0070681_10095970 | 3300005458 | Bacteria | 2913 |
| 45 | Ga0070681_10112235 | 3300005458 | Bacteria | 2665 |
| 46 | Ga0070681_10634078 | 3300005458 | Bacteria | 983 |
| 47 | Ga0070706_100029870 | 3300005467 | Bacteria | 5020 |
| 48 | Ga0070706_100048436 | 3300005467 | Bacteria | 3922 |
| 49 | Ga0070706_100316908 | 3300005467 | Bacteria | 1455 |
| 50 | Ga0070707_100015766 | 3300005468 | Bacteria | 7093 |
| 51 | Ga0070707_101120721 | 3300005468 | Bacteria | 753 |
| 52 | Ga0070698_100150267 | 3300005471 | Bacteria | 2277 |
| 53 | Ga0070698_100344875 | 3300005471 | Bacteria | 1421 |
| 54 | Ga0070699_100002071 | 3300005518 | Bacteria | 18145 |
| 55 | Ga0070699_100841037 | 3300005518 | Bacteria | 840 |
| 56 | Ga0070699_101693583 | 3300005518 | Bacteria | 579 |
| 57 | Ga0070679_100018483 | 3300005530 | Bacteria | 6765 |
| 58 | Ga0070679_100127684 | 3300005530 | Bacteria | 2524 |
| 59 | Ga0070679_100300273 | 3300005530 | Bacteria | 1556 |
| 60 | Ga0070679_100390077 | 3300005530 | Bacteria | 1339 |
| 61 | Ga0070679_100491896 | 3300005530 | Bacteria | 1171 |
| 62 | Ga0070684_100131797 | 3300005535 | Bacteria | 2255 |
| 63 | Ga0070697_100047518 | 3300005536 | Bacteria | 3479 |
| 64 | Ga0070697_100071040 | 3300005536 | Bacteria | 2855 |
| 65 | Ga0070697_100406518 | 3300005536 | Bacteria | 1182 |
| 66 | Ga0068853_100133988 | 3300005539 | Bacteria | 2220 |
| 67 | Ga0068853_100217752 | 3300005539 | Bacteria | 1743 |
| 68 | Ga0068853_101005837 | 3300005539 | Bacteria | 803 |
| 69 | Ga0070696_100377488 | 3300005546 | Bacteria | 1104 |
| 70 | Ga0070693_100040944 | 3300005547 | Bacteria | 2604 |
| 71 | Ga0070693_100141757 | 3300005547 | Bacteria | 1514 |
| 72 | Ga0070693_100978322 | 3300005547 | Bacteria | 639 |
| 73 | Ga0070693_101062022 | 3300005547 | Bacteria | 616 |
| 74 | Ga0068855_100015846 | 3300005563 | Bacteria | 9068 |
| 75 | Ga0068855_100128067 | 3300005563 | Bacteria | 2901 |
| 76 | Ga0068855_100186449 | 3300005563 | Bacteria | 2343 |
| 77 | Ga0068855_100256215 | 3300005563 | Bacteria | 1951 |
| 78 | Ga0068855_100642119 | 3300005563 | Bacteria | 1141 |
| 79 | Ga0070664_100232828 | 3300005564 | Bacteria | 1651 |
| 80 | Ga0070664_100591021 | 3300005564 | Bacteria | 1029 |
| 81 | Ga0068857_100022934 | 3300005577 | Bacteria | 5491 |
| 82 | Ga0068854_100272254 | 3300005578 | Bacteria | 1360 |
| 83 | Ga0068854_100387699 | 3300005578 | Bacteria | 1153 |
| 84 | Ga0068856_100066450 | 3300005614 | Bacteria | 3563 |
| 85 | Ga0068856_100845032 | 3300005614 | Bacteria | 935 |
| 86 | Ga0068856_101378687 | 3300005614 | Bacteria | 720 |
| 87 | Ga0068852_100098557 | 3300005616 | Bacteria | 2632 |
| 88 | Ga0068852_100318075 | 3300005616 | Bacteria | 1511 |
| 89 | Ga0068861_100302890 | 3300005719 | Bacteria | 1385 |
| 90 | Ga0068851_10011049 | 3300005834 | Bacteria | 4227 |
| 91 | Ga0068858_100392536 | 3300005842 | Bacteria | 1332 |
| 92 | Ga0081538_10060559 | 3300005981 | Bacteria | 2176 |
| 93 | Ga0081538_10111530 | 3300005981 | Bacteria | 1341 |
| 94 | Ga0081540_1038509 | 3300005983 | Bacteria | 2520 |
| 95 | Ga0070717_10070756 | 3300006028 | Bacteria | 2908 |
| 96 | Ga0070717_10306775 | 3300006028 | Bacteria | 1412 |
| 97 | Ga0070717_10344302 | 3300006028 | Bacteria | 1332 |
| 98 | Ga0075365_10001911 | 3300006038 | Bacteria | 9819 |
| 99 | Ga0075365_10158734 | 3300006038 | Bacteria | 1575 |
| 100 | Ga0075368_10073013 | 3300006042 | Bacteria | 1388 |
| 101 | Ga0075368_10154350 | 3300006042 | Bacteria | 960 |
| 102 | Ga0075363_100033366 | 3300006048 | Bacteria | 2680 |
| 103 | Ga0075363_100361803 | 3300006048 | Bacteria | 849 |
| 104 | Ga0075364_10036006 | 3300006051 | Bacteria | 3199 |
| 105 | Ga0075432_10132462 | 3300006058 | Bacteria | 945 |
| 106 | Ga0070715_10047134 | 3300006163 | Bacteria | 1835 |
| 107 | Ga0070716_100074523 | 3300006173 | Bacteria | 2005 |
| 108 | Ga0070712_100000967 | 3300006175 | Bacteria | 17301 |
| 109 | Ga0070712_100097287 | 3300006175 | Bacteria | 2169 |
| 110 | Ga0075362_10087508 | 3300006177 | Bacteria | 1443 |
| 111 | Ga0097621_100624510 | 3300006237 | Bacteria | 987 |
| 112 | Ga0068871_101263509 | 3300006358 | Bacteria | 694 |
| 113 | Ga0075428_100246588 | 3300006844 | Bacteria | 1926 |
| 114 | Ga0075428_100271781 | 3300006844 | Bacteria | 1824 |
| 115 | Ga0075428_101111839 | 3300006844 | Bacteria | 834 |
| 116 | Ga0075430_100053052 | 3300006846 | Bacteria | 3414 |
| 117 | Ga0075430_100726631 | 3300006846 | Bacteria | 819 |
| 118 | Ga0075431_100202139 | 3300006847 | Bacteria | 2032 |
| 119 | Ga0075431_100676986 | 3300006847 | Bacteria | 1010 |
| 120 | Ga0075433_10039634 | 3300006852 | Bacteria | 4075 |
| 121 | Ga0075434_100009416 | 3300006871 | Bacteria | 9104 |
| 122 | Ga0075434_100141491 | 3300006871 | Bacteria | 2426 |
| 123 | Ga0075434_100829036 | 3300006871 | Bacteria | 941 |
| 124 | Ga0068865_100723475 | 3300006881 | Bacteria | 852 |
| 125 | Ga0097620_101932354 | 3300006931 | Bacteria | 652 |
| 126 | Ga0075435_101069694 | 3300007076 | Bacteria | 705 |
| 127 | Ga0099794_10260653 | 3300007265 | Bacteria | 895 |
| 128 | Ga0099794_10382942 | 3300007265 | Bacteria | 734 |
| 129 | Ga0099795_10132347 | 3300007788 | Bacteria | 1008 |
| 130 | Ga0105250_10180588 | 3300009092 | Bacteria | 885 |
| 131 | Ga0105240_10008228 | 3300009093 | Bacteria | 14944 |
| 132 | Ga0105240_10025163 | 3300009093 | Bacteria | 7828 |
| 133 | Ga0105240_10034925 | 3300009093 | Bacteria | 6482 |
| 134 | Ga0105240_10119042 | 3300009093 | Bacteria | 3182 |
| 135 | Ga0105240_10319663 | 3300009093 | Bacteria | 1770 |
| 136 | Ga0105240_10446450 | 3300009093 | Bacteria | 1448 |
| 137 | Ga0105240_10700525 | 3300009093 | Bacteria | 1105 |
| 138 | Ga0105240_11237479 | 3300009093 | Bacteria | 789 |
| 139 | Ga0111539_10096842 | 3300009094 | Bacteria | 3466 |
| 140 | Ga0111539_11399713 | 3300009094 | Bacteria | 811 |
| 141 | Ga0105247_10020697 | 3300009101 | Bacteria | 3954 |
| 142 | Ga0114129_10119907 | 3300009147 | Bacteria | 3623 |
| 143 | Ga0114129_10199236 | 3300009147 | Bacteria | 2713 |
| 144 | Ga0105243_10168296 | 3300009148 | Bacteria | 1896 |
| 145 | Ga0105241_10183608 | 3300009174 | Bacteria | 1737 |
| 146 | Ga0105241_10409658 | 3300009174 | Bacteria | 1191 |
| 147 | Ga0105241_11431570 | 3300009174 | Bacteria | 663 |
| 148 | Ga0105242_10308217 | 3300009176 | Bacteria | 1448 |
| 149 | Ga0105248_10443284 | 3300009177 | Bacteria | 1463 |
| 150 | Ga0105248_11255553 | 3300009177 | Bacteria | 838 |
| 151 | Ga0105237_10087226 | 3300009545 | Bacteria | 3110 |
| 152 | Ga0105237_10308543 | 3300009545 | Bacteria | 1585 |
| 153 | Ga0105237_10314445 | 3300009545 | Bacteria | 1569 |
| 154 | Ga0105237_10597072 | 3300009545 | Bacteria | 1111 |
| 155 | Ga0105238_10327759 | 3300009551 | Bacteria | 1518 |
| 156 | Ga0105238_10396926 | 3300009551 | Bacteria | 1372 |
| 157 | Ga0105238_10551198 | 3300009551 | Bacteria | 1157 |
| 158 | Ga0105238_10628931 | 3300009551 | Bacteria | 1083 |
| 159 | Ga0105249_10918808 | 3300009553 | Bacteria | 942 |
| 160 | Ga0099796_10035679 | 3300010159 | Bacteria | 1651 |
| 161 | Ga0099796_10296410 | 3300010159 | Bacteria | 684 |
| 162 | Ga0099796_10297563 | 3300010159 | Bacteria | 683 |
| 163 | Ga0105239_10183036 | 3300010375 | Bacteria | 2344 |
| 164 | Ga0105239_10326897 | 3300010375 | Bacteria | 1730 |
| 165 | Ga0105246_10370205 | 3300011119 | Bacteria | 1180 |
| 166 | Ga0105246_10586826 | 3300011119 | Bacteria | 961 |
| 167 | Ga0105246_10900599 | 3300011119 | Bacteria | 793 |
| 168 | Ga0157370_10384041 | 3300013104 | Bacteria | 1293 |
| 169 | Ga0157370_10615181 | 3300013104 | Bacteria | 994 |
| 170 | Ga0157369_10022993 | 3300013105 | Bacteria | 6949 |
| 171 | Ga0157374_11517769 | 3300013296 | Bacteria | 693 |
| 172 | Ga0157372_10089798 | 3300013307 | Bacteria | 3491 |
| 173 | Ga0157372_10342081 | 3300013307 | Bacteria | 1743 |
| 174 | Ga0157372_11561944 | 3300013307 | Bacteria | 760 |
| 175 | Ga0157372_12491906 | 3300013307 | Bacteria | 594 |
| 176 | Ga0163163_10669104 | 3300014325 | Bacteria | 1102 |
| 177 | Ga0157380_10024283 | 3300014326 | Bacteria | 4586 |
| 178 | Ga0157380_10665249 | 3300014326 | Bacteria | 1041 |
| 179 | Ga0182008_10321497 | 3300014497 | Bacteria | 814 |
| 180 | Ga0157379_10434281 | 3300014968 | Bacteria | 1210 |
| 181 | Ga0157379_10765968 | 3300014968 | Bacteria | 909 |
| 182 | Ga0157379_11708494 | 3300014968 | Bacteria | 617 |
| 183 | Ga0206350_10558986 | 3300020080 | Bacteria | 586 |
| 184 | Ga0213874_10004811 | 3300021377 | Bacteria | 3115 |
| 185 | Ga0213876_10002439 | 3300021384 | Bacteria | 10933 |
| 186 | Ga0209758_1010679 | 3300025297 | Bacteria | 5453 |
| 187 | Ga0207656_10009884 | 3300025321 | Bacteria | 3553 |
| 188 | Ga0207692_10030296 | 3300025898 | Bacteria | 2579 |
| 189 | Ga0207692_10249709 | 3300025898 | Bacteria | 1063 |
| 190 | Ga0207692_10304060 | 3300025898 | Bacteria | 971 |
| 191 | Ga0207710_10041589 | 3300025900 | Bacteria | 2039 |
| 192 | Ga0207710_10510175 | 3300025900 | Bacteria | 624 |
| 193 | Ga0207647_10001150 | 3300025904 | Bacteria | 20374 |
| 194 | Ga0207685_10035260 | 3300025905 | Bacteria | 1825 |
| 195 | Ga0207699_10392537 | 3300025906 | Bacteria | 987 |
| 196 | Ga0207705_10131695 | 3300025909 | Bacteria | 1861 |
| 197 | Ga0207684_10026519 | 3300025910 | Bacteria | 4940 |
| 198 | Ga0207684_10136222 | 3300025910 | Bacteria | 2109 |
| 199 | Ga0207684_10162406 | 3300025910 | Bacteria | 1924 |
| 200 | Ga0207684_10441230 | 3300025910 | Bacteria | 1118 |
| 201 | Ga0207684_10501734 | 3300025910 | Bacteria | 1040 |
| 202 | Ga0207654_10140837 | 3300025911 | Bacteria | 1538 |
| 203 | Ga0207707_10004560 | 3300025912 | Bacteria | 12178 |
| 204 | Ga0207707_10020346 | 3300025912 | Bacteria | 5794 |
| 205 | Ga0207707_10024650 | 3300025912 | Bacteria | 5264 |
| 206 | Ga0207707_10872923 | 3300025912 | Bacteria | 745 |
| 207 | Ga0207695_10139548 | 3300025913 | Bacteria | 2374 |
| 208 | Ga0207695_10239588 | 3300025913 | Bacteria | 1716 |
| 209 | Ga0207695_10536178 | 3300025913 | Bacteria | 1052 |
| 210 | Ga0207695_10759439 | 3300025913 | Bacteria | 850 |
| 211 | Ga0207671_10354779 | 3300025914 | Bacteria | 1163 |
| 212 | Ga0207671_10436004 | 3300025914 | Bacteria | 1043 |
| 213 | Ga0207693_10003024 | 3300025915 | Bacteria | 14534 |
| 214 | Ga0207693_10016511 | 3300025915 | Bacteria | 5899 |
| 215 | Ga0207663_10159791 | 3300025916 | Bacteria | 1589 |
| 216 | Ga0207663_10435955 | 3300025916 | Bacteria | 1008 |
| 217 | Ga0207660_10018837 | 3300025917 | Bacteria | 4608 |
| 218 | Ga0207660_10034045 | 3300025917 | Bacteria | 3528 |
| 219 | Ga0207660_10088047 | 3300025917 | Bacteria | 2295 |
| 220 | Ga0207660_10298033 | 3300025917 | Bacteria | 1283 |
| 221 | Ga0207657_10001686 | 3300025919 | Bacteria | 23826 |
| 222 | Ga0207652_10026633 | 3300025921 | Bacteria | 4818 |
| 223 | Ga0207652_10134241 | 3300025921 | Bacteria | 2209 |
| 224 | Ga0207652_10882487 | 3300025921 | Bacteria | 791 |
| 225 | Ga0207646_10146103 | 3300025922 | Bacteria | 2131 |
| 226 | Ga0207646_10191506 | 3300025922 | Bacteria | 1847 |
| 227 | Ga0207646_10472958 | 3300025922 | Bacteria | 1130 |
| 228 | Ga0207646_11282762 | 3300025922 | Bacteria | 640 |
| 229 | Ga0207694_10416516 | 3300025924 | Bacteria | 1119 |
| 230 | Ga0207694_10422836 | 3300025924 | Bacteria | 1110 |
| 231 | Ga0207694_10569032 | 3300025924 | Bacteria | 952 |
| 232 | Ga0207694_11705966 | 3300025924 | Bacteria | 530 |
| 233 | Ga0207700_10030214 | 3300025928 | Bacteria | 3834 |
| 234 | Ga0207700_10044665 | 3300025928 | Bacteria | 3264 |
| 235 | Ga0207700_10231832 | 3300025928 | Bacteria | 1570 |
| 236 | Ga0207700_10459730 | 3300025928 | Bacteria | 1123 |
| 237 | Ga0207700_11037597 | 3300025928 | Bacteria | 733 |
| 238 | Ga0207664_10231044 | 3300025929 | Bacteria | 1608 |
| 239 | Ga0207690_10984086 | 3300025932 | Bacteria | 701 |
| 240 | Ga0207706_10020446 | 3300025933 | Bacteria | 5951 |
| 241 | Ga0207706_10537567 | 3300025933 | Bacteria | 1007 |
| 242 | Ga0207686_10408149 | 3300025934 | Bacteria | 1036 |
| 243 | Ga0207709_10767372 | 3300025935 | Bacteria | 776 |
| 244 | Ga0207665_10076784 | 3300025939 | Bacteria | 2292 |
| 245 | Ga0207665_10199348 | 3300025939 | Bacteria | 1458 |
| 246 | Ga0207665_10355356 | 3300025939 | Bacteria | 1107 |
| 247 | Ga0207711_10290572 | 3300025941 | Bacteria | 1507 |
| 248 | Ga0207711_11506519 | 3300025941 | Bacteria | 616 |
| 249 | Ga0207661_10105390 | 3300025944 | Bacteria | 2375 |
| 250 | Ga0207661_10769850 | 3300025944 | Bacteria | 886 |
| 251 | Ga0207679_10583720 | 3300025945 | Bacteria | 1005 |
| 252 | Ga0207667_10002324 | 3300025949 | Bacteria | 23814 |
| 253 | Ga0207667_10134382 | 3300025949 | Bacteria | 2547 |
| 254 | Ga0207667_10141261 | 3300025949 | Bacteria | 2479 |
| 255 | Ga0207667_10207927 | 3300025949 | Bacteria | 2006 |
| 256 | Ga0207667_10574085 | 3300025949 | Bacteria | 1139 |
| 257 | Ga0207668_10347002 | 3300025972 | Bacteria | 1240 |
| 258 | Ga0207640_10064044 | 3300025981 | Bacteria | 2446 |
| 259 | Ga0207640_10268994 | 3300025981 | Bacteria | 1332 |
| 260 | Ga0207677_10994739 | 3300026023 | Bacteria | 760 |
| 261 | Ga0207703_10226653 | 3300026035 | Bacteria | 1673 |
| 262 | Ga0207703_10414504 | 3300026035 | Bacteria | 1252 |
| 263 | Ga0207639_10027807 | 3300026041 | Bacteria | 4123 |
| 264 | Ga0207639_10031138 | 3300026041 | Bacteria | 3918 |
| 265 | Ga0207639_10763573 | 3300026041 | Bacteria | 899 |
| 266 | Ga0207639_10791686 | 3300026041 | Bacteria | 883 |
| 267 | Ga0207639_10875804 | 3300026041 | Bacteria | 839 |
| 268 | Ga0207708_10261964 | 3300026075 | Bacteria | 1396 |
| 269 | Ga0207702_10082698 | 3300026078 | Bacteria | 2792 |
| 270 | Ga0207702_10271587 | 3300026078 | Bacteria | 1599 |
| 271 | Ga0207674_10000890 | 3300026116 | Bacteria | 39065 |
| 272 | Ga0207675_100267690 | 3300026118 | Bacteria | 1658 |
| 273 | Ga0207683_10317716 | 3300026121 | Bacteria | 1426 |
| 274 | Ga0207683_10442644 | 3300026121 | Bacteria | 1198 |
| 275 | Ga0207698_10129747 | 3300026142 | Bacteria | 2152 |
| 276 | Ga0207698_10311676 | 3300026142 | Bacteria | 1470 |
| 277 | Ga0207698_10378844 | 3300026142 | Bacteria | 1345 |
| 278 | Ga0207698_10644962 | 3300026142 | Bacteria | 1048 |
| 279 | Ga0209813_10068471 | 3300027866 | Bacteria | 1149 |
| 280 | Ga0268265_11486623 | 3300028380 | Bacteria | 681 |
| 281 | Ga0265323_10053601 | 3300028653 | Bacteria | 1423 |
| 282 | Ga0265336_10000561 | 3300028666 | Bacteria | 21059 |
| 283 | Ga0265338_10000598 | 3300028800 | Bacteria | 63497 |
| 284 | Ga0265324_10007924 | 3300029957 | Bacteria | 4261 |
| 285 | Ga0265325_10234468 | 3300031241 | Bacteria | 836 |
| 286 | Ga0307408_100465623 | 3300031548 | Bacteria | 1099 |
| 287 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 288 | Ga0307508_10118780 | 3300031616 | Bacteria | 2246 |
| 289 | Ga0265342_10297467 | 3300031712 | Bacteria | 851 |
| 290 | Ga0307516_10478017 | 3300031730 | Bacteria | 901 |
| 291 | Ga0307405_10309161 | 3300031731 | Bacteria | 1202 |
| 292 | Ga0307413_10172076 | 3300031824 | Bacteria | 1534 |
| 293 | Ga0307412_10073156 | 3300031911 | Bacteria | 2344 |
| 294 | Ga0307409_100063990 | 3300031995 | Bacteria | 2887 |
| 295 | Ga0307416_100696806 | 3300032002 | Bacteria | 1104 |
| 296 | Ga0307414_11316499 | 3300032004 | Bacteria | 670 |
| 297 | Ga0307415_100353214 | 3300032126 | Bacteria | 1238 |
| 298 | Ga0316212_1013448 | 3300033547 | Bacteria | 1161 |
| 299 | Ga0373926_0325374 | 3300035083 | Bacteria | 602 |
| 300 | Ga0373929_0072506 | 3300035085 | Bacteria | 826 |
| 301 | Ga0373934_0030126 | 3300035086 | Bacteria | 2122 |
| 302 | Ga0373944_0071082 | 3300035089 | Bacteria | 1134 |
| 303 | Ga0373957_0110646 | 3300035120 | Bacteria | 1106 |
| 304 | Ga0373943_0104716 | 3300035170 | Bacteria | 1485 |
| 305 | Ga0373946_0097285 | 3300035171 | Bacteria | 1314 |
| 306 | Ga0373931_0158583 | 3300035691 | Bacteria | 1324 |
| 307 | Ga0373931_0371116 | 3300035691 | Bacteria | 900 |
| 308 | Ga0373935_0510711 | 3300035692 | Bacteria | 873 |
| 309 | Ga0373927_0020725 | 3300035695 | Bacteria | 4311 |
| 310 | Ga0373927_0106878 | 3300035695 | Bacteria | 1822 |
| 311 | Ga0373927_0178839 | 3300035695 | Bacteria | 1391 |
| 312 | Ga0373927_0361772 | 3300035695 | Bacteria | 956 |
| 313 | Ga0373933_0153594 | 3300035724 | Bacteria | 1459 |
| 314 | Ga0373933_0243998 | 3300035724 | Bacteria | 1156 |
| 315 | Ga0373947_0034928 | 3300035725 | Bacteria | 2975 |
| 316 | Ga0373947_0038463 | 3300035725 | Bacteria | 2843 |
| 317 | Ga0373937_0001232 | 3300036401 | Bacteria | 21520 |
| 318 | Ga0373937_0099477 | 3300036401 | Bacteria | 2698 |
| 319 | Ga0373937_0250346 | 3300036401 | Bacteria | 1670 |
| 320 | Ga0373937_0503118 | 3300036401 | Bacteria | 1151 |
| 321 | Ga0373925_0208743 | 3300037068 | Bacteria | 1555 |
| 322 | Ga0373925_0409791 | 3300037068 | Bacteria | 1106 |
| 323 | Ga0373925_1172854 | 3300037068 | Bacteria | 631 |
| 324 | Ga0395900_0284311 | 3300037418 | Bacteria | 1645 |
| 325 | Ga0395900_0783580 | 3300037418 | Bacteria | 882 |
| 326 | Ga0395898_0135802 | 3300037466 | Bacteria | 2355 |
| 327 | Ga0395898_0345278 | 3300037466 | Bacteria | 1419 |
| 328 | Ga0436364_1079344 | 3300037853 | Bacteria | 1551 |
| 329 | Ga0395901_0082818 | 3300038443 | Bacteria | 3352 |
| 330 | Ga0436365_0949897 | 3300039437 | Bacteria | 15199 |
| 331 | Ga0436360_0705531 | 3300039438 | Bacteria | 892 |
| 332 | Ga0436361_0390802 | 3300039447 | Bacteria | 701 |
| 333 | Ga0436363_0183469 | 3300039450 | Bacteria | 992 |
| 334 | Ga0436363_1106154 | 3300039450 | Bacteria | 3898 |
| 335 | Ga0436363_1113695 | 3300039450 | Bacteria | 764 |
| 336 | Ga0436363_1162239 | 3300039450 | Bacteria | 1286 |
| 337 | Ga0436362_0356181 | 3300039453 | Bacteria | 1934 |
| 338 | Ga0439465_0428837 | 3300041413 | Bacteria | 505 |
| 339 | Ga0451800_0378216 | 3300041459 | Bacteria | 724 |
| 340 | Ga0451807_2244634 | 3300041486 | Bacteria | 763 |
| 341 | Ga0451833_0934222 | 3300041491 | Bacteria | 676 |
| 342 | Ga0451847_0207748 | 3300041503 | Bacteria | 1433 |
| 343 | Ga0439431_0052444 | 3300041997 | Bacteria | 1060 |
| 344 | Ga0439449_0249877 | 3300042007 | Bacteria | 667 |
| 345 | Ga0495603_0230605 | 3300046455 | Bacteria | 1067 |
| 346 | Ga0495591_077697 | 3300046458 | Bacteria | 851 |
| 347 | Ga0495580_0167212 | 3300046472 | Bacteria | 1521 |
| 348 | Ga0495584_0038683 | 3300046491 | Bacteria | 2411 |
| 349 | Ga0495585_0237175 | 3300046492 | Bacteria | 914 |
| 350 | Ga0495606_0098603 | 3300046507 | Bacteria | 1783 |
| 351 | Ga0495610_0163312 | 3300046512 | Bacteria | 940 |
| 352 | Ga0495631_0077982 | 3300046518 | Bacteria | 1430 |
| 353 | Ga0495663_0065999 | 3300046525 | Bacteria | 1145 |
| 354 | Ga0495642_0306624 | 3300046528 | Bacteria | 696 |
| 355 | Ga0495665_0018870 | 3300046531 | Bacteria | 3706 |
| 356 | Ga0495598_0069381 | 3300046537 | Bacteria | 1106 |
| 357 | Ga0495621_0137765 | 3300046539 | Bacteria | 953 |
| 358 | Ga0495667_0816226 | 3300046559 | Bacteria | 575 |
| 359 | Ga0495634_0021849 | 3300046642 | Bacteria | 4516 |
| 360 | Ga0495659_0101234 | 3300046664 | Bacteria | 1116 |
| 361 | Ga0495646_0314031 | 3300046680 | Bacteria | 827 |
| 362 | Ga0495669_0190716 | 3300046684 | Bacteria | 978 |
| 363 | Ga0495669_0493424 | 3300046684 | Bacteria | 595 |
| 364 | Ga0495670_0026408 | 3300046691 | Bacteria | 2874 |
| 365 | Ga0495589_0228638 | 3300046794 | Bacteria | 873 |
| 366 | Ga0495674_0267662 | 3300047319 | Bacteria | 1403 |
| 367 | Ga0495674_1061485 | 3300047319 | Bacteria | 618 |
| 368 | Ga0495672_0037992 | 3300047320 | Bacteria | 2941 |
| 369 | Ga0495672_0205540 | 3300047320 | Bacteria | 982 |
| 370 | Ga0495626_0133385 | 3300048091 | Bacteria | 1059 |
| 371 | Ga0496100_0002006 | 3300048903 | Bacteria | 10183 |
| 372 | Ga0496101_0002012 | 3300048904 | Bacteria | 12342 |
| 373 | Ga0496102_0010048 | 3300048905 | Bacteria | 8140 |
| 374 | Ga0496103_0082460 | 3300048906 | Bacteria | 2024 |
| 375 | Ga0496103_0194119 | 3300048906 | Bacteria | 1305 |
| 376 | Ga0496104_0002158 | 3300048907 | Bacteria | 17075 |
| 377 | Ga0496104_0057252 | 3300048907 | Bacteria | 3688 |
| 378 | Ga0496104_0172953 | 3300048907 | Bacteria | 2070 |
| 379 | Ga0496105_0099753 | 3300048908 | Bacteria | 2398 |
| 380 | Ga0496105_0103932 | 3300048908 | Bacteria | 2346 |
| 381 | Ga0496105_1039204 | 3300048908 | Bacteria | 611 |
| 382 | Ga0496106_0065542 | 3300048909 | Bacteria | 2765 |
| 383 | Ga0496106_0421148 | 3300048909 | Bacteria | 1073 |
| 384 | Ga0496107_0002129 | 3300048910 | Bacteria | 12689 |
| 385 | Ga0496107_0020391 | 3300048910 | Bacteria | 4681 |
| 386 | Ga0496107_0515071 | 3300048910 | Bacteria | 887 |
| 387 | Ga0496108_0001911 | 3300048911 | Bacteria | 16662 |
| 388 | Ga0496108_0093687 | 3300048911 | Bacteria | 2555 |
| 389 | Ga0496108_0166493 | 3300048911 | Bacteria | 1906 |
| 390 | Ga0496109_0019720 | 3300048912 | Bacteria | 5949 |
| 391 | Ga0496109_0042051 | 3300048912 | Bacteria | 4139 |
| 392 | Ga0496109_0729787 | 3300048912 | Bacteria | 928 |
| 393 | Ga0496109_1223770 | 3300048912 | Bacteria | 687 |
| 394 | Ga0496110_0002553 | 3300048913 | Bacteria | 13681 |
| 395 | Ga0496110_0015885 | 3300048913 | Bacteria | 6276 |
| 396 | Ga0496110_0350608 | 3300048913 | Bacteria | 1344 |
| 397 | Ga0496111_0024906 | 3300048914 | Bacteria | 4220 |
| 398 | Ga0496112_0004008 | 3300048915 | Bacteria | 12349 |
| 399 | Ga0496112_0005493 | 3300048915 | Bacteria | 10973 |
| 400 | Ga0496113_0025475 | 3300048916 | Bacteria | 4216 |
| 401 | Ga0496113_0051637 | 3300048916 | Bacteria | 3069 |
| 402 | Ga0496113_0105002 | 3300048916 | Bacteria | 2193 |
| 403 | Ga0496114_0199681 | 3300048917 | Bacteria | 1751 |
| 404 | Ga0496115_0101061 | 3300048918 | Bacteria | 2364 |
| 405 | Ga0496121_0111723 | 3300048924 | Bacteria | 2083 |
| 406 | Ga0496126_0013784 | 3300048929 | Bacteria | 8197 |
| 407 | Ga0496126_0063532 | 3300048929 | Bacteria | 3309 |
| 408 | Ga0501031_0341062 | 3300049568 | Bacteria | 970 |
| 409 | Ga0501032_0048170 | 3300049569 | Bacteria | 2877 |
| 410 | Ga0501033_0078626 | 3300049570 | Bacteria | 2420 |
| 411 | Ga0501034_1142352 | 3300049571 | Bacteria | 659 |
| 412 | Ga0501036_0082368 | 3300049572 | Bacteria | 2719 |
| 413 | Ga0501037_0113028 | 3300049573 | Bacteria | 1955 |
| 414 | Ga0501038_0065986 | 3300049574 | Bacteria | 3083 |
| 415 | Ga0501038_0293986 | 3300049574 | Bacteria | 1276 |
| 416 | Ga0501039_0727367 | 3300049575 | Bacteria | 776 |
| 417 | Ga0501040_0234533 | 3300049576 | Bacteria | 1307 |
| 418 | Ga0501041_0314403 | 3300049577 | Bacteria | 988 |
| 419 | Ga0501041_0346222 | 3300049577 | Bacteria | 939 |
| 420 | Ga0501043_0000636 | 3300049579 | Bacteria | 31054 |
| 421 | Ga0501046_0003152 | 3300049580 | Bacteria | 15221 |
| 422 | Ga0501046_0218855 | 3300049580 | Bacteria | 1411 |
| 423 | Ga0501047_0096335 | 3300049581 | Bacteria | 2837 |
| 424 | Ga0501048_0051141 | 3300049582 | Bacteria | 2942 |
| 425 | Ga0501067_0005936 | 3300049583 | Bacteria | 6768 |
| 426 | Ga0501069_0062769 | 3300049585 | Bacteria | 2074 |
| 427 | Ga0501071_0231280 | 3300049587 | Bacteria | 1393 |
| 428 | Ga0501072_0127364 | 3300049588 | Bacteria | 2029 |
| 429 | Ga0501073_0032862 | 3300049589 | Bacteria | 3697 |
| 430 | Ga0501074_0085565 | 3300049590 | Bacteria | 2259 |
| 431 | Ga0501075_0028488 | 3300049591 | Bacteria | 4123 |
| 432 | Ga0501075_0193477 | 3300049591 | Bacteria | 1551 |
| 433 | Ga0501075_0204738 | 3300049591 | Bacteria | 1505 |
| 434 | Ga0501217_115449 | 3300049661 | Bacteria | 775 |
| 435 | Ga0501221_089602 | 3300049704 | Bacteria | 751 |
| 436 | Ga0501080_0107253 | 3300049742 | Bacteria | 2589 |
| 437 | Ga0501081_0066188 | 3300049743 | Bacteria | 2513 |
| 438 | Ga0501083_0040135 | 3300049744 | Bacteria | 3177 |
| 439 | Ga0501035_0352776 | 3300049822 | Bacteria | 1230 |
| 440 | Ga0501044_0020671 | 3300049823 | Bacteria | 7028 |
| 441 | Ga0501045_0457878 | 3300049824 | Bacteria | 948 |
| 442 | Ga0501045_0842677 | 3300049824 | Bacteria | 674 |
| 443 | nmdc:mga03683_390778_c1 | 3300050489 | Bacteria | 663 |
| 444 | nmdc:mga03683_72354_c1 | 3300050489 | Bacteria | 1476 |
| 445 | nmdc:mga03n38_495505_c1 | 3300050490 | Bacteria | 685 |
| 446 | nmdc:mga03n38_874593_c1 | 3300050490 | Bacteria | 527 |
| 447 | nmdc:mga00v17_4843_c2 | 3300050491 | Bacteria | 1065 |
| 448 | nmdc:mga0yw44_49339_c1 | 3300050492 | Bacteria | 2540 |
| 449 | nmdc:mga0k408_280321_c1 | 3300050493 | Bacteria | 995 |
| 450 | nmdc:mga06z11_110545_c1 | 3300050494 | Bacteria | 1521 |
| 451 | nmdc:mga04h51_62011_c1 | 3300050495 | Bacteria | 1284 |
| 452 | nmdc:mga07m45_13451_c1 | 3300050496 | Bacteria | 4343 |
| 453 | nmdc:mga05p37_451969_c1 | 3300050507 | Bacteria | 1487 |
| 454 | nmdc:mga09592_100798_c1 | 3300050508 | Bacteria | 2473 |
| 455 | nmdc:mga09592_336369_c1 | 3300050508 | Bacteria | 1307 |
| 456 | nmdc:mga0qj67_15760_c1 | 3300050509 | Bacteria | 5725 |
| 457 | nmdc:mga06r32_100618_c1 | 3300050510 | Bacteria | 2836 |
| 458 | nmdc:mga06r32_423813_c1 | 3300050510 | Bacteria | 1312 |
| 459 | nmdc:mga08y16_70447_c1 | 3300050511 | Bacteria | 3645 |
| 460 | nmdc:mga0n895_19441_c1 | 3300050512 | Bacteria | 6314 |
| 461 | nmdc:mga0rr50_227749_c1 | 3300050513 | Bacteria | 1541 |
| 462 | nmdc:mga0rr50_293089_c1 | 3300050513 | Bacteria | 1360 |
| 463 | nmdc:mga0rr50_956887_c1 | 3300050513 | Bacteria | 730 |
| 464 | nmdc:mga08x19_92294_c1 | 3300050514 | Bacteria | 2000 |
| 465 | nmdc:mga0a205_7307_c1 | 3300050515 | Bacteria | 9993 |
| 466 | Ga0495619_1007879 | 3300053085 | Bacteria | 557 |
| 467 | Ga0500595_013452 | 3300053119 | Bacteria | 3133 |
| 468 | Ga0500568_0057551 | 3300053139 | Bacteria | 1512 |
| 469 | Ga0500568_0066582 | 3300053139 | Bacteria | 1385 |
| 470 | Ga0500616_0012208 | 3300053153 | Bacteria | 5033 |
| 471 | Ga0501084_0029062 | 3300054114 | Bacteria | 4623 |
| 472 | Ga0501084_0099789 | 3300054114 | Bacteria | 2438 |
| 473 | Ga0501084_0452502 | 3300054114 | Bacteria | 1085 |
| 474 | Ga0501082_0024421 | 3300060353 | Bacteria | 5210 |
| 475 | Ga0501082_0343231 | 3300060353 | Bacteria | 1301 |
| 476 | Ga0501082_0415747 | 3300060353 | Bacteria | 1174 |
| 477 | Ga0530510_0470834 | 3300061734 | Bacteria | 951 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_451969_c1 | nmdc:mga05p37_451969_c1_947_1429 | 124 |
| 2 | 3300050508 | nmdc:mga09592_100798_c1 | nmdc:mga09592_100798_c1_1862_2344 | 124 |
| 3 | 3300031712 | Ga0265342_10297467 | Ga0265342_102974671 | 130 |
| 4 | 3300006844 | Ga0075428_101111839 | Ga0075428_1011118391 | 132 |
| 5 | 3300009147 | Ga0114129_10119907 | Ga0114129_101199072 | 132 |
| 6 | 3300050509 | nmdc:mga0qj67_15760_c1 | nmdc:mga0qj67_15760_c1_3734_4216 | 132 |
| 7 | 3300050510 | nmdc:mga06r32_100618_c1 | nmdc:mga06r32_100618_c1_979_1461 | 132 |
| 8 | 3300035692 | Ga0373935_0510711 | Ga0373935_0510711_240_677 | 134 |
| 9 | 3300037068 | Ga0373925_0409791 | Ga0373925_0409791_162_599 | 134 |
| 10 | 3300028653 | Ga0265323_10053601 | Ga0265323_100536011 | 138 |
| 11 | 3300049587 | Ga0501071_0231280 | Ga0501071_0231280_335_835 | 138 |
| 12 | 3300050489 | nmdc:mga03683_390778_c1 | nmdc:mga03683_390778_c1_79_597 | 138 |
| 13 | 3300001989 | JGI24739J22299_10003399 | JGI24739J22299_100033997 | 140 |
| 14 | 3300001990 | JGI24737J22298_10000493 | JGI24737J22298_1000049312 | 140 |
| 15 | 3300002067 | JGI24735J21928_10018703 | JGI24735J21928_100187031 | 140 |
| 16 | 3300003215 | JGI25153J46596_10104910 | JGI25153J46596_101049101 | 140 |
| 17 | 3300005327 | Ga0070658_10071586 | Ga0070658_100715861 | 140 |
| 18 | 3300005329 | Ga0070683_100082697 | Ga0070683_1000826971 | 140 |
| 19 | 3300005329 | Ga0070683_101009581 | Ga0070683_1010095811 | 140 |
| 20 | 3300005330 | Ga0070690_100168043 | Ga0070690_1001680432 | 140 |
| 21 | 3300005336 | Ga0070680_100011100 | Ga0070680_1000111004 | 140 |
| 22 | 3300005336 | Ga0070680_100101410 | Ga0070680_1001014102 | 140 |
| 23 | 3300005336 | Ga0070680_100139162 | Ga0070680_1001391622 | 140 |
| 24 | 3300005337 | Ga0070682_100018296 | Ga0070682_1000182965 | 140 |
| 25 | 3300005339 | Ga0070660_100098180 | Ga0070660_1000981802 | 140 |
| 26 | 3300005341 | Ga0070691_10083610 | Ga0070691_100836102 | 140 |
| 27 | 3300005341 | Ga0070691_10267268 | Ga0070691_102672682 | 140 |
| 28 | 3300005366 | Ga0070659_100131525 | Ga0070659_1001315252 | 140 |
| 29 | 3300005366 | Ga0070659_101202664 | Ga0070659_1012026641 | 140 |
| 30 | 3300005434 | Ga0070709_10072463 | Ga0070709_100724632 | 140 |
| 31 | 3300005435 | Ga0070714_100051084 | Ga0070714_1000510844 | 140 |
| 32 | 3300005435 | Ga0070714_100068153 | Ga0070714_1000681532 | 140 |
| 33 | 3300005436 | Ga0070713_100007994 | Ga0070713_1000079943 | 140 |
| 34 | 3300005436 | Ga0070713_100012129 | Ga0070713_1000121292 | 140 |
| 35 | 3300005436 | Ga0070713_100029489 | Ga0070713_1000294893 | 140 |
| 36 | 3300005436 | Ga0070713_100103151 | Ga0070713_1001031513 | 140 |
| 37 | 3300005436 | Ga0070713_100267088 | Ga0070713_1002670881 | 140 |
| 38 | 3300005436 | Ga0070713_100382378 | Ga0070713_1003823781 | 140 |
| 39 | 3300005437 | Ga0070710_10184651 | Ga0070710_101846512 | 140 |
| 40 | 3300005437 | Ga0070710_10303376 | Ga0070710_103033762 | 140 |
| 41 | 3300005438 | Ga0070701_10542958 | Ga0070701_105429581 | 140 |
| 42 | 3300005439 | Ga0070711_100003792 | Ga0070711_1000037928 | 140 |
| 43 | 3300005439 | Ga0070711_100053458 | Ga0070711_1000534582 | 140 |
| 44 | 3300005439 | Ga0070711_100117333 | Ga0070711_1001173332 | 140 |
| 45 | 3300005439 | Ga0070711_100126406 | Ga0070711_1001264062 | 140 |
| 46 | 3300005439 | Ga0070711_100139447 | Ga0070711_1001394471 | 140 |
| 47 | 3300005440 | Ga0070705_100994677 | Ga0070705_1009946772 | 140 |
| 48 | 3300005441 | Ga0070700_100182443 | Ga0070700_1001824432 | 140 |
| 49 | 3300005441 | Ga0070700_101202722 | Ga0070700_1012027221 | 140 |
| 50 | 3300005445 | Ga0070708_100081054 | Ga0070708_1000810542 | 140 |
| 51 | 3300005456 | Ga0070678_100271787 | Ga0070678_1002717872 | 140 |
| 52 | 3300005456 | Ga0070678_100532120 | Ga0070678_1005321202 | 140 |
| 53 | 3300005457 | Ga0070662_100155691 | Ga0070662_1001556912 | 140 |
| 54 | 3300005457 | Ga0070662_100461749 | Ga0070662_1004617492 | 140 |
| 55 | 3300005458 | Ga0070681_10041750 | Ga0070681_100417502 | 140 |
| 56 | 3300005458 | Ga0070681_10095970 | Ga0070681_100959703 | 140 |
| 57 | 3300005458 | Ga0070681_10112235 | Ga0070681_101122354 | 140 |
| 58 | 3300005458 | Ga0070681_10634078 | Ga0070681_106340781 | 140 |
| 59 | 3300005467 | Ga0070706_100029870 | Ga0070706_1000298703 | 140 |
| 60 | 3300005467 | Ga0070706_100048436 | Ga0070706_1000484363 | 140 |
| 61 | 3300005467 | Ga0070706_100316908 | Ga0070706_1003169081 | 140 |
| 62 | 3300005468 | Ga0070707_100015766 | Ga0070707_1000157667 | 140 |
| 63 | 3300005468 | Ga0070707_101120721 | Ga0070707_1011207211 | 140 |
| 64 | 3300005471 | Ga0070698_100150267 | Ga0070698_1001502672 | 140 |
| 65 | 3300005471 | Ga0070698_100344875 | Ga0070698_1003448752 | 140 |
| 66 | 3300005518 | Ga0070699_100002071 | Ga0070699_1000020718 | 140 |
| 67 | 3300005518 | Ga0070699_100841037 | Ga0070699_1008410372 | 140 |
| 68 | 3300005518 | Ga0070699_101693583 | Ga0070699_1016935831 | 140 |
| 69 | 3300005530 | Ga0070679_100018483 | Ga0070679_1000184836 | 140 |
| 70 | 3300005530 | Ga0070679_100127684 | Ga0070679_1001276844 | 140 |
| 71 | 3300005530 | Ga0070679_100300273 | Ga0070679_1003002732 | 140 |
| 72 | 3300005530 | Ga0070679_100390077 | Ga0070679_1003900772 | 140 |
| 73 | 3300005530 | Ga0070679_100491896 | Ga0070679_1004918962 | 140 |
| 74 | 3300005535 | Ga0070684_100131797 | Ga0070684_1001317971 | 140 |
| 75 | 3300005536 | Ga0070697_100047518 | Ga0070697_1000475183 | 140 |
| 76 | 3300005536 | Ga0070697_100071040 | Ga0070697_1000710403 | 140 |
| 77 | 3300005536 | Ga0070697_100406518 | Ga0070697_1004065181 | 140 |
| 78 | 3300005539 | Ga0068853_100133988 | Ga0068853_1001339882 | 140 |
| 79 | 3300005539 | Ga0068853_100217752 | Ga0068853_1002177523 | 140 |
| 80 | 3300005539 | Ga0068853_101005837 | Ga0068853_1010058372 | 140 |
| 81 | 3300005546 | Ga0070696_100377488 | Ga0070696_1003774881 | 140 |
| 82 | 3300005547 | Ga0070693_100040944 | Ga0070693_1000409441 | 140 |
| 83 | 3300005547 | Ga0070693_100141757 | Ga0070693_1001417572 | 140 |
| 84 | 3300005547 | Ga0070693_100978322 | Ga0070693_1009783221 | 140 |
| 85 | 3300005547 | Ga0070693_101062022 | Ga0070693_1010620221 | 140 |
| 86 | 3300005563 | Ga0068855_100015846 | Ga0068855_1000158468 | 140 |
| 87 | 3300005563 | Ga0068855_100128067 | Ga0068855_1001280672 | 140 |
| 88 | 3300005563 | Ga0068855_100186449 | Ga0068855_1001864492 | 140 |
| 89 | 3300005563 | Ga0068855_100256215 | Ga0068855_1002562151 | 140 |
| 90 | 3300005563 | Ga0068855_100642119 | Ga0068855_1006421191 | 140 |
| 91 | 3300005564 | Ga0070664_100232828 | Ga0070664_1002328283 | 140 |
| 92 | 3300005564 | Ga0070664_100591021 | Ga0070664_1005910211 | 140 |
| 93 | 3300005577 | Ga0068857_100022934 | Ga0068857_1000229347 | 140 |
| 94 | 3300005578 | Ga0068854_100272254 | Ga0068854_1002722541 | 140 |
| 95 | 3300005578 | Ga0068854_100387699 | Ga0068854_1003876992 | 140 |
| 96 | 3300005614 | Ga0068856_100066450 | Ga0068856_1000664503 | 140 |
| 97 | 3300005614 | Ga0068856_100845032 | Ga0068856_1008450321 | 140 |
| 98 | 3300005614 | Ga0068856_101378687 | Ga0068856_1013786871 | 140 |
| 99 | 3300005616 | Ga0068852_100098557 | Ga0068852_1000985572 | 140 |
| 100 | 3300005616 | Ga0068852_100318075 | Ga0068852_1003180752 | 140 |
| 101 | 3300005719 | Ga0068861_100302890 | Ga0068861_1003028902 | 140 |
| 102 | 3300005834 | Ga0068851_10011049 | Ga0068851_100110493 | 140 |
| 103 | 3300005842 | Ga0068858_100392536 | Ga0068858_1003925361 | 140 |
| 104 | 3300005981 | Ga0081538_10060559 | Ga0081538_100605592 | 140 |
| 105 | 3300005981 | Ga0081538_10111530 | Ga0081538_101115302 | 140 |
| 106 | 3300005983 | Ga0081540_1038509 | Ga0081540_10385092 | 140 |
| 107 | 3300006028 | Ga0070717_10070756 | Ga0070717_100707561 | 140 |
| 108 | 3300006028 | Ga0070717_10306775 | Ga0070717_103067751 | 140 |
| 109 | 3300006028 | Ga0070717_10344302 | Ga0070717_103443022 | 140 |
| 110 | 3300006038 | Ga0075365_10001911 | Ga0075365_100019112 | 140 |
| 111 | 3300006038 | Ga0075365_10158734 | Ga0075365_101587342 | 140 |
| 112 | 3300006042 | Ga0075368_10073013 | Ga0075368_100730132 | 140 |
| 113 | 3300006042 | Ga0075368_10154350 | Ga0075368_101543501 | 140 |
| 114 | 3300006048 | Ga0075363_100033366 | Ga0075363_1000333661 | 140 |
| 115 | 3300006048 | Ga0075363_100361803 | Ga0075363_1003618032 | 140 |
| 116 | 3300006051 | Ga0075364_10036006 | Ga0075364_100360062 | 140 |
| 117 | 3300006058 | Ga0075432_10132462 | Ga0075432_101324622 | 140 |
| 118 | 3300006163 | Ga0070715_10047134 | Ga0070715_100471342 | 140 |
| 119 | 3300006173 | Ga0070716_100074523 | Ga0070716_1000745232 | 140 |
| 120 | 3300006175 | Ga0070712_100000967 | Ga0070712_1000009678 | 140 |
| 121 | 3300006175 | Ga0070712_100097287 | Ga0070712_1000972873 | 140 |
| 122 | 3300006177 | Ga0075362_10087508 | Ga0075362_100875082 | 140 |
| 123 | 3300006237 | Ga0097621_100624510 | Ga0097621_1006245103 | 140 |
| 124 | 3300006358 | Ga0068871_101263509 | Ga0068871_1012635091 | 140 |
| 125 | 3300006844 | Ga0075428_100246588 | Ga0075428_1002465882 | 140 |
| 126 | 3300006844 | Ga0075428_100271781 | Ga0075428_1002717812 | 140 |
| 127 | 3300006846 | Ga0075430_100053052 | Ga0075430_1000530524 | 140 |
| 128 | 3300006846 | Ga0075430_100726631 | Ga0075430_1007266312 | 140 |
| 129 | 3300006847 | Ga0075431_100202139 | Ga0075431_1002021392 | 140 |
| 130 | 3300006847 | Ga0075431_100676986 | Ga0075431_1006769861 | 140 |
| 131 | 3300006852 | Ga0075433_10039634 | Ga0075433_100396344 | 140 |
| 132 | 3300006871 | Ga0075434_100009416 | Ga0075434_1000094165 | 140 |
| 133 | 3300006871 | Ga0075434_100141491 | Ga0075434_1001414913 | 140 |
| 134 | 3300006871 | Ga0075434_100829036 | Ga0075434_1008290361 | 140 |
| 135 | 3300006881 | Ga0068865_100723475 | Ga0068865_1007234751 | 140 |
| 136 | 3300006931 | Ga0097620_101932354 | Ga0097620_1019323541 | 140 |
| 137 | 3300007076 | Ga0075435_101069694 | Ga0075435_1010696942 | 140 |
| 138 | 3300007265 | Ga0099794_10260653 | Ga0099794_102606531 | 140 |
| 139 | 3300007265 | Ga0099794_10382942 | Ga0099794_103829421 | 140 |
| 140 | 3300007788 | Ga0099795_10132347 | Ga0099795_101323472 | 140 |
| 141 | 3300009092 | Ga0105250_10180588 | Ga0105250_101805882 | 140 |
| 142 | 3300009093 | Ga0105240_10008228 | Ga0105240_100082287 | 140 |
| 143 | 3300009093 | Ga0105240_10025163 | Ga0105240_100251637 | 140 |
| 144 | 3300009093 | Ga0105240_10034925 | Ga0105240_100349252 | 140 |
| 145 | 3300009093 | Ga0105240_10119042 | Ga0105240_101190423 | 140 |
| 146 | 3300009093 | Ga0105240_10319663 | Ga0105240_103196632 | 140 |
| 147 | 3300009093 | Ga0105240_10446450 | Ga0105240_104464501 | 140 |
| 148 | 3300009093 | Ga0105240_10700525 | Ga0105240_107005252 | 140 |
| 149 | 3300009093 | Ga0105240_11237479 | Ga0105240_112374791 | 140 |
| 150 | 3300009094 | Ga0111539_10096842 | Ga0111539_100968422 | 140 |
| 151 | 3300009094 | Ga0111539_11399713 | Ga0111539_113997132 | 140 |
| 152 | 3300009101 | Ga0105247_10020697 | Ga0105247_100206976 | 140 |
| 153 | 3300009147 | Ga0114129_10199236 | Ga0114129_101992363 | 140 |
| 154 | 3300009148 | Ga0105243_10168296 | Ga0105243_101682962 | 140 |
| 155 | 3300009174 | Ga0105241_10183608 | Ga0105241_101836083 | 140 |
| 156 | 3300009174 | Ga0105241_10409658 | Ga0105241_104096581 | 140 |
| 157 | 3300009174 | Ga0105241_11431570 | Ga0105241_114315701 | 140 |
| 158 | 3300009176 | Ga0105242_10308217 | Ga0105242_103082172 | 140 |
| 159 | 3300009177 | Ga0105248_10443284 | Ga0105248_104432842 | 140 |
| 160 | 3300009177 | Ga0105248_11255553 | Ga0105248_112555531 | 140 |
| 161 | 3300009545 | Ga0105237_10087226 | Ga0105237_100872262 | 140 |
| 162 | 3300009545 | Ga0105237_10308543 | Ga0105237_103085432 | 140 |
| 163 | 3300009545 | Ga0105237_10314445 | Ga0105237_103144452 | 140 |
| 164 | 3300009545 | Ga0105237_10597072 | Ga0105237_105970722 | 140 |
| 165 | 3300009551 | Ga0105238_10327759 | Ga0105238_103277591 | 140 |
| 166 | 3300009551 | Ga0105238_10396926 | Ga0105238_103969261 | 140 |
| 167 | 3300009551 | Ga0105238_10551198 | Ga0105238_105511981 | 140 |
| 168 | 3300009551 | Ga0105238_10628931 | Ga0105238_106289312 | 140 |
| 169 | 3300009553 | Ga0105249_10918808 | Ga0105249_109188081 | 140 |
| 170 | 3300010159 | Ga0099796_10035679 | Ga0099796_100356792 | 140 |
| 171 | 3300010159 | Ga0099796_10296410 | Ga0099796_102964102 | 140 |
| 172 | 3300010159 | Ga0099796_10297563 | Ga0099796_102975631 | 140 |
| 173 | 3300010375 | Ga0105239_10183036 | Ga0105239_101830362 | 140 |
| 174 | 3300010375 | Ga0105239_10326897 | Ga0105239_103268972 | 140 |
| 175 | 3300011119 | Ga0105246_10370205 | Ga0105246_103702051 | 140 |
| 176 | 3300011119 | Ga0105246_10586826 | Ga0105246_105868262 | 140 |
| 177 | 3300011119 | Ga0105246_10900599 | Ga0105246_109005992 | 140 |
| 178 | 3300013104 | Ga0157370_10384041 | Ga0157370_103840411 | 140 |
| 179 | 3300013104 | Ga0157370_10615181 | Ga0157370_106151811 | 140 |
| 180 | 3300013105 | Ga0157369_10022993 | Ga0157369_100229932 | 140 |
| 181 | 3300013296 | Ga0157374_11517769 | Ga0157374_115177691 | 140 |
| 182 | 3300013307 | Ga0157372_10089798 | Ga0157372_100897984 | 140 |
| 183 | 3300013307 | Ga0157372_10342081 | Ga0157372_103420811 | 140 |
| 184 | 3300013307 | Ga0157372_11561944 | Ga0157372_115619441 | 140 |
| 185 | 3300013307 | Ga0157372_12491906 | Ga0157372_124919062 | 140 |
| 186 | 3300014325 | Ga0163163_10669104 | Ga0163163_106691042 | 140 |
| 187 | 3300014326 | Ga0157380_10024283 | Ga0157380_100242834 | 140 |
| 188 | 3300014326 | Ga0157380_10665249 | Ga0157380_106652491 | 140 |
| 189 | 3300014497 | Ga0182008_10321497 | Ga0182008_103214971 | 140 |
| 190 | 3300014968 | Ga0157379_10434281 | Ga0157379_104342811 | 140 |
| 191 | 3300014968 | Ga0157379_10765968 | Ga0157379_107659681 | 140 |
| 192 | 3300014968 | Ga0157379_11708494 | Ga0157379_117084941 | 140 |
| 193 | 3300020080 | Ga0206350_10558986 | Ga0206350_105589861 | 140 |
| 194 | 3300021377 | Ga0213874_10004811 | Ga0213874_100048112 | 140 |
| 195 | 3300021384 | Ga0213876_10002439 | Ga0213876_100024399 | 140 |
| 196 | 3300025297 | Ga0209758_1010679 | Ga0209758_10106793 | 140 |
| 197 | 3300025321 | Ga0207656_10009884 | Ga0207656_100098843 | 140 |
| 198 | 3300025898 | Ga0207692_10030296 | Ga0207692_100302962 | 140 |
| 199 | 3300025898 | Ga0207692_10249709 | Ga0207692_102497092 | 140 |
| 200 | 3300025898 | Ga0207692_10304060 | Ga0207692_103040602 | 140 |
| 201 | 3300025900 | Ga0207710_10041589 | Ga0207710_100415892 | 140 |
| 202 | 3300025900 | Ga0207710_10510175 | Ga0207710_105101751 | 140 |
| 203 | 3300025904 | Ga0207647_10001150 | Ga0207647_100011507 | 140 |
| 204 | 3300025905 | Ga0207685_10035260 | Ga0207685_100352602 | 140 |
| 205 | 3300025906 | Ga0207699_10392537 | Ga0207699_103925371 | 140 |
| 206 | 3300025909 | Ga0207705_10131695 | Ga0207705_101316951 | 140 |
| 207 | 3300025910 | Ga0207684_10026519 | Ga0207684_100265193 | 140 |
| 208 | 3300025910 | Ga0207684_10136222 | Ga0207684_101362222 | 140 |
| 209 | 3300025910 | Ga0207684_10162406 | Ga0207684_101624061 | 140 |
| 210 | 3300025910 | Ga0207684_10441230 | Ga0207684_104412302 | 140 |
| 211 | 3300025910 | Ga0207684_10501734 | Ga0207684_105017341 | 140 |
| 212 | 3300025911 | Ga0207654_10140837 | Ga0207654_101408373 | 140 |
| 213 | 3300025912 | Ga0207707_10004560 | Ga0207707_1000456012 | 140 |
| 214 | 3300025912 | Ga0207707_10020346 | Ga0207707_100203463 | 140 |
| 215 | 3300025912 | Ga0207707_10024650 | Ga0207707_100246504 | 140 |
| 216 | 3300025912 | Ga0207707_10872923 | Ga0207707_108729231 | 140 |
| 217 | 3300025913 | Ga0207695_10139548 | Ga0207695_101395482 | 140 |
| 218 | 3300025913 | Ga0207695_10239588 | Ga0207695_102395882 | 140 |
| 219 | 3300025913 | Ga0207695_10536178 | Ga0207695_105361781 | 140 |
| 220 | 3300025913 | Ga0207695_10759439 | Ga0207695_107594391 | 140 |
| 221 | 3300025914 | Ga0207671_10354779 | Ga0207671_103547792 | 140 |
| 222 | 3300025914 | Ga0207671_10436004 | Ga0207671_104360042 | 140 |
| 223 | 3300025915 | Ga0207693_10003024 | Ga0207693_1000302410 | 140 |
| 224 | 3300025915 | Ga0207693_10016511 | Ga0207693_100165112 | 140 |
| 225 | 3300025916 | Ga0207663_10159791 | Ga0207663_101597912 | 140 |
| 226 | 3300025916 | Ga0207663_10435955 | Ga0207663_104359553 | 140 |
| 227 | 3300025917 | Ga0207660_10018837 | Ga0207660_100188373 | 140 |
| 228 | 3300025917 | Ga0207660_10034045 | Ga0207660_100340452 | 140 |
| 229 | 3300025917 | Ga0207660_10088047 | Ga0207660_100880473 | 140 |
| 230 | 3300025917 | Ga0207660_10298033 | Ga0207660_102980333 | 140 |
| 231 | 3300025919 | Ga0207657_10001686 | Ga0207657_100016862 | 140 |
| 232 | 3300025921 | Ga0207652_10026633 | Ga0207652_100266334 | 140 |
| 233 | 3300025921 | Ga0207652_10134241 | Ga0207652_101342411 | 140 |
| 234 | 3300025921 | Ga0207652_10882487 | Ga0207652_108824871 | 140 |
| 235 | 3300025922 | Ga0207646_10146103 | Ga0207646_101461033 | 140 |
| 236 | 3300025922 | Ga0207646_10191506 | Ga0207646_101915062 | 140 |
| 237 | 3300025922 | Ga0207646_10472958 | Ga0207646_104729582 | 140 |
| 238 | 3300025922 | Ga0207646_11282762 | Ga0207646_112827621 | 140 |
| 239 | 3300025924 | Ga0207694_10416516 | Ga0207694_104165162 | 140 |
| 240 | 3300025924 | Ga0207694_10422836 | Ga0207694_104228362 | 140 |
| 241 | 3300025924 | Ga0207694_10569032 | Ga0207694_105690321 | 140 |
| 242 | 3300025924 | Ga0207694_11705966 | Ga0207694_117059661 | 140 |
| 243 | 3300025928 | Ga0207700_10030214 | Ga0207700_100302142 | 140 |
| 244 | 3300025928 | Ga0207700_10044665 | Ga0207700_100446652 | 140 |
| 245 | 3300025928 | Ga0207700_10231832 | Ga0207700_102318322 | 140 |
| 246 | 3300025928 | Ga0207700_10459730 | Ga0207700_104597301 | 140 |
| 247 | 3300025928 | Ga0207700_11037597 | Ga0207700_110375971 | 140 |
| 248 | 3300025929 | Ga0207664_10231044 | Ga0207664_102310442 | 140 |
| 249 | 3300025932 | Ga0207690_10984086 | Ga0207690_109840861 | 140 |
| 250 | 3300025933 | Ga0207706_10020446 | Ga0207706_100204462 | 140 |
| 251 | 3300025933 | Ga0207706_10537567 | Ga0207706_105375672 | 140 |
| 252 | 3300025934 | Ga0207686_10408149 | Ga0207686_104081491 | 140 |
| 253 | 3300025935 | Ga0207709_10767372 | Ga0207709_107673722 | 140 |
| 254 | 3300025939 | Ga0207665_10076784 | Ga0207665_100767842 | 140 |
| 255 | 3300025939 | Ga0207665_10199348 | Ga0207665_101993482 | 140 |
| 256 | 3300025939 | Ga0207665_10355356 | Ga0207665_103553561 | 140 |
| 257 | 3300025941 | Ga0207711_10290572 | Ga0207711_102905721 | 140 |
| 258 | 3300025941 | Ga0207711_11506519 | Ga0207711_115065191 | 140 |
| 259 | 3300025944 | Ga0207661_10105390 | Ga0207661_101053902 | 140 |
| 260 | 3300025944 | Ga0207661_10769850 | Ga0207661_107698501 | 140 |
| 261 | 3300025945 | Ga0207679_10583720 | Ga0207679_105837202 | 140 |
| 262 | 3300025949 | Ga0207667_10002324 | Ga0207667_1000232425 | 140 |
| 263 | 3300025949 | Ga0207667_10134382 | Ga0207667_101343822 | 140 |
| 264 | 3300025949 | Ga0207667_10141261 | Ga0207667_101412613 | 140 |
| 265 | 3300025949 | Ga0207667_10207927 | Ga0207667_102079272 | 140 |
| 266 | 3300025949 | Ga0207667_10574085 | Ga0207667_105740851 | 140 |
| 267 | 3300025972 | Ga0207668_10347002 | Ga0207668_103470021 | 140 |
| 268 | 3300025981 | Ga0207640_10064044 | Ga0207640_100640441 | 140 |
| 269 | 3300025981 | Ga0207640_10268994 | Ga0207640_102689941 | 140 |
| 270 | 3300026023 | Ga0207677_10994739 | Ga0207677_109947391 | 140 |
| 271 | 3300026035 | Ga0207703_10226653 | Ga0207703_102266532 | 140 |
| 272 | 3300026035 | Ga0207703_10414504 | Ga0207703_104145041 | 140 |
| 273 | 3300026041 | Ga0207639_10027807 | Ga0207639_100278072 | 140 |
| 274 | 3300026041 | Ga0207639_10031138 | Ga0207639_100311382 | 140 |
| 275 | 3300026041 | Ga0207639_10763573 | Ga0207639_107635731 | 140 |
| 276 | 3300026041 | Ga0207639_10791686 | Ga0207639_107916861 | 140 |
| 277 | 3300026041 | Ga0207639_10875804 | Ga0207639_108758042 | 140 |
| 278 | 3300026075 | Ga0207708_10261964 | Ga0207708_102619642 | 140 |
| 279 | 3300026078 | Ga0207702_10082698 | Ga0207702_100826982 | 140 |
| 280 | 3300026078 | Ga0207702_10271587 | Ga0207702_102715872 | 140 |
| 281 | 3300026116 | Ga0207674_10000890 | Ga0207674_100008908 | 140 |
| 282 | 3300026118 | Ga0207675_100267690 | Ga0207675_1002676902 | 140 |
| 283 | 3300026121 | Ga0207683_10317716 | Ga0207683_103177162 | 140 |
| 284 | 3300026121 | Ga0207683_10442644 | Ga0207683_104426441 | 140 |
| 285 | 3300026142 | Ga0207698_10129747 | Ga0207698_101297473 | 140 |
| 286 | 3300026142 | Ga0207698_10311676 | Ga0207698_103116762 | 140 |
| 287 | 3300026142 | Ga0207698_10378844 | Ga0207698_103788442 | 140 |
| 288 | 3300026142 | Ga0207698_10644962 | Ga0207698_106449622 | 140 |
| 289 | 3300027866 | Ga0209813_10068471 | Ga0209813_100684712 | 140 |
| 290 | 3300028380 | Ga0268265_11486623 | Ga0268265_114866232 | 140 |
| 291 | 3300028666 | Ga0265336_10000561 | Ga0265336_1000056113 | 140 |
| 292 | 3300028800 | Ga0265338_10000598 | Ga0265338_1000059825 | 140 |
| 293 | 3300029957 | Ga0265324_10007924 | Ga0265324_100079242 | 140 |
| 294 | 3300031241 | Ga0265325_10234468 | Ga0265325_102344681 | 140 |
| 295 | 3300031548 | Ga0307408_100465623 | Ga0307408_1004656231 | 140 |
| 296 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000250 | 140 |
| 297 | 3300031616 | Ga0307508_10118780 | Ga0307508_101187801 | 140 |
| 298 | 3300031730 | Ga0307516_10478017 | Ga0307516_104780171 | 140 |
| 299 | 3300031731 | Ga0307405_10309161 | Ga0307405_103091612 | 140 |
| 300 | 3300031824 | Ga0307413_10172076 | Ga0307413_101720762 | 140 |
| 301 | 3300031911 | Ga0307412_10073156 | Ga0307412_100731562 | 140 |
| 302 | 3300031995 | Ga0307409_100063990 | Ga0307409_1000639904 | 140 |
| 303 | 3300032002 | Ga0307416_100696806 | Ga0307416_1006968062 | 140 |
| 304 | 3300032004 | Ga0307414_11316499 | Ga0307414_113164991 | 140 |
| 305 | 3300032126 | Ga0307415_100353214 | Ga0307415_1003532142 | 140 |
| 306 | 3300033547 | Ga0316212_1013448 | Ga0316212_10134481 | 140 |
| 307 | 3300035083 | Ga0373926_0325374 | Ga0373926_0325374_136_591 | 140 |
| 308 | 3300035085 | Ga0373929_0072506 | Ga0373929_0072506_132_554 | 140 |
| 309 | 3300035086 | Ga0373934_0030126 | Ga0373934_0030126_630_1052 | 140 |
| 310 | 3300035089 | Ga0373944_0071082 | Ga0373944_0071082_492_914 | 140 |
| 311 | 3300035120 | Ga0373957_0110646 | Ga0373957_0110646_204_644 | 140 |
| 312 | 3300035170 | Ga0373943_0104716 | Ga0373943_0104716_211_648 | 140 |
| 313 | 3300035171 | Ga0373946_0097285 | Ga0373946_0097285_213_635 | 140 |
| 314 | 3300035691 | Ga0373931_0158583 | Ga0373931_0158583_88_534 | 140 |
| 315 | 3300035691 | Ga0373931_0371116 | Ga0373931_0371116_151_573 | 140 |
| 316 | 3300035695 | Ga0373927_0020725 | Ga0373927_0020725_1734_2156 | 140 |
| 317 | 3300035695 | Ga0373927_0106878 | Ga0373927_0106878_281_703 | 140 |
| 318 | 3300035695 | Ga0373927_0178839 | Ga0373927_0178839_177_626 | 140 |
| 319 | 3300035695 | Ga0373927_0361772 | Ga0373927_0361772_31_507 | 140 |
| 320 | 3300035724 | Ga0373933_0153594 | Ga0373933_0153594_277_717 | 140 |
| 321 | 3300035724 | Ga0373933_0243998 | Ga0373933_0243998_169_591 | 140 |
| 322 | 3300035725 | Ga0373947_0034928 | Ga0373947_0034928_474_896 | 140 |
| 323 | 3300035725 | Ga0373947_0038463 | Ga0373947_0038463_2274_2696 | 140 |
| 324 | 3300036401 | Ga0373937_0001232 | Ga0373937_0001232_17201_17641 | 140 |
| 325 | 3300036401 | Ga0373937_0099477 | Ga0373937_0099477_1278_1727 | 140 |
| 326 | 3300036401 | Ga0373937_0250346 | Ga0373937_0250346_956_1405 | 140 |
| 327 | 3300036401 | Ga0373937_0503118 | Ga0373937_0503118_459_881 | 140 |
| 328 | 3300037068 | Ga0373925_0208743 | Ga0373925_0208743_348_797 | 140 |
| 329 | 3300037068 | Ga0373925_1172854 | Ga0373925_1172854_36_458 | 140 |
| 330 | 3300037418 | Ga0395900_0284311 | Ga0395900_0284311_60_482 | 140 |
| 331 | 3300037418 | Ga0395900_0783580 | Ga0395900_0783580_20_442 | 140 |
| 332 | 3300037466 | Ga0395898_0135802 | Ga0395898_0135802_664_1086 | 140 |
| 333 | 3300037466 | Ga0395898_0345278 | Ga0395898_0345278_109_531 | 140 |
| 334 | 3300037853 | Ga0436364_1079344 | Ga0436364_1079344_872_1294 | 140 |
| 335 | 3300038443 | Ga0395901_0082818 | Ga0395901_0082818_655_1077 | 140 |
| 336 | 3300039437 | Ga0436365_0949897 | Ga0436365_0949897_9918_10340 | 140 |
| 337 | 3300039438 | Ga0436360_0705531 | Ga0436360_0705531_113_562 | 140 |
| 338 | 3300039447 | Ga0436361_0390802 | Ga0436361_0390802_258_683 | 140 |
| 339 | 3300039450 | Ga0436363_0183469 | Ga0436363_0183469_173_595 | 140 |
| 340 | 3300039450 | Ga0436363_1106154 | Ga0436363_1106154_2031_2453 | 140 |
| 341 | 3300039450 | Ga0436363_1113695 | Ga0436363_1113695_254_676 | 140 |
| 342 | 3300039450 | Ga0436363_1162239 | Ga0436363_1162239_124_546 | 140 |
| 343 | 3300039453 | Ga0436362_0356181 | Ga0436362_0356181_104_526 | 140 |
| 344 | 3300041413 | Ga0439465_0428837 | Ga0439465_0428837_31_456 | 140 |
| 345 | 3300041459 | Ga0451800_0378216 | Ga0451800_0378216_201_623 | 140 |
| 346 | 3300041486 | Ga0451807_2244634 | Ga0451807_2244634_148_588 | 140 |
| 347 | 3300041491 | Ga0451833_0934222 | Ga0451833_0934222_99_521 | 140 |
| 348 | 3300041503 | Ga0451847_0207748 | Ga0451847_0207748_589_1014 | 140 |
| 349 | 3300041997 | Ga0439431_0052444 | Ga0439431_0052444_415_840 | 140 |
| 350 | 3300042007 | Ga0439449_0249877 | Ga0439449_0249877_54_479 | 140 |
| 351 | 3300046455 | Ga0495603_0230605 | Ga0495603_0230605_218_640 | 140 |
| 352 | 3300046458 | Ga0495591_077697 | Ga0495591_077697_129_551 | 140 |
| 353 | 3300046472 | Ga0495580_0167212 | Ga0495580_0167212_411_848 | 140 |
| 354 | 3300046491 | Ga0495584_0038683 | Ga0495584_0038683_1202_1624 | 140 |
| 355 | 3300046492 | Ga0495585_0237175 | Ga0495585_0237175_65_487 | 140 |
| 356 | 3300046507 | Ga0495606_0098603 | Ga0495606_0098603_1031_1453 | 140 |
| 357 | 3300046512 | Ga0495610_0163312 | Ga0495610_0163312_448_870 | 140 |
| 358 | 3300046518 | Ga0495631_0077982 | Ga0495631_0077982_666_1088 | 140 |
| 359 | 3300046525 | Ga0495663_0065999 | Ga0495663_0065999_548_973 | 140 |
| 360 | 3300046528 | Ga0495642_0306624 | Ga0495642_0306624_135_584 | 140 |
| 361 | 3300046531 | Ga0495665_0018870 | Ga0495665_0018870_3087_3509 | 140 |
| 362 | 3300046537 | Ga0495598_0069381 | Ga0495598_0069381_199_621 | 140 |
| 363 | 3300046539 | Ga0495621_0137765 | Ga0495621_0137765_230_652 | 140 |
| 364 | 3300046559 | Ga0495667_0816226 | Ga0495667_0816226_72_494 | 140 |
| 365 | 3300046642 | Ga0495634_0021849 | Ga0495634_0021849_916_1338 | 140 |
| 366 | 3300046664 | Ga0495659_0101234 | Ga0495659_0101234_35_457 | 140 |
| 367 | 3300046680 | Ga0495646_0314031 | Ga0495646_0314031_17_439 | 140 |
| 368 | 3300046684 | Ga0495669_0190716 | Ga0495669_0190716_469_918 | 140 |
| 369 | 3300046684 | Ga0495669_0493424 | Ga0495669_0493424_128_550 | 140 |
| 370 | 3300046691 | Ga0495670_0026408 | Ga0495670_0026408_693_1115 | 140 |
| 371 | 3300046794 | Ga0495589_0228638 | Ga0495589_0228638_101_523 | 140 |
| 372 | 3300047319 | Ga0495674_0267662 | Ga0495674_0267662_57_479 | 140 |
| 373 | 3300047319 | Ga0495674_1061485 | Ga0495674_1061485_166_588 | 140 |
| 374 | 3300047320 | Ga0495672_0037992 | Ga0495672_0037992_973_1395 | 140 |
| 375 | 3300047320 | Ga0495672_0205540 | Ga0495672_0205540_86_508 | 140 |
| 376 | 3300048091 | Ga0495626_0133385 | Ga0495626_0133385_202_624 | 140 |
| 377 | 3300048903 | Ga0496100_0002006 | Ga0496100_0002006_3005_3427 | 140 |
| 378 | 3300048904 | Ga0496101_0002012 | Ga0496101_0002012_6376_6798 | 140 |
| 379 | 3300048905 | Ga0496102_0010048 | Ga0496102_0010048_5521_5943 | 140 |
| 380 | 3300048906 | Ga0496103_0082460 | Ga0496103_0082460_1172_1594 | 140 |
| 381 | 3300048906 | Ga0496103_0194119 | Ga0496103_0194119_182_628 | 140 |
| 382 | 3300048907 | Ga0496104_0002158 | Ga0496104_0002158_15673_16095 | 140 |
| 383 | 3300048907 | Ga0496104_0057252 | Ga0496104_0057252_442_864 | 140 |
| 384 | 3300048907 | Ga0496104_0172953 | Ga0496104_0172953_1456_1902 | 140 |
| 385 | 3300048908 | Ga0496105_0099753 | Ga0496105_0099753_1255_1701 | 140 |
| 386 | 3300048908 | Ga0496105_0103932 | Ga0496105_0103932_1827_2249 | 140 |
| 387 | 3300048908 | Ga0496105_1039204 | Ga0496105_1039204_179_601 | 140 |
| 388 | 3300048909 | Ga0496106_0065542 | Ga0496106_0065542_1834_2280 | 140 |
| 389 | 3300048909 | Ga0496106_0421148 | Ga0496106_0421148_475_897 | 140 |
| 390 | 3300048910 | Ga0496107_0002129 | Ga0496107_0002129_7416_7838 | 140 |
| 391 | 3300048910 | Ga0496107_0020391 | Ga0496107_0020391_3566_4012 | 140 |
| 392 | 3300048910 | Ga0496107_0515071 | Ga0496107_0515071_53_475 | 140 |
| 393 | 3300048911 | Ga0496108_0001911 | Ga0496108_0001911_14126_14548 | 140 |
| 394 | 3300048911 | Ga0496108_0093687 | Ga0496108_0093687_262_684 | 140 |
| 395 | 3300048911 | Ga0496108_0166493 | Ga0496108_0166493_873_1295 | 140 |
| 396 | 3300048912 | Ga0496109_0019720 | Ga0496109_0019720_3377_3799 | 140 |
| 397 | 3300048912 | Ga0496109_0042051 | Ga0496109_0042051_3109_3531 | 140 |
| 398 | 3300048912 | Ga0496109_0729787 | Ga0496109_0729787_245_667 | 140 |
| 399 | 3300048912 | Ga0496109_1223770 | Ga0496109_1223770_240_662 | 140 |
| 400 | 3300048913 | Ga0496110_0002553 | Ga0496110_0002553_2338_2760 | 140 |
| 401 | 3300048913 | Ga0496110_0015885 | Ga0496110_0015885_5593_6015 | 140 |
| 402 | 3300048913 | Ga0496110_0350608 | Ga0496110_0350608_833_1255 | 140 |
| 403 | 3300048914 | Ga0496111_0024906 | Ga0496111_0024906_1576_1998 | 140 |
| 404 | 3300048915 | Ga0496112_0004008 | Ga0496112_0004008_9589_10011 | 140 |
| 405 | 3300048915 | Ga0496112_0005493 | Ga0496112_0005493_5790_6212 | 140 |
| 406 | 3300048916 | Ga0496113_0025475 | Ga0496113_0025475_808_1254 | 140 |
| 407 | 3300048916 | Ga0496113_0051637 | Ga0496113_0051637_1266_1688 | 140 |
| 408 | 3300048916 | Ga0496113_0105002 | Ga0496113_0105002_136_558 | 140 |
| 409 | 3300048917 | Ga0496114_0199681 | Ga0496114_0199681_1285_1731 | 140 |
| 410 | 3300048918 | Ga0496115_0101061 | Ga0496115_0101061_1680_2102 | 140 |
| 411 | 3300048924 | Ga0496121_0111723 | Ga0496121_0111723_353_775 | 140 |
| 412 | 3300048929 | Ga0496126_0013784 | Ga0496126_0013784_387_821 | 140 |
| 413 | 3300048929 | Ga0496126_0063532 | Ga0496126_0063532_2345_2779 | 140 |
| 414 | 3300049568 | Ga0501031_0341062 | Ga0501031_0341062_189_620 | 140 |
| 415 | 3300049569 | Ga0501032_0048170 | Ga0501032_0048170_434_865 | 140 |
| 416 | 3300049570 | Ga0501033_0078626 | Ga0501033_0078626_275_706 | 140 |
| 417 | 3300049571 | Ga0501034_1142352 | Ga0501034_1142352_40_462 | 140 |
| 418 | 3300049572 | Ga0501036_0082368 | Ga0501036_0082368_1012_1443 | 140 |
| 419 | 3300049573 | Ga0501037_0113028 | Ga0501037_0113028_152_583 | 140 |
| 420 | 3300049574 | Ga0501038_0065986 | Ga0501038_0065986_2501_2932 | 140 |
| 421 | 3300049574 | Ga0501038_0293986 | Ga0501038_0293986_712_1236 | 140 |
| 422 | 3300049575 | Ga0501039_0727367 | Ga0501039_0727367_212_643 | 140 |
| 423 | 3300049576 | Ga0501040_0234533 | Ga0501040_0234533_625_1074 | 140 |
| 424 | 3300049577 | Ga0501041_0314403 | Ga0501041_0314403_428_922 | 140 |
| 425 | 3300049577 | Ga0501041_0346222 | Ga0501041_0346222_67_591 | 140 |
| 426 | 3300049579 | Ga0501043_0000636 | Ga0501043_0000636_15361_15792 | 140 |
| 427 | 3300049580 | Ga0501046_0003152 | Ga0501046_0003152_170_601 | 140 |
| 428 | 3300049580 | Ga0501046_0218855 | Ga0501046_0218855_465_983 | 140 |
| 429 | 3300049581 | Ga0501047_0096335 | Ga0501047_0096335_152_583 | 140 |
| 430 | 3300049582 | Ga0501048_0051141 | Ga0501048_0051141_2079_2510 | 140 |
| 431 | 3300049583 | Ga0501067_0005936 | Ga0501067_0005936_6174_6605 | 140 |
| 432 | 3300049585 | Ga0501069_0062769 | Ga0501069_0062769_1448_1879 | 140 |
| 433 | 3300049588 | Ga0501072_0127364 | Ga0501072_0127364_193_642 | 140 |
| 434 | 3300049589 | Ga0501073_0032862 | Ga0501073_0032862_1367_1798 | 140 |
| 435 | 3300049590 | Ga0501074_0085565 | Ga0501074_0085565_1201_1632 | 140 |
| 436 | 3300049591 | Ga0501075_0028488 | Ga0501075_0028488_2699_3148 | 140 |
| 437 | 3300049591 | Ga0501075_0193477 | Ga0501075_0193477_177_701 | 140 |
| 438 | 3300049591 | Ga0501075_0204738 | Ga0501075_0204738_491_1009 | 140 |
| 439 | 3300049661 | Ga0501217_115449 | Ga0501217_115449_337_762 | 140 |
| 440 | 3300049704 | Ga0501221_089602 | Ga0501221_089602_260_685 | 140 |
| 441 | 3300049742 | Ga0501080_0107253 | Ga0501080_0107253_1537_1986 | 140 |
| 442 | 3300049743 | Ga0501081_0066188 | Ga0501081_0066188_897_1421 | 140 |
| 443 | 3300049744 | Ga0501083_0040135 | Ga0501083_0040135_489_920 | 140 |
| 444 | 3300049822 | Ga0501035_0352776 | Ga0501035_0352776_50_481 | 140 |
| 445 | 3300049823 | Ga0501044_0020671 | Ga0501044_0020671_2168_2599 | 140 |
| 446 | 3300049824 | Ga0501045_0457878 | Ga0501045_0457878_273_800 | 140 |
| 447 | 3300049824 | Ga0501045_0842677 | Ga0501045_0842677_202_651 | 140 |
| 448 | 3300050489 | nmdc:mga03683_72354_c1 | nmdc:mga03683_72354_c1_964_1386 | 140 |
| 449 | 3300050490 | nmdc:mga03n38_495505_c1 | nmdc:mga03n38_495505_c1_249_674 | 140 |
| 450 | 3300050490 | nmdc:mga03n38_874593_c1 | nmdc:mga03n38_874593_c1_57_482 | 140 |
| 451 | 3300050491 | nmdc:mga00v17_4843_c2 | nmdc:mga00v17_4843_c2_600_1022 | 140 |
| 452 | 3300050492 | nmdc:mga0yw44_49339_c1 | nmdc:mga0yw44_49339_c1_1305_1727 | 140 |
| 453 | 3300050493 | nmdc:mga0k408_280321_c1 | nmdc:mga0k408_280321_c1_17_442 | 140 |
| 454 | 3300050494 | nmdc:mga06z11_110545_c1 | nmdc:mga06z11_110545_c1_932_1354 | 140 |
| 455 | 3300050495 | nmdc:mga04h51_62011_c1 | nmdc:mga04h51_62011_c1_271_693 | 140 |
| 456 | 3300050496 | nmdc:mga07m45_13451_c1 | nmdc:mga07m45_13451_c1_3521_3946 | 140 |
| 457 | 3300050508 | nmdc:mga09592_336369_c1 | nmdc:mga09592_336369_c1_354_881 | 140 |
| 458 | 3300050510 | nmdc:mga06r32_423813_c1 | nmdc:mga06r32_423813_c1_284_811 | 140 |
| 459 | 3300050511 | nmdc:mga08y16_70447_c1 | nmdc:mga08y16_70447_c1_2162_2683 | 140 |
| 460 | 3300050512 | nmdc:mga0n895_19441_c1 | nmdc:mga0n895_19441_c1_4917_5438 | 140 |
| 461 | 3300050513 | nmdc:mga0rr50_227749_c1 | nmdc:mga0rr50_227749_c1_978_1400 | 140 |
| 462 | 3300050513 | nmdc:mga0rr50_293089_c1 | nmdc:mga0rr50_293089_c1_199_621 | 140 |
| 463 | 3300050513 | nmdc:mga0rr50_956887_c1 | nmdc:mga0rr50_956887_c1_111_638 | 140 |
| 464 | 3300050514 | nmdc:mga08x19_92294_c1 | nmdc:mga08x19_92294_c1_828_1250 | 140 |
| 465 | 3300050515 | nmdc:mga0a205_7307_c1 | nmdc:mga0a205_7307_c1_8784_9305 | 140 |
| 466 | 3300053085 | Ga0495619_1007879 | Ga0495619_1007879_81_521 | 140 |
| 467 | 3300053119 | Ga0500595_013452 | Ga0500595_013452_2457_2879 | 140 |
| 468 | 3300053139 | Ga0500568_0057551 | Ga0500568_0057551_306_728 | 140 |
| 469 | 3300053139 | Ga0500568_0066582 | Ga0500568_0066582_755_1177 | 140 |
| 470 | 3300053153 | Ga0500616_0012208 | Ga0500616_0012208_4257_4697 | 140 |
| 471 | 3300054114 | Ga0501084_0029062 | Ga0501084_0029062_49_480 | 140 |
| 472 | 3300054114 | Ga0501084_0099789 | Ga0501084_0099789_1897_2415 | 140 |
| 473 | 3300054114 | Ga0501084_0452502 | Ga0501084_0452502_480_998 | 140 |
| 474 | 3300060353 | Ga0501082_0024421 | Ga0501082_0024421_3905_4336 | 140 |
| 475 | 3300060353 | Ga0501082_0343231 | Ga0501082_0343231_816_1265 | 140 |
| 476 | 3300060353 | Ga0501082_0415747 | Ga0501082_0415747_126_644 | 140 |
| 477 | 3300061734 | Ga0530510_0470834 | Ga0530510_0470834_31_549 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wkq-assembly1.cif.gz_A | 2.10 a resolution structure of ipab (residues 74-242) from shigella flexneri | 0.6544 | 2 | 111 |
| 1or3-assembly1.cif.gz_A | apolipoprotein e3 (apoe3), trigonal truncation mutant 165 | 0.6412 | 9 | 128 |
| 1nfo-assembly1.cif.gz_A | apolipoprotein e2 (apoe2, d154a mutation) | 0.6216 | 9 | 132 |
| 6x8n-assembly2.cif.gz_B | crystal structure of h49a able mutant | 0.6211 | 5 | 130 |
| 1ya9-assembly1.cif.gz_A | crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e | 0.6168 | 3 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nfoA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein | 0.6216 | 9 | 132 | 1.20.120.20 |
| 1ya9A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein | 0.6168 | 3 | 127 | 1.20.120.20 |
| af_O62236_4_120_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6027 | 2 | 123 | 1.20.58.70 |
| af_Q0WRW8_184_365_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5982 | 5 | 130 | 1.20.120.1770 |
| af_P93654_17_132_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5853 | 2 | 109 | 1.20.58.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y2J9X3-F1-model_v4 | Protoporphyrinogen IX oxidase | 1.003 | 2 | 106 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A170PUU5-F1-model_v4 | deleted | 0.9988 | 2 | 107 |
|
| AF-A0A7C5IUV1-F1-model_v4 | Protoporphyrinogen IX oxidase | 0.9957 | 3 | 67 |
GO:0005886
GO:0006782 GO:0016491 GO:0046872 |
| AF-A0A528NWT4-F1-model_v4 | deleted | 0.9929 | 2 | 71 |
|
| AF-A0A3D1L6P9-F1-model_v4 | deleted | 0.992 | 2 | 106 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar