F451675

General Info

Members Datasets Scaffolds Average Seq Length
477 278 477 144

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_101111839|Ga0075428_1011118391
Length 164
Sequence VLATSRRWLRAAIAIAVTLALVAILVLWRPSGLYPWLKALHVIAIIAWMAGMLYLPRLFVYHCDAEPGSKQSETFKLMERRLLTVIINPAMVLSWALGLWAAGWLQAKVVLVLMLSALQGFFVRWVRDFANDANRHSPKFYRIVNEVPTILMIGIVILAVVKPF

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
182 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
197 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.24
Nodule 0
Rhizoplane 7.55
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 3.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003399 3300001989 Bacteria 6073
2 JGI24737J22298_10000493 3300001990 Bacteria 13715
3 JGI24735J21928_10018703 3300002067 Bacteria 2135
4 JGI25153J46596_10104910 3300003215 Bacteria 658
5 Ga0070658_10071586 3300005327 Bacteria 2840
6 Ga0070683_100082697 3300005329 Bacteria 3007
7 Ga0070683_101009581 3300005329 Bacteria 799
8 Ga0070690_100168043 3300005330 Bacteria 1508
9 Ga0070680_100011100 3300005336 Bacteria 6964
10 Ga0070680_100101410 3300005336 Bacteria 2389
11 Ga0070680_100139162 3300005336 Bacteria 2035
12 Ga0070682_100018296 3300005337 Bacteria 4093
13 Ga0070660_100098180 3300005339 Bacteria 2318
14 Ga0070691_10083610 3300005341 Bacteria 1566
15 Ga0070691_10267268 3300005341 Bacteria 923
16 Ga0070659_100131525 3300005366 Bacteria 2033
17 Ga0070659_101202664 3300005366 Bacteria 670
18 Ga0070709_10072463 3300005434 Bacteria 2227
19 Ga0070714_100051084 3300005435 Bacteria 3524
20 Ga0070714_100068153 3300005435 Bacteria 3070
21 Ga0070713_100007994 3300005436 Bacteria 7475
22 Ga0070713_100012129 3300005436 Bacteria 6310
23 Ga0070713_100029489 3300005436 Bacteria 4347
24 Ga0070713_100103151 3300005436 Bacteria 2475
25 Ga0070713_100267088 3300005436 Bacteria 1565
26 Ga0070713_100382378 3300005436 Bacteria 1312
27 Ga0070710_10184651 3300005437 Bacteria 1308
28 Ga0070710_10303376 3300005437 Bacteria 1043
29 Ga0070701_10542958 3300005438 Bacteria 761
30 Ga0070711_100003792 3300005439 Bacteria 8870
31 Ga0070711_100053458 3300005439 Bacteria 2783
32 Ga0070711_100117333 3300005439 Bacteria 1963
33 Ga0070711_100126406 3300005439 Bacteria 1898
34 Ga0070711_100139447 3300005439 Bacteria 1816
35 Ga0070705_100994677 3300005440 Bacteria 680
36 Ga0070700_100182443 3300005441 Bacteria 1462
37 Ga0070700_101202722 3300005441 Bacteria 633
38 Ga0070708_100081054 3300005445 Bacteria 2938
39 Ga0070678_100271787 3300005456 Bacteria 1430
40 Ga0070678_100532120 3300005456 Bacteria 1041
41 Ga0070662_100155691 3300005457 Bacteria 1784
42 Ga0070662_100461749 3300005457 Bacteria 1055
43 Ga0070681_10041750 3300005458 Bacteria 4598
44 Ga0070681_10095970 3300005458 Bacteria 2913
45 Ga0070681_10112235 3300005458 Bacteria 2665
46 Ga0070681_10634078 3300005458 Bacteria 983
47 Ga0070706_100029870 3300005467 Bacteria 5020
48 Ga0070706_100048436 3300005467 Bacteria 3922
49 Ga0070706_100316908 3300005467 Bacteria 1455
50 Ga0070707_100015766 3300005468 Bacteria 7093
51 Ga0070707_101120721 3300005468 Bacteria 753
52 Ga0070698_100150267 3300005471 Bacteria 2277
53 Ga0070698_100344875 3300005471 Bacteria 1421
54 Ga0070699_100002071 3300005518 Bacteria 18145
55 Ga0070699_100841037 3300005518 Bacteria 840
56 Ga0070699_101693583 3300005518 Bacteria 579
57 Ga0070679_100018483 3300005530 Bacteria 6765
58 Ga0070679_100127684 3300005530 Bacteria 2524
59 Ga0070679_100300273 3300005530 Bacteria 1556
60 Ga0070679_100390077 3300005530 Bacteria 1339
61 Ga0070679_100491896 3300005530 Bacteria 1171
62 Ga0070684_100131797 3300005535 Bacteria 2255
63 Ga0070697_100047518 3300005536 Bacteria 3479
64 Ga0070697_100071040 3300005536 Bacteria 2855
65 Ga0070697_100406518 3300005536 Bacteria 1182
66 Ga0068853_100133988 3300005539 Bacteria 2220
67 Ga0068853_100217752 3300005539 Bacteria 1743
68 Ga0068853_101005837 3300005539 Bacteria 803
69 Ga0070696_100377488 3300005546 Bacteria 1104
70 Ga0070693_100040944 3300005547 Bacteria 2604
71 Ga0070693_100141757 3300005547 Bacteria 1514
72 Ga0070693_100978322 3300005547 Bacteria 639
73 Ga0070693_101062022 3300005547 Bacteria 616
74 Ga0068855_100015846 3300005563 Bacteria 9068
75 Ga0068855_100128067 3300005563 Bacteria 2901
76 Ga0068855_100186449 3300005563 Bacteria 2343
77 Ga0068855_100256215 3300005563 Bacteria 1951
78 Ga0068855_100642119 3300005563 Bacteria 1141
79 Ga0070664_100232828 3300005564 Bacteria 1651
80 Ga0070664_100591021 3300005564 Bacteria 1029
81 Ga0068857_100022934 3300005577 Bacteria 5491
82 Ga0068854_100272254 3300005578 Bacteria 1360
83 Ga0068854_100387699 3300005578 Bacteria 1153
84 Ga0068856_100066450 3300005614 Bacteria 3563
85 Ga0068856_100845032 3300005614 Bacteria 935
86 Ga0068856_101378687 3300005614 Bacteria 720
87 Ga0068852_100098557 3300005616 Bacteria 2632
88 Ga0068852_100318075 3300005616 Bacteria 1511
89 Ga0068861_100302890 3300005719 Bacteria 1385
90 Ga0068851_10011049 3300005834 Bacteria 4227
91 Ga0068858_100392536 3300005842 Bacteria 1332
92 Ga0081538_10060559 3300005981 Bacteria 2176
93 Ga0081538_10111530 3300005981 Bacteria 1341
94 Ga0081540_1038509 3300005983 Bacteria 2520
95 Ga0070717_10070756 3300006028 Bacteria 2908
96 Ga0070717_10306775 3300006028 Bacteria 1412
97 Ga0070717_10344302 3300006028 Bacteria 1332
98 Ga0075365_10001911 3300006038 Bacteria 9819
99 Ga0075365_10158734 3300006038 Bacteria 1575
100 Ga0075368_10073013 3300006042 Bacteria 1388
101 Ga0075368_10154350 3300006042 Bacteria 960
102 Ga0075363_100033366 3300006048 Bacteria 2680
103 Ga0075363_100361803 3300006048 Bacteria 849
104 Ga0075364_10036006 3300006051 Bacteria 3199
105 Ga0075432_10132462 3300006058 Bacteria 945
106 Ga0070715_10047134 3300006163 Bacteria 1835
107 Ga0070716_100074523 3300006173 Bacteria 2005
108 Ga0070712_100000967 3300006175 Bacteria 17301
109 Ga0070712_100097287 3300006175 Bacteria 2169
110 Ga0075362_10087508 3300006177 Bacteria 1443
111 Ga0097621_100624510 3300006237 Bacteria 987
112 Ga0068871_101263509 3300006358 Bacteria 694
113 Ga0075428_100246588 3300006844 Bacteria 1926
114 Ga0075428_100271781 3300006844 Bacteria 1824
115 Ga0075428_101111839 3300006844 Bacteria 834
116 Ga0075430_100053052 3300006846 Bacteria 3414
117 Ga0075430_100726631 3300006846 Bacteria 819
118 Ga0075431_100202139 3300006847 Bacteria 2032
119 Ga0075431_100676986 3300006847 Bacteria 1010
120 Ga0075433_10039634 3300006852 Bacteria 4075
121 Ga0075434_100009416 3300006871 Bacteria 9104
122 Ga0075434_100141491 3300006871 Bacteria 2426
123 Ga0075434_100829036 3300006871 Bacteria 941
124 Ga0068865_100723475 3300006881 Bacteria 852
125 Ga0097620_101932354 3300006931 Bacteria 652
126 Ga0075435_101069694 3300007076 Bacteria 705
127 Ga0099794_10260653 3300007265 Bacteria 895
128 Ga0099794_10382942 3300007265 Bacteria 734
129 Ga0099795_10132347 3300007788 Bacteria 1008
130 Ga0105250_10180588 3300009092 Bacteria 885
131 Ga0105240_10008228 3300009093 Bacteria 14944
132 Ga0105240_10025163 3300009093 Bacteria 7828
133 Ga0105240_10034925 3300009093 Bacteria 6482
134 Ga0105240_10119042 3300009093 Bacteria 3182
135 Ga0105240_10319663 3300009093 Bacteria 1770
136 Ga0105240_10446450 3300009093 Bacteria 1448
137 Ga0105240_10700525 3300009093 Bacteria 1105
138 Ga0105240_11237479 3300009093 Bacteria 789
139 Ga0111539_10096842 3300009094 Bacteria 3466
140 Ga0111539_11399713 3300009094 Bacteria 811
141 Ga0105247_10020697 3300009101 Bacteria 3954
142 Ga0114129_10119907 3300009147 Bacteria 3623
143 Ga0114129_10199236 3300009147 Bacteria 2713
144 Ga0105243_10168296 3300009148 Bacteria 1896
145 Ga0105241_10183608 3300009174 Bacteria 1737
146 Ga0105241_10409658 3300009174 Bacteria 1191
147 Ga0105241_11431570 3300009174 Bacteria 663
148 Ga0105242_10308217 3300009176 Bacteria 1448
149 Ga0105248_10443284 3300009177 Bacteria 1463
150 Ga0105248_11255553 3300009177 Bacteria 838
151 Ga0105237_10087226 3300009545 Bacteria 3110
152 Ga0105237_10308543 3300009545 Bacteria 1585
153 Ga0105237_10314445 3300009545 Bacteria 1569
154 Ga0105237_10597072 3300009545 Bacteria 1111
155 Ga0105238_10327759 3300009551 Bacteria 1518
156 Ga0105238_10396926 3300009551 Bacteria 1372
157 Ga0105238_10551198 3300009551 Bacteria 1157
158 Ga0105238_10628931 3300009551 Bacteria 1083
159 Ga0105249_10918808 3300009553 Bacteria 942
160 Ga0099796_10035679 3300010159 Bacteria 1651
161 Ga0099796_10296410 3300010159 Bacteria 684
162 Ga0099796_10297563 3300010159 Bacteria 683
163 Ga0105239_10183036 3300010375 Bacteria 2344
164 Ga0105239_10326897 3300010375 Bacteria 1730
165 Ga0105246_10370205 3300011119 Bacteria 1180
166 Ga0105246_10586826 3300011119 Bacteria 961
167 Ga0105246_10900599 3300011119 Bacteria 793
168 Ga0157370_10384041 3300013104 Bacteria 1293
169 Ga0157370_10615181 3300013104 Bacteria 994
170 Ga0157369_10022993 3300013105 Bacteria 6949
171 Ga0157374_11517769 3300013296 Bacteria 693
172 Ga0157372_10089798 3300013307 Bacteria 3491
173 Ga0157372_10342081 3300013307 Bacteria 1743
174 Ga0157372_11561944 3300013307 Bacteria 760
175 Ga0157372_12491906 3300013307 Bacteria 594
176 Ga0163163_10669104 3300014325 Bacteria 1102
177 Ga0157380_10024283 3300014326 Bacteria 4586
178 Ga0157380_10665249 3300014326 Bacteria 1041
179 Ga0182008_10321497 3300014497 Bacteria 814
180 Ga0157379_10434281 3300014968 Bacteria 1210
181 Ga0157379_10765968 3300014968 Bacteria 909
182 Ga0157379_11708494 3300014968 Bacteria 617
183 Ga0206350_10558986 3300020080 Bacteria 586
184 Ga0213874_10004811 3300021377 Bacteria 3115
185 Ga0213876_10002439 3300021384 Bacteria 10933
186 Ga0209758_1010679 3300025297 Bacteria 5453
187 Ga0207656_10009884 3300025321 Bacteria 3553
188 Ga0207692_10030296 3300025898 Bacteria 2579
189 Ga0207692_10249709 3300025898 Bacteria 1063
190 Ga0207692_10304060 3300025898 Bacteria 971
191 Ga0207710_10041589 3300025900 Bacteria 2039
192 Ga0207710_10510175 3300025900 Bacteria 624
193 Ga0207647_10001150 3300025904 Bacteria 20374
194 Ga0207685_10035260 3300025905 Bacteria 1825
195 Ga0207699_10392537 3300025906 Bacteria 987
196 Ga0207705_10131695 3300025909 Bacteria 1861
197 Ga0207684_10026519 3300025910 Bacteria 4940
198 Ga0207684_10136222 3300025910 Bacteria 2109
199 Ga0207684_10162406 3300025910 Bacteria 1924
200 Ga0207684_10441230 3300025910 Bacteria 1118
201 Ga0207684_10501734 3300025910 Bacteria 1040
202 Ga0207654_10140837 3300025911 Bacteria 1538
203 Ga0207707_10004560 3300025912 Bacteria 12178
204 Ga0207707_10020346 3300025912 Bacteria 5794
205 Ga0207707_10024650 3300025912 Bacteria 5264
206 Ga0207707_10872923 3300025912 Bacteria 745
207 Ga0207695_10139548 3300025913 Bacteria 2374
208 Ga0207695_10239588 3300025913 Bacteria 1716
209 Ga0207695_10536178 3300025913 Bacteria 1052
210 Ga0207695_10759439 3300025913 Bacteria 850
211 Ga0207671_10354779 3300025914 Bacteria 1163
212 Ga0207671_10436004 3300025914 Bacteria 1043
213 Ga0207693_10003024 3300025915 Bacteria 14534
214 Ga0207693_10016511 3300025915 Bacteria 5899
215 Ga0207663_10159791 3300025916 Bacteria 1589
216 Ga0207663_10435955 3300025916 Bacteria 1008
217 Ga0207660_10018837 3300025917 Bacteria 4608
218 Ga0207660_10034045 3300025917 Bacteria 3528
219 Ga0207660_10088047 3300025917 Bacteria 2295
220 Ga0207660_10298033 3300025917 Bacteria 1283
221 Ga0207657_10001686 3300025919 Bacteria 23826
222 Ga0207652_10026633 3300025921 Bacteria 4818
223 Ga0207652_10134241 3300025921 Bacteria 2209
224 Ga0207652_10882487 3300025921 Bacteria 791
225 Ga0207646_10146103 3300025922 Bacteria 2131
226 Ga0207646_10191506 3300025922 Bacteria 1847
227 Ga0207646_10472958 3300025922 Bacteria 1130
228 Ga0207646_11282762 3300025922 Bacteria 640
229 Ga0207694_10416516 3300025924 Bacteria 1119
230 Ga0207694_10422836 3300025924 Bacteria 1110
231 Ga0207694_10569032 3300025924 Bacteria 952
232 Ga0207694_11705966 3300025924 Bacteria 530
233 Ga0207700_10030214 3300025928 Bacteria 3834
234 Ga0207700_10044665 3300025928 Bacteria 3264
235 Ga0207700_10231832 3300025928 Bacteria 1570
236 Ga0207700_10459730 3300025928 Bacteria 1123
237 Ga0207700_11037597 3300025928 Bacteria 733
238 Ga0207664_10231044 3300025929 Bacteria 1608
239 Ga0207690_10984086 3300025932 Bacteria 701
240 Ga0207706_10020446 3300025933 Bacteria 5951
241 Ga0207706_10537567 3300025933 Bacteria 1007
242 Ga0207686_10408149 3300025934 Bacteria 1036
243 Ga0207709_10767372 3300025935 Bacteria 776
244 Ga0207665_10076784 3300025939 Bacteria 2292
245 Ga0207665_10199348 3300025939 Bacteria 1458
246 Ga0207665_10355356 3300025939 Bacteria 1107
247 Ga0207711_10290572 3300025941 Bacteria 1507
248 Ga0207711_11506519 3300025941 Bacteria 616
249 Ga0207661_10105390 3300025944 Bacteria 2375
250 Ga0207661_10769850 3300025944 Bacteria 886
251 Ga0207679_10583720 3300025945 Bacteria 1005
252 Ga0207667_10002324 3300025949 Bacteria 23814
253 Ga0207667_10134382 3300025949 Bacteria 2547
254 Ga0207667_10141261 3300025949 Bacteria 2479
255 Ga0207667_10207927 3300025949 Bacteria 2006
256 Ga0207667_10574085 3300025949 Bacteria 1139
257 Ga0207668_10347002 3300025972 Bacteria 1240
258 Ga0207640_10064044 3300025981 Bacteria 2446
259 Ga0207640_10268994 3300025981 Bacteria 1332
260 Ga0207677_10994739 3300026023 Bacteria 760
261 Ga0207703_10226653 3300026035 Bacteria 1673
262 Ga0207703_10414504 3300026035 Bacteria 1252
263 Ga0207639_10027807 3300026041 Bacteria 4123
264 Ga0207639_10031138 3300026041 Bacteria 3918
265 Ga0207639_10763573 3300026041 Bacteria 899
266 Ga0207639_10791686 3300026041 Bacteria 883
267 Ga0207639_10875804 3300026041 Bacteria 839
268 Ga0207708_10261964 3300026075 Bacteria 1396
269 Ga0207702_10082698 3300026078 Bacteria 2792
270 Ga0207702_10271587 3300026078 Bacteria 1599
271 Ga0207674_10000890 3300026116 Bacteria 39065
272 Ga0207675_100267690 3300026118 Bacteria 1658
273 Ga0207683_10317716 3300026121 Bacteria 1426
274 Ga0207683_10442644 3300026121 Bacteria 1198
275 Ga0207698_10129747 3300026142 Bacteria 2152
276 Ga0207698_10311676 3300026142 Bacteria 1470
277 Ga0207698_10378844 3300026142 Bacteria 1345
278 Ga0207698_10644962 3300026142 Bacteria 1048
279 Ga0209813_10068471 3300027866 Bacteria 1149
280 Ga0268265_11486623 3300028380 Bacteria 681
281 Ga0265323_10053601 3300028653 Bacteria 1423
282 Ga0265336_10000561 3300028666 Bacteria 21059
283 Ga0265338_10000598 3300028800 Bacteria 63497
284 Ga0265324_10007924 3300029957 Bacteria 4261
285 Ga0265325_10234468 3300031241 Bacteria 836
286 Ga0307408_100465623 3300031548 Bacteria 1099
287 Ga0307508_10000002 3300031616 Bacteria 407635
288 Ga0307508_10118780 3300031616 Bacteria 2246
289 Ga0265342_10297467 3300031712 Bacteria 851
290 Ga0307516_10478017 3300031730 Bacteria 901
291 Ga0307405_10309161 3300031731 Bacteria 1202
292 Ga0307413_10172076 3300031824 Bacteria 1534
293 Ga0307412_10073156 3300031911 Bacteria 2344
294 Ga0307409_100063990 3300031995 Bacteria 2887
295 Ga0307416_100696806 3300032002 Bacteria 1104
296 Ga0307414_11316499 3300032004 Bacteria 670
297 Ga0307415_100353214 3300032126 Bacteria 1238
298 Ga0316212_1013448 3300033547 Bacteria 1161
299 Ga0373926_0325374 3300035083 Bacteria 602
300 Ga0373929_0072506 3300035085 Bacteria 826
301 Ga0373934_0030126 3300035086 Bacteria 2122
302 Ga0373944_0071082 3300035089 Bacteria 1134
303 Ga0373957_0110646 3300035120 Bacteria 1106
304 Ga0373943_0104716 3300035170 Bacteria 1485
305 Ga0373946_0097285 3300035171 Bacteria 1314
306 Ga0373931_0158583 3300035691 Bacteria 1324
307 Ga0373931_0371116 3300035691 Bacteria 900
308 Ga0373935_0510711 3300035692 Bacteria 873
309 Ga0373927_0020725 3300035695 Bacteria 4311
310 Ga0373927_0106878 3300035695 Bacteria 1822
311 Ga0373927_0178839 3300035695 Bacteria 1391
312 Ga0373927_0361772 3300035695 Bacteria 956
313 Ga0373933_0153594 3300035724 Bacteria 1459
314 Ga0373933_0243998 3300035724 Bacteria 1156
315 Ga0373947_0034928 3300035725 Bacteria 2975
316 Ga0373947_0038463 3300035725 Bacteria 2843
317 Ga0373937_0001232 3300036401 Bacteria 21520
318 Ga0373937_0099477 3300036401 Bacteria 2698
319 Ga0373937_0250346 3300036401 Bacteria 1670
320 Ga0373937_0503118 3300036401 Bacteria 1151
321 Ga0373925_0208743 3300037068 Bacteria 1555
322 Ga0373925_0409791 3300037068 Bacteria 1106
323 Ga0373925_1172854 3300037068 Bacteria 631
324 Ga0395900_0284311 3300037418 Bacteria 1645
325 Ga0395900_0783580 3300037418 Bacteria 882
326 Ga0395898_0135802 3300037466 Bacteria 2355
327 Ga0395898_0345278 3300037466 Bacteria 1419
328 Ga0436364_1079344 3300037853 Bacteria 1551
329 Ga0395901_0082818 3300038443 Bacteria 3352
330 Ga0436365_0949897 3300039437 Bacteria 15199
331 Ga0436360_0705531 3300039438 Bacteria 892
332 Ga0436361_0390802 3300039447 Bacteria 701
333 Ga0436363_0183469 3300039450 Bacteria 992
334 Ga0436363_1106154 3300039450 Bacteria 3898
335 Ga0436363_1113695 3300039450 Bacteria 764
336 Ga0436363_1162239 3300039450 Bacteria 1286
337 Ga0436362_0356181 3300039453 Bacteria 1934
338 Ga0439465_0428837 3300041413 Bacteria 505
339 Ga0451800_0378216 3300041459 Bacteria 724
340 Ga0451807_2244634 3300041486 Bacteria 763
341 Ga0451833_0934222 3300041491 Bacteria 676
342 Ga0451847_0207748 3300041503 Bacteria 1433
343 Ga0439431_0052444 3300041997 Bacteria 1060
344 Ga0439449_0249877 3300042007 Bacteria 667
345 Ga0495603_0230605 3300046455 Bacteria 1067
346 Ga0495591_077697 3300046458 Bacteria 851
347 Ga0495580_0167212 3300046472 Bacteria 1521
348 Ga0495584_0038683 3300046491 Bacteria 2411
349 Ga0495585_0237175 3300046492 Bacteria 914
350 Ga0495606_0098603 3300046507 Bacteria 1783
351 Ga0495610_0163312 3300046512 Bacteria 940
352 Ga0495631_0077982 3300046518 Bacteria 1430
353 Ga0495663_0065999 3300046525 Bacteria 1145
354 Ga0495642_0306624 3300046528 Bacteria 696
355 Ga0495665_0018870 3300046531 Bacteria 3706
356 Ga0495598_0069381 3300046537 Bacteria 1106
357 Ga0495621_0137765 3300046539 Bacteria 953
358 Ga0495667_0816226 3300046559 Bacteria 575
359 Ga0495634_0021849 3300046642 Bacteria 4516
360 Ga0495659_0101234 3300046664 Bacteria 1116
361 Ga0495646_0314031 3300046680 Bacteria 827
362 Ga0495669_0190716 3300046684 Bacteria 978
363 Ga0495669_0493424 3300046684 Bacteria 595
364 Ga0495670_0026408 3300046691 Bacteria 2874
365 Ga0495589_0228638 3300046794 Bacteria 873
366 Ga0495674_0267662 3300047319 Bacteria 1403
367 Ga0495674_1061485 3300047319 Bacteria 618
368 Ga0495672_0037992 3300047320 Bacteria 2941
369 Ga0495672_0205540 3300047320 Bacteria 982
370 Ga0495626_0133385 3300048091 Bacteria 1059
371 Ga0496100_0002006 3300048903 Bacteria 10183
372 Ga0496101_0002012 3300048904 Bacteria 12342
373 Ga0496102_0010048 3300048905 Bacteria 8140
374 Ga0496103_0082460 3300048906 Bacteria 2024
375 Ga0496103_0194119 3300048906 Bacteria 1305
376 Ga0496104_0002158 3300048907 Bacteria 17075
377 Ga0496104_0057252 3300048907 Bacteria 3688
378 Ga0496104_0172953 3300048907 Bacteria 2070
379 Ga0496105_0099753 3300048908 Bacteria 2398
380 Ga0496105_0103932 3300048908 Bacteria 2346
381 Ga0496105_1039204 3300048908 Bacteria 611
382 Ga0496106_0065542 3300048909 Bacteria 2765
383 Ga0496106_0421148 3300048909 Bacteria 1073
384 Ga0496107_0002129 3300048910 Bacteria 12689
385 Ga0496107_0020391 3300048910 Bacteria 4681
386 Ga0496107_0515071 3300048910 Bacteria 887
387 Ga0496108_0001911 3300048911 Bacteria 16662
388 Ga0496108_0093687 3300048911 Bacteria 2555
389 Ga0496108_0166493 3300048911 Bacteria 1906
390 Ga0496109_0019720 3300048912 Bacteria 5949
391 Ga0496109_0042051 3300048912 Bacteria 4139
392 Ga0496109_0729787 3300048912 Bacteria 928
393 Ga0496109_1223770 3300048912 Bacteria 687
394 Ga0496110_0002553 3300048913 Bacteria 13681
395 Ga0496110_0015885 3300048913 Bacteria 6276
396 Ga0496110_0350608 3300048913 Bacteria 1344
397 Ga0496111_0024906 3300048914 Bacteria 4220
398 Ga0496112_0004008 3300048915 Bacteria 12349
399 Ga0496112_0005493 3300048915 Bacteria 10973
400 Ga0496113_0025475 3300048916 Bacteria 4216
401 Ga0496113_0051637 3300048916 Bacteria 3069
402 Ga0496113_0105002 3300048916 Bacteria 2193
403 Ga0496114_0199681 3300048917 Bacteria 1751
404 Ga0496115_0101061 3300048918 Bacteria 2364
405 Ga0496121_0111723 3300048924 Bacteria 2083
406 Ga0496126_0013784 3300048929 Bacteria 8197
407 Ga0496126_0063532 3300048929 Bacteria 3309
408 Ga0501031_0341062 3300049568 Bacteria 970
409 Ga0501032_0048170 3300049569 Bacteria 2877
410 Ga0501033_0078626 3300049570 Bacteria 2420
411 Ga0501034_1142352 3300049571 Bacteria 659
412 Ga0501036_0082368 3300049572 Bacteria 2719
413 Ga0501037_0113028 3300049573 Bacteria 1955
414 Ga0501038_0065986 3300049574 Bacteria 3083
415 Ga0501038_0293986 3300049574 Bacteria 1276
416 Ga0501039_0727367 3300049575 Bacteria 776
417 Ga0501040_0234533 3300049576 Bacteria 1307
418 Ga0501041_0314403 3300049577 Bacteria 988
419 Ga0501041_0346222 3300049577 Bacteria 939
420 Ga0501043_0000636 3300049579 Bacteria 31054
421 Ga0501046_0003152 3300049580 Bacteria 15221
422 Ga0501046_0218855 3300049580 Bacteria 1411
423 Ga0501047_0096335 3300049581 Bacteria 2837
424 Ga0501048_0051141 3300049582 Bacteria 2942
425 Ga0501067_0005936 3300049583 Bacteria 6768
426 Ga0501069_0062769 3300049585 Bacteria 2074
427 Ga0501071_0231280 3300049587 Bacteria 1393
428 Ga0501072_0127364 3300049588 Bacteria 2029
429 Ga0501073_0032862 3300049589 Bacteria 3697
430 Ga0501074_0085565 3300049590 Bacteria 2259
431 Ga0501075_0028488 3300049591 Bacteria 4123
432 Ga0501075_0193477 3300049591 Bacteria 1551
433 Ga0501075_0204738 3300049591 Bacteria 1505
434 Ga0501217_115449 3300049661 Bacteria 775
435 Ga0501221_089602 3300049704 Bacteria 751
436 Ga0501080_0107253 3300049742 Bacteria 2589
437 Ga0501081_0066188 3300049743 Bacteria 2513
438 Ga0501083_0040135 3300049744 Bacteria 3177
439 Ga0501035_0352776 3300049822 Bacteria 1230
440 Ga0501044_0020671 3300049823 Bacteria 7028
441 Ga0501045_0457878 3300049824 Bacteria 948
442 Ga0501045_0842677 3300049824 Bacteria 674
443 nmdc:mga03683_390778_c1 3300050489 Bacteria 663
444 nmdc:mga03683_72354_c1 3300050489 Bacteria 1476
445 nmdc:mga03n38_495505_c1 3300050490 Bacteria 685
446 nmdc:mga03n38_874593_c1 3300050490 Bacteria 527
447 nmdc:mga00v17_4843_c2 3300050491 Bacteria 1065
448 nmdc:mga0yw44_49339_c1 3300050492 Bacteria 2540
449 nmdc:mga0k408_280321_c1 3300050493 Bacteria 995
450 nmdc:mga06z11_110545_c1 3300050494 Bacteria 1521
451 nmdc:mga04h51_62011_c1 3300050495 Bacteria 1284
452 nmdc:mga07m45_13451_c1 3300050496 Bacteria 4343
453 nmdc:mga05p37_451969_c1 3300050507 Bacteria 1487
454 nmdc:mga09592_100798_c1 3300050508 Bacteria 2473
455 nmdc:mga09592_336369_c1 3300050508 Bacteria 1307
456 nmdc:mga0qj67_15760_c1 3300050509 Bacteria 5725
457 nmdc:mga06r32_100618_c1 3300050510 Bacteria 2836
458 nmdc:mga06r32_423813_c1 3300050510 Bacteria 1312
459 nmdc:mga08y16_70447_c1 3300050511 Bacteria 3645
460 nmdc:mga0n895_19441_c1 3300050512 Bacteria 6314
461 nmdc:mga0rr50_227749_c1 3300050513 Bacteria 1541
462 nmdc:mga0rr50_293089_c1 3300050513 Bacteria 1360
463 nmdc:mga0rr50_956887_c1 3300050513 Bacteria 730
464 nmdc:mga08x19_92294_c1 3300050514 Bacteria 2000
465 nmdc:mga0a205_7307_c1 3300050515 Bacteria 9993
466 Ga0495619_1007879 3300053085 Bacteria 557
467 Ga0500595_013452 3300053119 Bacteria 3133
468 Ga0500568_0057551 3300053139 Bacteria 1512
469 Ga0500568_0066582 3300053139 Bacteria 1385
470 Ga0500616_0012208 3300053153 Bacteria 5033
471 Ga0501084_0029062 3300054114 Bacteria 4623
472 Ga0501084_0099789 3300054114 Bacteria 2438
473 Ga0501084_0452502 3300054114 Bacteria 1085
474 Ga0501082_0024421 3300060353 Bacteria 5210
475 Ga0501082_0343231 3300060353 Bacteria 1301
476 Ga0501082_0415747 3300060353 Bacteria 1174
477 Ga0530510_0470834 3300061734 Bacteria 951

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_451969_c1 nmdc:mga05p37_451969_c1_947_1429 124
2 3300050508 nmdc:mga09592_100798_c1 nmdc:mga09592_100798_c1_1862_2344 124
3 3300031712 Ga0265342_10297467 Ga0265342_102974671 130
4 3300006844 Ga0075428_101111839 Ga0075428_1011118391 132
5 3300009147 Ga0114129_10119907 Ga0114129_101199072 132
6 3300050509 nmdc:mga0qj67_15760_c1 nmdc:mga0qj67_15760_c1_3734_4216 132
7 3300050510 nmdc:mga06r32_100618_c1 nmdc:mga06r32_100618_c1_979_1461 132
8 3300035692 Ga0373935_0510711 Ga0373935_0510711_240_677 134
9 3300037068 Ga0373925_0409791 Ga0373925_0409791_162_599 134
10 3300028653 Ga0265323_10053601 Ga0265323_100536011 138
11 3300049587 Ga0501071_0231280 Ga0501071_0231280_335_835 138
12 3300050489 nmdc:mga03683_390778_c1 nmdc:mga03683_390778_c1_79_597 138
13 3300001989 JGI24739J22299_10003399 JGI24739J22299_100033997 140
14 3300001990 JGI24737J22298_10000493 JGI24737J22298_1000049312 140
15 3300002067 JGI24735J21928_10018703 JGI24735J21928_100187031 140
16 3300003215 JGI25153J46596_10104910 JGI25153J46596_101049101 140
17 3300005327 Ga0070658_10071586 Ga0070658_100715861 140
18 3300005329 Ga0070683_100082697 Ga0070683_1000826971 140
19 3300005329 Ga0070683_101009581 Ga0070683_1010095811 140
20 3300005330 Ga0070690_100168043 Ga0070690_1001680432 140
21 3300005336 Ga0070680_100011100 Ga0070680_1000111004 140
22 3300005336 Ga0070680_100101410 Ga0070680_1001014102 140
23 3300005336 Ga0070680_100139162 Ga0070680_1001391622 140
24 3300005337 Ga0070682_100018296 Ga0070682_1000182965 140
25 3300005339 Ga0070660_100098180 Ga0070660_1000981802 140
26 3300005341 Ga0070691_10083610 Ga0070691_100836102 140
27 3300005341 Ga0070691_10267268 Ga0070691_102672682 140
28 3300005366 Ga0070659_100131525 Ga0070659_1001315252 140
29 3300005366 Ga0070659_101202664 Ga0070659_1012026641 140
30 3300005434 Ga0070709_10072463 Ga0070709_100724632 140
31 3300005435 Ga0070714_100051084 Ga0070714_1000510844 140
32 3300005435 Ga0070714_100068153 Ga0070714_1000681532 140
33 3300005436 Ga0070713_100007994 Ga0070713_1000079943 140
34 3300005436 Ga0070713_100012129 Ga0070713_1000121292 140
35 3300005436 Ga0070713_100029489 Ga0070713_1000294893 140
36 3300005436 Ga0070713_100103151 Ga0070713_1001031513 140
37 3300005436 Ga0070713_100267088 Ga0070713_1002670881 140
38 3300005436 Ga0070713_100382378 Ga0070713_1003823781 140
39 3300005437 Ga0070710_10184651 Ga0070710_101846512 140
40 3300005437 Ga0070710_10303376 Ga0070710_103033762 140
41 3300005438 Ga0070701_10542958 Ga0070701_105429581 140
42 3300005439 Ga0070711_100003792 Ga0070711_1000037928 140
43 3300005439 Ga0070711_100053458 Ga0070711_1000534582 140
44 3300005439 Ga0070711_100117333 Ga0070711_1001173332 140
45 3300005439 Ga0070711_100126406 Ga0070711_1001264062 140
46 3300005439 Ga0070711_100139447 Ga0070711_1001394471 140
47 3300005440 Ga0070705_100994677 Ga0070705_1009946772 140
48 3300005441 Ga0070700_100182443 Ga0070700_1001824432 140
49 3300005441 Ga0070700_101202722 Ga0070700_1012027221 140
50 3300005445 Ga0070708_100081054 Ga0070708_1000810542 140
51 3300005456 Ga0070678_100271787 Ga0070678_1002717872 140
52 3300005456 Ga0070678_100532120 Ga0070678_1005321202 140
53 3300005457 Ga0070662_100155691 Ga0070662_1001556912 140
54 3300005457 Ga0070662_100461749 Ga0070662_1004617492 140
55 3300005458 Ga0070681_10041750 Ga0070681_100417502 140
56 3300005458 Ga0070681_10095970 Ga0070681_100959703 140
57 3300005458 Ga0070681_10112235 Ga0070681_101122354 140
58 3300005458 Ga0070681_10634078 Ga0070681_106340781 140
59 3300005467 Ga0070706_100029870 Ga0070706_1000298703 140
60 3300005467 Ga0070706_100048436 Ga0070706_1000484363 140
61 3300005467 Ga0070706_100316908 Ga0070706_1003169081 140
62 3300005468 Ga0070707_100015766 Ga0070707_1000157667 140
63 3300005468 Ga0070707_101120721 Ga0070707_1011207211 140
64 3300005471 Ga0070698_100150267 Ga0070698_1001502672 140
65 3300005471 Ga0070698_100344875 Ga0070698_1003448752 140
66 3300005518 Ga0070699_100002071 Ga0070699_1000020718 140
67 3300005518 Ga0070699_100841037 Ga0070699_1008410372 140
68 3300005518 Ga0070699_101693583 Ga0070699_1016935831 140
69 3300005530 Ga0070679_100018483 Ga0070679_1000184836 140
70 3300005530 Ga0070679_100127684 Ga0070679_1001276844 140
71 3300005530 Ga0070679_100300273 Ga0070679_1003002732 140
72 3300005530 Ga0070679_100390077 Ga0070679_1003900772 140
73 3300005530 Ga0070679_100491896 Ga0070679_1004918962 140
74 3300005535 Ga0070684_100131797 Ga0070684_1001317971 140
75 3300005536 Ga0070697_100047518 Ga0070697_1000475183 140
76 3300005536 Ga0070697_100071040 Ga0070697_1000710403 140
77 3300005536 Ga0070697_100406518 Ga0070697_1004065181 140
78 3300005539 Ga0068853_100133988 Ga0068853_1001339882 140
79 3300005539 Ga0068853_100217752 Ga0068853_1002177523 140
80 3300005539 Ga0068853_101005837 Ga0068853_1010058372 140
81 3300005546 Ga0070696_100377488 Ga0070696_1003774881 140
82 3300005547 Ga0070693_100040944 Ga0070693_1000409441 140
83 3300005547 Ga0070693_100141757 Ga0070693_1001417572 140
84 3300005547 Ga0070693_100978322 Ga0070693_1009783221 140
85 3300005547 Ga0070693_101062022 Ga0070693_1010620221 140
86 3300005563 Ga0068855_100015846 Ga0068855_1000158468 140
87 3300005563 Ga0068855_100128067 Ga0068855_1001280672 140
88 3300005563 Ga0068855_100186449 Ga0068855_1001864492 140
89 3300005563 Ga0068855_100256215 Ga0068855_1002562151 140
90 3300005563 Ga0068855_100642119 Ga0068855_1006421191 140
91 3300005564 Ga0070664_100232828 Ga0070664_1002328283 140
92 3300005564 Ga0070664_100591021 Ga0070664_1005910211 140
93 3300005577 Ga0068857_100022934 Ga0068857_1000229347 140
94 3300005578 Ga0068854_100272254 Ga0068854_1002722541 140
95 3300005578 Ga0068854_100387699 Ga0068854_1003876992 140
96 3300005614 Ga0068856_100066450 Ga0068856_1000664503 140
97 3300005614 Ga0068856_100845032 Ga0068856_1008450321 140
98 3300005614 Ga0068856_101378687 Ga0068856_1013786871 140
99 3300005616 Ga0068852_100098557 Ga0068852_1000985572 140
100 3300005616 Ga0068852_100318075 Ga0068852_1003180752 140
101 3300005719 Ga0068861_100302890 Ga0068861_1003028902 140
102 3300005834 Ga0068851_10011049 Ga0068851_100110493 140
103 3300005842 Ga0068858_100392536 Ga0068858_1003925361 140
104 3300005981 Ga0081538_10060559 Ga0081538_100605592 140
105 3300005981 Ga0081538_10111530 Ga0081538_101115302 140
106 3300005983 Ga0081540_1038509 Ga0081540_10385092 140
107 3300006028 Ga0070717_10070756 Ga0070717_100707561 140
108 3300006028 Ga0070717_10306775 Ga0070717_103067751 140
109 3300006028 Ga0070717_10344302 Ga0070717_103443022 140
110 3300006038 Ga0075365_10001911 Ga0075365_100019112 140
111 3300006038 Ga0075365_10158734 Ga0075365_101587342 140
112 3300006042 Ga0075368_10073013 Ga0075368_100730132 140
113 3300006042 Ga0075368_10154350 Ga0075368_101543501 140
114 3300006048 Ga0075363_100033366 Ga0075363_1000333661 140
115 3300006048 Ga0075363_100361803 Ga0075363_1003618032 140
116 3300006051 Ga0075364_10036006 Ga0075364_100360062 140
117 3300006058 Ga0075432_10132462 Ga0075432_101324622 140
118 3300006163 Ga0070715_10047134 Ga0070715_100471342 140
119 3300006173 Ga0070716_100074523 Ga0070716_1000745232 140
120 3300006175 Ga0070712_100000967 Ga0070712_1000009678 140
121 3300006175 Ga0070712_100097287 Ga0070712_1000972873 140
122 3300006177 Ga0075362_10087508 Ga0075362_100875082 140
123 3300006237 Ga0097621_100624510 Ga0097621_1006245103 140
124 3300006358 Ga0068871_101263509 Ga0068871_1012635091 140
125 3300006844 Ga0075428_100246588 Ga0075428_1002465882 140
126 3300006844 Ga0075428_100271781 Ga0075428_1002717812 140
127 3300006846 Ga0075430_100053052 Ga0075430_1000530524 140
128 3300006846 Ga0075430_100726631 Ga0075430_1007266312 140
129 3300006847 Ga0075431_100202139 Ga0075431_1002021392 140
130 3300006847 Ga0075431_100676986 Ga0075431_1006769861 140
131 3300006852 Ga0075433_10039634 Ga0075433_100396344 140
132 3300006871 Ga0075434_100009416 Ga0075434_1000094165 140
133 3300006871 Ga0075434_100141491 Ga0075434_1001414913 140
134 3300006871 Ga0075434_100829036 Ga0075434_1008290361 140
135 3300006881 Ga0068865_100723475 Ga0068865_1007234751 140
136 3300006931 Ga0097620_101932354 Ga0097620_1019323541 140
137 3300007076 Ga0075435_101069694 Ga0075435_1010696942 140
138 3300007265 Ga0099794_10260653 Ga0099794_102606531 140
139 3300007265 Ga0099794_10382942 Ga0099794_103829421 140
140 3300007788 Ga0099795_10132347 Ga0099795_101323472 140
141 3300009092 Ga0105250_10180588 Ga0105250_101805882 140
142 3300009093 Ga0105240_10008228 Ga0105240_100082287 140
143 3300009093 Ga0105240_10025163 Ga0105240_100251637 140
144 3300009093 Ga0105240_10034925 Ga0105240_100349252 140
145 3300009093 Ga0105240_10119042 Ga0105240_101190423 140
146 3300009093 Ga0105240_10319663 Ga0105240_103196632 140
147 3300009093 Ga0105240_10446450 Ga0105240_104464501 140
148 3300009093 Ga0105240_10700525 Ga0105240_107005252 140
149 3300009093 Ga0105240_11237479 Ga0105240_112374791 140
150 3300009094 Ga0111539_10096842 Ga0111539_100968422 140
151 3300009094 Ga0111539_11399713 Ga0111539_113997132 140
152 3300009101 Ga0105247_10020697 Ga0105247_100206976 140
153 3300009147 Ga0114129_10199236 Ga0114129_101992363 140
154 3300009148 Ga0105243_10168296 Ga0105243_101682962 140
155 3300009174 Ga0105241_10183608 Ga0105241_101836083 140
156 3300009174 Ga0105241_10409658 Ga0105241_104096581 140
157 3300009174 Ga0105241_11431570 Ga0105241_114315701 140
158 3300009176 Ga0105242_10308217 Ga0105242_103082172 140
159 3300009177 Ga0105248_10443284 Ga0105248_104432842 140
160 3300009177 Ga0105248_11255553 Ga0105248_112555531 140
161 3300009545 Ga0105237_10087226 Ga0105237_100872262 140
162 3300009545 Ga0105237_10308543 Ga0105237_103085432 140
163 3300009545 Ga0105237_10314445 Ga0105237_103144452 140
164 3300009545 Ga0105237_10597072 Ga0105237_105970722 140
165 3300009551 Ga0105238_10327759 Ga0105238_103277591 140
166 3300009551 Ga0105238_10396926 Ga0105238_103969261 140
167 3300009551 Ga0105238_10551198 Ga0105238_105511981 140
168 3300009551 Ga0105238_10628931 Ga0105238_106289312 140
169 3300009553 Ga0105249_10918808 Ga0105249_109188081 140
170 3300010159 Ga0099796_10035679 Ga0099796_100356792 140
171 3300010159 Ga0099796_10296410 Ga0099796_102964102 140
172 3300010159 Ga0099796_10297563 Ga0099796_102975631 140
173 3300010375 Ga0105239_10183036 Ga0105239_101830362 140
174 3300010375 Ga0105239_10326897 Ga0105239_103268972 140
175 3300011119 Ga0105246_10370205 Ga0105246_103702051 140
176 3300011119 Ga0105246_10586826 Ga0105246_105868262 140
177 3300011119 Ga0105246_10900599 Ga0105246_109005992 140
178 3300013104 Ga0157370_10384041 Ga0157370_103840411 140
179 3300013104 Ga0157370_10615181 Ga0157370_106151811 140
180 3300013105 Ga0157369_10022993 Ga0157369_100229932 140
181 3300013296 Ga0157374_11517769 Ga0157374_115177691 140
182 3300013307 Ga0157372_10089798 Ga0157372_100897984 140
183 3300013307 Ga0157372_10342081 Ga0157372_103420811 140
184 3300013307 Ga0157372_11561944 Ga0157372_115619441 140
185 3300013307 Ga0157372_12491906 Ga0157372_124919062 140
186 3300014325 Ga0163163_10669104 Ga0163163_106691042 140
187 3300014326 Ga0157380_10024283 Ga0157380_100242834 140
188 3300014326 Ga0157380_10665249 Ga0157380_106652491 140
189 3300014497 Ga0182008_10321497 Ga0182008_103214971 140
190 3300014968 Ga0157379_10434281 Ga0157379_104342811 140
191 3300014968 Ga0157379_10765968 Ga0157379_107659681 140
192 3300014968 Ga0157379_11708494 Ga0157379_117084941 140
193 3300020080 Ga0206350_10558986 Ga0206350_105589861 140
194 3300021377 Ga0213874_10004811 Ga0213874_100048112 140
195 3300021384 Ga0213876_10002439 Ga0213876_100024399 140
196 3300025297 Ga0209758_1010679 Ga0209758_10106793 140
197 3300025321 Ga0207656_10009884 Ga0207656_100098843 140
198 3300025898 Ga0207692_10030296 Ga0207692_100302962 140
199 3300025898 Ga0207692_10249709 Ga0207692_102497092 140
200 3300025898 Ga0207692_10304060 Ga0207692_103040602 140
201 3300025900 Ga0207710_10041589 Ga0207710_100415892 140
202 3300025900 Ga0207710_10510175 Ga0207710_105101751 140
203 3300025904 Ga0207647_10001150 Ga0207647_100011507 140
204 3300025905 Ga0207685_10035260 Ga0207685_100352602 140
205 3300025906 Ga0207699_10392537 Ga0207699_103925371 140
206 3300025909 Ga0207705_10131695 Ga0207705_101316951 140
207 3300025910 Ga0207684_10026519 Ga0207684_100265193 140
208 3300025910 Ga0207684_10136222 Ga0207684_101362222 140
209 3300025910 Ga0207684_10162406 Ga0207684_101624061 140
210 3300025910 Ga0207684_10441230 Ga0207684_104412302 140
211 3300025910 Ga0207684_10501734 Ga0207684_105017341 140
212 3300025911 Ga0207654_10140837 Ga0207654_101408373 140
213 3300025912 Ga0207707_10004560 Ga0207707_1000456012 140
214 3300025912 Ga0207707_10020346 Ga0207707_100203463 140
215 3300025912 Ga0207707_10024650 Ga0207707_100246504 140
216 3300025912 Ga0207707_10872923 Ga0207707_108729231 140
217 3300025913 Ga0207695_10139548 Ga0207695_101395482 140
218 3300025913 Ga0207695_10239588 Ga0207695_102395882 140
219 3300025913 Ga0207695_10536178 Ga0207695_105361781 140
220 3300025913 Ga0207695_10759439 Ga0207695_107594391 140
221 3300025914 Ga0207671_10354779 Ga0207671_103547792 140
222 3300025914 Ga0207671_10436004 Ga0207671_104360042 140
223 3300025915 Ga0207693_10003024 Ga0207693_1000302410 140
224 3300025915 Ga0207693_10016511 Ga0207693_100165112 140
225 3300025916 Ga0207663_10159791 Ga0207663_101597912 140
226 3300025916 Ga0207663_10435955 Ga0207663_104359553 140
227 3300025917 Ga0207660_10018837 Ga0207660_100188373 140
228 3300025917 Ga0207660_10034045 Ga0207660_100340452 140
229 3300025917 Ga0207660_10088047 Ga0207660_100880473 140
230 3300025917 Ga0207660_10298033 Ga0207660_102980333 140
231 3300025919 Ga0207657_10001686 Ga0207657_100016862 140
232 3300025921 Ga0207652_10026633 Ga0207652_100266334 140
233 3300025921 Ga0207652_10134241 Ga0207652_101342411 140
234 3300025921 Ga0207652_10882487 Ga0207652_108824871 140
235 3300025922 Ga0207646_10146103 Ga0207646_101461033 140
236 3300025922 Ga0207646_10191506 Ga0207646_101915062 140
237 3300025922 Ga0207646_10472958 Ga0207646_104729582 140
238 3300025922 Ga0207646_11282762 Ga0207646_112827621 140
239 3300025924 Ga0207694_10416516 Ga0207694_104165162 140
240 3300025924 Ga0207694_10422836 Ga0207694_104228362 140
241 3300025924 Ga0207694_10569032 Ga0207694_105690321 140
242 3300025924 Ga0207694_11705966 Ga0207694_117059661 140
243 3300025928 Ga0207700_10030214 Ga0207700_100302142 140
244 3300025928 Ga0207700_10044665 Ga0207700_100446652 140
245 3300025928 Ga0207700_10231832 Ga0207700_102318322 140
246 3300025928 Ga0207700_10459730 Ga0207700_104597301 140
247 3300025928 Ga0207700_11037597 Ga0207700_110375971 140
248 3300025929 Ga0207664_10231044 Ga0207664_102310442 140
249 3300025932 Ga0207690_10984086 Ga0207690_109840861 140
250 3300025933 Ga0207706_10020446 Ga0207706_100204462 140
251 3300025933 Ga0207706_10537567 Ga0207706_105375672 140
252 3300025934 Ga0207686_10408149 Ga0207686_104081491 140
253 3300025935 Ga0207709_10767372 Ga0207709_107673722 140
254 3300025939 Ga0207665_10076784 Ga0207665_100767842 140
255 3300025939 Ga0207665_10199348 Ga0207665_101993482 140
256 3300025939 Ga0207665_10355356 Ga0207665_103553561 140
257 3300025941 Ga0207711_10290572 Ga0207711_102905721 140
258 3300025941 Ga0207711_11506519 Ga0207711_115065191 140
259 3300025944 Ga0207661_10105390 Ga0207661_101053902 140
260 3300025944 Ga0207661_10769850 Ga0207661_107698501 140
261 3300025945 Ga0207679_10583720 Ga0207679_105837202 140
262 3300025949 Ga0207667_10002324 Ga0207667_1000232425 140
263 3300025949 Ga0207667_10134382 Ga0207667_101343822 140
264 3300025949 Ga0207667_10141261 Ga0207667_101412613 140
265 3300025949 Ga0207667_10207927 Ga0207667_102079272 140
266 3300025949 Ga0207667_10574085 Ga0207667_105740851 140
267 3300025972 Ga0207668_10347002 Ga0207668_103470021 140
268 3300025981 Ga0207640_10064044 Ga0207640_100640441 140
269 3300025981 Ga0207640_10268994 Ga0207640_102689941 140
270 3300026023 Ga0207677_10994739 Ga0207677_109947391 140
271 3300026035 Ga0207703_10226653 Ga0207703_102266532 140
272 3300026035 Ga0207703_10414504 Ga0207703_104145041 140
273 3300026041 Ga0207639_10027807 Ga0207639_100278072 140
274 3300026041 Ga0207639_10031138 Ga0207639_100311382 140
275 3300026041 Ga0207639_10763573 Ga0207639_107635731 140
276 3300026041 Ga0207639_10791686 Ga0207639_107916861 140
277 3300026041 Ga0207639_10875804 Ga0207639_108758042 140
278 3300026075 Ga0207708_10261964 Ga0207708_102619642 140
279 3300026078 Ga0207702_10082698 Ga0207702_100826982 140
280 3300026078 Ga0207702_10271587 Ga0207702_102715872 140
281 3300026116 Ga0207674_10000890 Ga0207674_100008908 140
282 3300026118 Ga0207675_100267690 Ga0207675_1002676902 140
283 3300026121 Ga0207683_10317716 Ga0207683_103177162 140
284 3300026121 Ga0207683_10442644 Ga0207683_104426441 140
285 3300026142 Ga0207698_10129747 Ga0207698_101297473 140
286 3300026142 Ga0207698_10311676 Ga0207698_103116762 140
287 3300026142 Ga0207698_10378844 Ga0207698_103788442 140
288 3300026142 Ga0207698_10644962 Ga0207698_106449622 140
289 3300027866 Ga0209813_10068471 Ga0209813_100684712 140
290 3300028380 Ga0268265_11486623 Ga0268265_114866232 140
291 3300028666 Ga0265336_10000561 Ga0265336_1000056113 140
292 3300028800 Ga0265338_10000598 Ga0265338_1000059825 140
293 3300029957 Ga0265324_10007924 Ga0265324_100079242 140
294 3300031241 Ga0265325_10234468 Ga0265325_102344681 140
295 3300031548 Ga0307408_100465623 Ga0307408_1004656231 140
296 3300031616 Ga0307508_10000002 Ga0307508_1000000250 140
297 3300031616 Ga0307508_10118780 Ga0307508_101187801 140
298 3300031730 Ga0307516_10478017 Ga0307516_104780171 140
299 3300031731 Ga0307405_10309161 Ga0307405_103091612 140
300 3300031824 Ga0307413_10172076 Ga0307413_101720762 140
301 3300031911 Ga0307412_10073156 Ga0307412_100731562 140
302 3300031995 Ga0307409_100063990 Ga0307409_1000639904 140
303 3300032002 Ga0307416_100696806 Ga0307416_1006968062 140
304 3300032004 Ga0307414_11316499 Ga0307414_113164991 140
305 3300032126 Ga0307415_100353214 Ga0307415_1003532142 140
306 3300033547 Ga0316212_1013448 Ga0316212_10134481 140
307 3300035083 Ga0373926_0325374 Ga0373926_0325374_136_591 140
308 3300035085 Ga0373929_0072506 Ga0373929_0072506_132_554 140
309 3300035086 Ga0373934_0030126 Ga0373934_0030126_630_1052 140
310 3300035089 Ga0373944_0071082 Ga0373944_0071082_492_914 140
311 3300035120 Ga0373957_0110646 Ga0373957_0110646_204_644 140
312 3300035170 Ga0373943_0104716 Ga0373943_0104716_211_648 140
313 3300035171 Ga0373946_0097285 Ga0373946_0097285_213_635 140
314 3300035691 Ga0373931_0158583 Ga0373931_0158583_88_534 140
315 3300035691 Ga0373931_0371116 Ga0373931_0371116_151_573 140
316 3300035695 Ga0373927_0020725 Ga0373927_0020725_1734_2156 140
317 3300035695 Ga0373927_0106878 Ga0373927_0106878_281_703 140
318 3300035695 Ga0373927_0178839 Ga0373927_0178839_177_626 140
319 3300035695 Ga0373927_0361772 Ga0373927_0361772_31_507 140
320 3300035724 Ga0373933_0153594 Ga0373933_0153594_277_717 140
321 3300035724 Ga0373933_0243998 Ga0373933_0243998_169_591 140
322 3300035725 Ga0373947_0034928 Ga0373947_0034928_474_896 140
323 3300035725 Ga0373947_0038463 Ga0373947_0038463_2274_2696 140
324 3300036401 Ga0373937_0001232 Ga0373937_0001232_17201_17641 140
325 3300036401 Ga0373937_0099477 Ga0373937_0099477_1278_1727 140
326 3300036401 Ga0373937_0250346 Ga0373937_0250346_956_1405 140
327 3300036401 Ga0373937_0503118 Ga0373937_0503118_459_881 140
328 3300037068 Ga0373925_0208743 Ga0373925_0208743_348_797 140
329 3300037068 Ga0373925_1172854 Ga0373925_1172854_36_458 140
330 3300037418 Ga0395900_0284311 Ga0395900_0284311_60_482 140
331 3300037418 Ga0395900_0783580 Ga0395900_0783580_20_442 140
332 3300037466 Ga0395898_0135802 Ga0395898_0135802_664_1086 140
333 3300037466 Ga0395898_0345278 Ga0395898_0345278_109_531 140
334 3300037853 Ga0436364_1079344 Ga0436364_1079344_872_1294 140
335 3300038443 Ga0395901_0082818 Ga0395901_0082818_655_1077 140
336 3300039437 Ga0436365_0949897 Ga0436365_0949897_9918_10340 140
337 3300039438 Ga0436360_0705531 Ga0436360_0705531_113_562 140
338 3300039447 Ga0436361_0390802 Ga0436361_0390802_258_683 140
339 3300039450 Ga0436363_0183469 Ga0436363_0183469_173_595 140
340 3300039450 Ga0436363_1106154 Ga0436363_1106154_2031_2453 140
341 3300039450 Ga0436363_1113695 Ga0436363_1113695_254_676 140
342 3300039450 Ga0436363_1162239 Ga0436363_1162239_124_546 140
343 3300039453 Ga0436362_0356181 Ga0436362_0356181_104_526 140
344 3300041413 Ga0439465_0428837 Ga0439465_0428837_31_456 140
345 3300041459 Ga0451800_0378216 Ga0451800_0378216_201_623 140
346 3300041486 Ga0451807_2244634 Ga0451807_2244634_148_588 140
347 3300041491 Ga0451833_0934222 Ga0451833_0934222_99_521 140
348 3300041503 Ga0451847_0207748 Ga0451847_0207748_589_1014 140
349 3300041997 Ga0439431_0052444 Ga0439431_0052444_415_840 140
350 3300042007 Ga0439449_0249877 Ga0439449_0249877_54_479 140
351 3300046455 Ga0495603_0230605 Ga0495603_0230605_218_640 140
352 3300046458 Ga0495591_077697 Ga0495591_077697_129_551 140
353 3300046472 Ga0495580_0167212 Ga0495580_0167212_411_848 140
354 3300046491 Ga0495584_0038683 Ga0495584_0038683_1202_1624 140
355 3300046492 Ga0495585_0237175 Ga0495585_0237175_65_487 140
356 3300046507 Ga0495606_0098603 Ga0495606_0098603_1031_1453 140
357 3300046512 Ga0495610_0163312 Ga0495610_0163312_448_870 140
358 3300046518 Ga0495631_0077982 Ga0495631_0077982_666_1088 140
359 3300046525 Ga0495663_0065999 Ga0495663_0065999_548_973 140
360 3300046528 Ga0495642_0306624 Ga0495642_0306624_135_584 140
361 3300046531 Ga0495665_0018870 Ga0495665_0018870_3087_3509 140
362 3300046537 Ga0495598_0069381 Ga0495598_0069381_199_621 140
363 3300046539 Ga0495621_0137765 Ga0495621_0137765_230_652 140
364 3300046559 Ga0495667_0816226 Ga0495667_0816226_72_494 140
365 3300046642 Ga0495634_0021849 Ga0495634_0021849_916_1338 140
366 3300046664 Ga0495659_0101234 Ga0495659_0101234_35_457 140
367 3300046680 Ga0495646_0314031 Ga0495646_0314031_17_439 140
368 3300046684 Ga0495669_0190716 Ga0495669_0190716_469_918 140
369 3300046684 Ga0495669_0493424 Ga0495669_0493424_128_550 140
370 3300046691 Ga0495670_0026408 Ga0495670_0026408_693_1115 140
371 3300046794 Ga0495589_0228638 Ga0495589_0228638_101_523 140
372 3300047319 Ga0495674_0267662 Ga0495674_0267662_57_479 140
373 3300047319 Ga0495674_1061485 Ga0495674_1061485_166_588 140
374 3300047320 Ga0495672_0037992 Ga0495672_0037992_973_1395 140
375 3300047320 Ga0495672_0205540 Ga0495672_0205540_86_508 140
376 3300048091 Ga0495626_0133385 Ga0495626_0133385_202_624 140
377 3300048903 Ga0496100_0002006 Ga0496100_0002006_3005_3427 140
378 3300048904 Ga0496101_0002012 Ga0496101_0002012_6376_6798 140
379 3300048905 Ga0496102_0010048 Ga0496102_0010048_5521_5943 140
380 3300048906 Ga0496103_0082460 Ga0496103_0082460_1172_1594 140
381 3300048906 Ga0496103_0194119 Ga0496103_0194119_182_628 140
382 3300048907 Ga0496104_0002158 Ga0496104_0002158_15673_16095 140
383 3300048907 Ga0496104_0057252 Ga0496104_0057252_442_864 140
384 3300048907 Ga0496104_0172953 Ga0496104_0172953_1456_1902 140
385 3300048908 Ga0496105_0099753 Ga0496105_0099753_1255_1701 140
386 3300048908 Ga0496105_0103932 Ga0496105_0103932_1827_2249 140
387 3300048908 Ga0496105_1039204 Ga0496105_1039204_179_601 140
388 3300048909 Ga0496106_0065542 Ga0496106_0065542_1834_2280 140
389 3300048909 Ga0496106_0421148 Ga0496106_0421148_475_897 140
390 3300048910 Ga0496107_0002129 Ga0496107_0002129_7416_7838 140
391 3300048910 Ga0496107_0020391 Ga0496107_0020391_3566_4012 140
392 3300048910 Ga0496107_0515071 Ga0496107_0515071_53_475 140
393 3300048911 Ga0496108_0001911 Ga0496108_0001911_14126_14548 140
394 3300048911 Ga0496108_0093687 Ga0496108_0093687_262_684 140
395 3300048911 Ga0496108_0166493 Ga0496108_0166493_873_1295 140
396 3300048912 Ga0496109_0019720 Ga0496109_0019720_3377_3799 140
397 3300048912 Ga0496109_0042051 Ga0496109_0042051_3109_3531 140
398 3300048912 Ga0496109_0729787 Ga0496109_0729787_245_667 140
399 3300048912 Ga0496109_1223770 Ga0496109_1223770_240_662 140
400 3300048913 Ga0496110_0002553 Ga0496110_0002553_2338_2760 140
401 3300048913 Ga0496110_0015885 Ga0496110_0015885_5593_6015 140
402 3300048913 Ga0496110_0350608 Ga0496110_0350608_833_1255 140
403 3300048914 Ga0496111_0024906 Ga0496111_0024906_1576_1998 140
404 3300048915 Ga0496112_0004008 Ga0496112_0004008_9589_10011 140
405 3300048915 Ga0496112_0005493 Ga0496112_0005493_5790_6212 140
406 3300048916 Ga0496113_0025475 Ga0496113_0025475_808_1254 140
407 3300048916 Ga0496113_0051637 Ga0496113_0051637_1266_1688 140
408 3300048916 Ga0496113_0105002 Ga0496113_0105002_136_558 140
409 3300048917 Ga0496114_0199681 Ga0496114_0199681_1285_1731 140
410 3300048918 Ga0496115_0101061 Ga0496115_0101061_1680_2102 140
411 3300048924 Ga0496121_0111723 Ga0496121_0111723_353_775 140
412 3300048929 Ga0496126_0013784 Ga0496126_0013784_387_821 140
413 3300048929 Ga0496126_0063532 Ga0496126_0063532_2345_2779 140
414 3300049568 Ga0501031_0341062 Ga0501031_0341062_189_620 140
415 3300049569 Ga0501032_0048170 Ga0501032_0048170_434_865 140
416 3300049570 Ga0501033_0078626 Ga0501033_0078626_275_706 140
417 3300049571 Ga0501034_1142352 Ga0501034_1142352_40_462 140
418 3300049572 Ga0501036_0082368 Ga0501036_0082368_1012_1443 140
419 3300049573 Ga0501037_0113028 Ga0501037_0113028_152_583 140
420 3300049574 Ga0501038_0065986 Ga0501038_0065986_2501_2932 140
421 3300049574 Ga0501038_0293986 Ga0501038_0293986_712_1236 140
422 3300049575 Ga0501039_0727367 Ga0501039_0727367_212_643 140
423 3300049576 Ga0501040_0234533 Ga0501040_0234533_625_1074 140
424 3300049577 Ga0501041_0314403 Ga0501041_0314403_428_922 140
425 3300049577 Ga0501041_0346222 Ga0501041_0346222_67_591 140
426 3300049579 Ga0501043_0000636 Ga0501043_0000636_15361_15792 140
427 3300049580 Ga0501046_0003152 Ga0501046_0003152_170_601 140
428 3300049580 Ga0501046_0218855 Ga0501046_0218855_465_983 140
429 3300049581 Ga0501047_0096335 Ga0501047_0096335_152_583 140
430 3300049582 Ga0501048_0051141 Ga0501048_0051141_2079_2510 140
431 3300049583 Ga0501067_0005936 Ga0501067_0005936_6174_6605 140
432 3300049585 Ga0501069_0062769 Ga0501069_0062769_1448_1879 140
433 3300049588 Ga0501072_0127364 Ga0501072_0127364_193_642 140
434 3300049589 Ga0501073_0032862 Ga0501073_0032862_1367_1798 140
435 3300049590 Ga0501074_0085565 Ga0501074_0085565_1201_1632 140
436 3300049591 Ga0501075_0028488 Ga0501075_0028488_2699_3148 140
437 3300049591 Ga0501075_0193477 Ga0501075_0193477_177_701 140
438 3300049591 Ga0501075_0204738 Ga0501075_0204738_491_1009 140
439 3300049661 Ga0501217_115449 Ga0501217_115449_337_762 140
440 3300049704 Ga0501221_089602 Ga0501221_089602_260_685 140
441 3300049742 Ga0501080_0107253 Ga0501080_0107253_1537_1986 140
442 3300049743 Ga0501081_0066188 Ga0501081_0066188_897_1421 140
443 3300049744 Ga0501083_0040135 Ga0501083_0040135_489_920 140
444 3300049822 Ga0501035_0352776 Ga0501035_0352776_50_481 140
445 3300049823 Ga0501044_0020671 Ga0501044_0020671_2168_2599 140
446 3300049824 Ga0501045_0457878 Ga0501045_0457878_273_800 140
447 3300049824 Ga0501045_0842677 Ga0501045_0842677_202_651 140
448 3300050489 nmdc:mga03683_72354_c1 nmdc:mga03683_72354_c1_964_1386 140
449 3300050490 nmdc:mga03n38_495505_c1 nmdc:mga03n38_495505_c1_249_674 140
450 3300050490 nmdc:mga03n38_874593_c1 nmdc:mga03n38_874593_c1_57_482 140
451 3300050491 nmdc:mga00v17_4843_c2 nmdc:mga00v17_4843_c2_600_1022 140
452 3300050492 nmdc:mga0yw44_49339_c1 nmdc:mga0yw44_49339_c1_1305_1727 140
453 3300050493 nmdc:mga0k408_280321_c1 nmdc:mga0k408_280321_c1_17_442 140
454 3300050494 nmdc:mga06z11_110545_c1 nmdc:mga06z11_110545_c1_932_1354 140
455 3300050495 nmdc:mga04h51_62011_c1 nmdc:mga04h51_62011_c1_271_693 140
456 3300050496 nmdc:mga07m45_13451_c1 nmdc:mga07m45_13451_c1_3521_3946 140
457 3300050508 nmdc:mga09592_336369_c1 nmdc:mga09592_336369_c1_354_881 140
458 3300050510 nmdc:mga06r32_423813_c1 nmdc:mga06r32_423813_c1_284_811 140
459 3300050511 nmdc:mga08y16_70447_c1 nmdc:mga08y16_70447_c1_2162_2683 140
460 3300050512 nmdc:mga0n895_19441_c1 nmdc:mga0n895_19441_c1_4917_5438 140
461 3300050513 nmdc:mga0rr50_227749_c1 nmdc:mga0rr50_227749_c1_978_1400 140
462 3300050513 nmdc:mga0rr50_293089_c1 nmdc:mga0rr50_293089_c1_199_621 140
463 3300050513 nmdc:mga0rr50_956887_c1 nmdc:mga0rr50_956887_c1_111_638 140
464 3300050514 nmdc:mga08x19_92294_c1 nmdc:mga08x19_92294_c1_828_1250 140
465 3300050515 nmdc:mga0a205_7307_c1 nmdc:mga0a205_7307_c1_8784_9305 140
466 3300053085 Ga0495619_1007879 Ga0495619_1007879_81_521 140
467 3300053119 Ga0500595_013452 Ga0500595_013452_2457_2879 140
468 3300053139 Ga0500568_0057551 Ga0500568_0057551_306_728 140
469 3300053139 Ga0500568_0066582 Ga0500568_0066582_755_1177 140
470 3300053153 Ga0500616_0012208 Ga0500616_0012208_4257_4697 140
471 3300054114 Ga0501084_0029062 Ga0501084_0029062_49_480 140
472 3300054114 Ga0501084_0099789 Ga0501084_0099789_1897_2415 140
473 3300054114 Ga0501084_0452502 Ga0501084_0452502_480_998 140
474 3300060353 Ga0501082_0024421 Ga0501082_0024421_3905_4336 140
475 3300060353 Ga0501082_0343231 Ga0501082_0343231_816_1265 140
476 3300060353 Ga0501082_0415747 Ga0501082_0415747_126_644 140
477 3300061734 Ga0530510_0470834 Ga0530510_0470834_31_549 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03653

UPF0093

Uncharacterised protein family (UPF0093)

31

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wkq-assembly1.cif.gz_A 2.10 a resolution structure of ipab (residues 74-242) from shigella flexneri 0.6544 2 111
1or3-assembly1.cif.gz_A apolipoprotein e3 (apoe3), trigonal truncation mutant 165 0.6412 9 128
1nfo-assembly1.cif.gz_A apolipoprotein e2 (apoe2, d154a mutation) 0.6216 9 132
6x8n-assembly2.cif.gz_B crystal structure of h49a able mutant 0.6211 5 130
1ya9-assembly1.cif.gz_A crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e 0.6168 3 127
ID Description Score Start End Superfamily
1nfoA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.6216 9 132 1.20.120.20
1ya9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.6168 3 127 1.20.120.20
af_O62236_4_120_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6027 2 123 1.20.58.70
af_Q0WRW8_184_365_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5982 5 130 1.20.120.1770
af_P93654_17_132_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5853 2 109 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A1Y2J9X3-F1-model_v4 Protoporphyrinogen IX oxidase 1.003 2 106 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A170PUU5-F1-model_v4 deleted 0.9988 2 107
AF-A0A7C5IUV1-F1-model_v4 Protoporphyrinogen IX oxidase 0.9957 3 67 GO:0005886
GO:0006782
GO:0016491
GO:0046872
AF-A0A528NWT4-F1-model_v4 deleted 0.9929 2 71
AF-A0A3D1L6P9-F1-model_v4 deleted 0.992 2 106

Feature Viewer

pLDDT pTM Quality
84.64 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map