F450747

General Info

Members Datasets Scaffolds Average Seq Length
472 295 432 192

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100201476|Ga0070708_1002014762
Length 221
Sequence MSSAISNFPAQAPLRRCETMRKSRIEAAKTRERIVTAAAAEFRQHGIAATGLADLMKAAGLTHGGFYRHFASKDQLVAEACSAAIATMTERVASSASRERGRKGLEAAVADYLSTEHRDNPRDGCPLAALGSEMARADTQTRAAATAGFLKLVDALAGGFAEGTPDEARRRAMVAALTLIGALTVSRVVTDQALSDAILRNAEDSITGSQTTGRKKAKTSR

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
5 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
9 2643221629 Devosia sp. Root105 Isolate Unclassified
10 2643221662 Devosia sp. Root413D1 Isolate Unclassified
11 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
14 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
15 2738541297 Duganella sp. GV083 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543026 Duganella sp. GV089 Isolate Unclassified
19 2738543029 Duganella sp. GV039 Isolate Unclassified
20 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
21 2808606448 Streptomyces sp. 193411 Isolate Unclassified
22 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
23 2821131069 Duganella sp. 1224 Isolate Unclassified
24 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
25 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
26 2842711865 Duganella sp. R-73148 Isolate Unclassified
27 2857558681 Duganella sp. R-74565 Isolate Unclassified
28 2857564685 Duganella sp. R-74599 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
31 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
32 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
33 2922554459 Rhodococcus sp. 66b Isolate Unclassified
34 2932401849 Devosia sp. 2618 Isolate Rhizosphere
35 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
36 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
183 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.95
Metatranscriptomes 0
Isolates 8.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.84
Nodule 1.06
Rhizoplane 4.45
Rhizosphere 73.94
Stem 0
Stem Tuber 0
Unclassified 12.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10003596 3300003316 Bacteria 2941
2 rootH1_10025322 3300003316 Bacteria 1327
3 rootH2_10051586 3300003320 Bacteria 2303
4 rootH2_10096546 3300003320 Bacteria 3124
5 rootL2_10018938 3300003322 Bacteria 3814
6 rootL2_10036323 3300003322 Bacteria 3188
7 rootL2_10166893 3300003322 Bacteria 3218
8 rootL2_10166900 3300003322 Bacteria 3219
9 rootH1_10024353 3300003323 Bacteria 2669
10 rootH1_10075453 3300003323 Bacteria 4743
11 rootH1_10232545 3300003323 Bacteria 1163
12 rootH1_10274655 3300003323 Bacteria 1748
13 Ga0055529_1000068 3300003763 Bacteria 163911
14 Ga0055526_1000013 3300003771 Bacteria 233580
15 Ga0055526_1039916 3300003771 Bacteria 1190
16 Ga0055536_1012112 3300003781 Bacteria 3231
17 Ga0055530_10050156 3300003791 Bacteria 974
18 Ga0055531_10001469 3300003794 Bacteria 17339
19 Ga0065165_1000203 3300005262 Bacteria 103001
20 Ga0070658_10044516 3300005327 Bacteria 3587
21 Ga0070676_10023373 3300005328 Bacteria 3474
22 Ga0070683_100550390 3300005329 Bacteria 1103
23 Ga0070680_100084223 3300005336 Bacteria 2626
24 Ga0070660_100544908 3300005339 Bacteria 967
25 Ga0070660_100644905 3300005339 Bacteria 887
26 Ga0070660_100789423 3300005339 Unclassified 798
27 Ga0070661_100094231 3300005344 Bacteria 2219
28 Ga0070661_100106358 3300005344 Bacteria 2092
29 Ga0070674_100009568 3300005356 Bacteria 5805
30 Ga0070673_100041601 3300005364 Bacteria 3537
31 Ga0070659_100215504 3300005366 Bacteria 1583
32 Ga0070659_100739100 3300005366 Bacteria 853
33 Ga0070709_10042307 3300005434 Bacteria 2812
34 Ga0070709_10181030 3300005434 Bacteria 1480
35 Ga0070714_100612029 3300005435 Bacteria 1047
36 Ga0070713_100678182 3300005436 Bacteria 983
37 Ga0070713_101538194 3300005436 Unclassified 646
38 Ga0070710_10087922 3300005437 Bacteria 1827
39 Ga0070710_10382912 3300005437 Bacteria 939
40 Ga0070711_100125227 3300005439 Bacteria 1906
41 Ga0070711_100208251 3300005439 Bacteria 1513
42 Ga0070708_100201476 3300005445 Unclassified 1863
43 Ga0070708_100269130 3300005445 Unclassified 1602
44 Ga0070708_100396396 3300005445 Bacteria 1301
45 Ga0070681_10059821 3300005458 Bacteria 3789
46 Ga0070706_100219344 3300005467 Bacteria 1775
47 Ga0070706_100327054 3300005467 Bacteria 1430
48 Ga0070706_100609163 3300005467 Bacteria 1015
49 Ga0070706_100815594 3300005467 Unclassified 863
50 Ga0070707_100194718 3300005468 Bacteria 1976
51 Ga0070707_100370486 3300005468 Bacteria 1391
52 Ga0070707_100642652 3300005468 Bacteria 1024
53 Ga0070707_100696757 3300005468 Unclassified 979
54 Ga0070698_100322499 3300005471 Unclassified 1475
55 Ga0070698_100535002 3300005471 Unclassified 1111
56 Ga0070699_100350617 3300005518 Bacteria 1330
57 Ga0070699_100400769 3300005518 Unclassified 1240
58 Ga0070679_100086935 3300005530 Bacteria 3113
59 Ga0070679_100545481 3300005530 Bacteria 1103
60 Ga0070684_100058572 3300005535 Bacteria 3367
61 Ga0070684_101076402 3300005535 Bacteria 755
62 Ga0070697_100140014 3300005536 Unclassified 2034
63 Ga0070697_100491530 3300005536 Unclassified 1072
64 Ga0068853_100022700 3300005539 Bacteria 5244
65 Ga0068853_100483202 3300005539 Bacteria 1168
66 Ga0070665_100011328 3300005548 Bacteria 9020
67 Ga0070665_100044075 3300005548 Bacteria 4481
68 Ga0070665_100109439 3300005548 Bacteria 2765
69 Ga0070704_101080970 3300005549 Unclassified 728
70 Ga0068855_100037537 3300005563 Bacteria 5760
71 Ga0068855_100044135 3300005563 Bacteria 5277
72 Ga0070664_100027105 3300005564 Bacteria 4760
73 Ga0070664_100157554 3300005564 Bacteria 2007
74 Ga0070664_100221977 3300005564 Bacteria 1691
75 Ga0068857_100020890 3300005577 Bacteria 5760
76 Ga0068856_100123679 3300005614 Bacteria 2589
77 Ga0068856_100376746 3300005614 Bacteria 1438
78 Ga0068852_100003487 3300005616 Bacteria 10999
79 Ga0068852_100007544 3300005616 Bacteria 7944
80 Ga0068852_100467954 3300005616 Bacteria 1251
81 Ga0068852_101271517 3300005616 Unclassified 757
82 Ga0081455_10110035 3300005937 Bacteria 2191
83 Ga0081538_10020583 3300005981 Bacteria 4847
84 Ga0081538_10023055 3300005981 Bacteria 4486
85 Ga0081538_10037185 3300005981 Bacteria 3164
86 Ga0081538_10147308 3300005981 Bacteria 1073
87 Ga0081540_1025106 3300005983 Bacteria 3440
88 Ga0070717_10765816 3300006028 Bacteria 878
89 Ga0075365_10000779 3300006038 Bacteria 13000
90 Ga0075368_10015193 3300006042 Bacteria 2852
91 Ga0075363_100020719 3300006048 Bacteria 3301
92 Ga0075363_100037667 3300006048 Bacteria 2540
93 Ga0075364_10110393 3300006051 Bacteria 1835
94 Ga0070715_10129057 3300006163 Bacteria 1215
95 Ga0070715_10354744 3300006163 Unclassified 802
96 Ga0070716_100051111 3300006173 Bacteria 2348
97 Ga0070716_100053684 3300006173 Bacteria 2299
98 Ga0070716_100378894 3300006173 Bacteria 1010
99 Ga0070712_100484562 3300006175 Unclassified 1034
100 Ga0070712_100535819 3300006175 Bacteria 985
101 Ga0075367_10111998 3300006178 Bacteria 1676
102 Ga0097621_100269923 3300006237 Bacteria 1495
103 Ga0068871_100207410 3300006358 Bacteria 1694
104 Ga0075428_100404980 3300006844 Bacteria 1462
105 Ga0075433_10293959 3300006852 Unclassified 1439
106 Ga0075434_100699170 3300006871 Bacteria 1031
107 Ga0075436_100314284 3300006914 Unclassified 1125
108 Ga0099794_10141096 3300007265 Bacteria 1220
109 Ga0099794_10146840 3300007265 Bacteria 1196
110 Ga0099794_10252076 3300007265 Unclassified 910
111 Ga0099794_10537402 3300007265 Bacteria 617
112 Ga0099795_10109943 3300007788 Unclassified 1091
113 Ga0099795_10221738 3300007788 Bacteria 805
114 Ga0105240_10028665 3300009093 Bacteria 7265
115 Ga0105240_10036629 3300009093 Bacteria 6308
116 Ga0105240_10114455 3300009093 Bacteria 3258
117 Ga0111539_10709644 3300009094 Unclassified 1171
118 Ga0114129_10332231 3300009147 Unclassified 2018
119 Ga0114129_10351079 3300009147 Unclassified 1954
120 Ga0114129_11869790 3300009147 Bacteria 729
121 Ga0105241_10030539 3300009174 Bacteria 4028
122 Ga0105237_10000075 3300009545 Bacteria 132511
123 Ga0105237_10057163 3300009545 Bacteria 3904
124 Ga0105237_10276437 3300009545 Bacteria 1682
125 Ga0105237_10776994 3300009545 Bacteria 964
126 Ga0105238_10025580 3300009551 Bacteria 6018
127 Ga0105238_10073211 3300009551 Bacteria 3421
128 Ga0099796_10068699 3300010159 Bacteria 1274
129 Ga0099796_10084327 3300010159 Bacteria 1171
130 Ga0099796_10205448 3300010159 Bacteria 801
131 Ga0105239_10062254 3300010375 Bacteria 4095
132 Ga0105239_10649316 3300010375 Bacteria 1205
133 Ga0105246_10354430 3300011119 Bacteria 1203
134 Ga0157370_10048435 3300013104 Bacteria 4071
135 Ga0157370_10072896 3300013104 Bacteria 3240
136 Ga0157370_10075722 3300013104 Bacteria 3172
137 Ga0157374_10418517 3300013296 Bacteria 1338
138 Ga0157378_10617133 3300013297 Bacteria 1097
139 Ga0163162_10000389 3300013306 Bacteria 40197
140 Ga0163162_10451972 3300013306 Bacteria 1417
141 Ga0157372_10352162 3300013307 Bacteria 1715
142 Ga0157372_10440209 3300013307 Bacteria 1519
143 Ga0157372_10969212 3300013307 Bacteria 985
144 Ga0163163_11645528 3300014325 Bacteria 703
145 Ga0182008_10147109 3300014497 Bacteria 1181
146 Ga0157379_10064383 3300014968 Bacteria 3277
147 Ga0213875_10263628 3300021388 Bacteria 813
148 Ga0209437_105103 3300025233 Bacteria 2258
149 Ga0209455_1000026 3300025272 Bacteria 653778
150 Ga0209564_1000002 3300025295 Bacteria 1636803
151 Ga0209564_1009160 3300025295 Bacteria 4758
152 Ga0209758_1000237 3300025297 Bacteria 115867
153 Ga0207426_1000018 3300025302 Bacteria 566740
154 Ga0209051_1039495 3300025303 Bacteria 1703
155 Ga0209257_1004194 3300025304 Bacteria 11433
156 Ga0207692_10209173 3300025898 Bacteria 1151
157 Ga0207692_10685220 3300025898 Unclassified 664
158 Ga0207685_10379422 3300025905 Bacteria 720
159 Ga0207699_10144888 3300025906 Bacteria 1565
160 Ga0207699_10160496 3300025906 Bacteria 1496
161 Ga0207645_10055900 3300025907 Bacteria 2520
162 Ga0207705_10016241 3300025909 Bacteria 5338
163 Ga0207705_10286657 3300025909 Bacteria 1261
164 Ga0207684_10002651 3300025910 Bacteria 17908
165 Ga0207684_10226763 3300025910 Unclassified 1612
166 Ga0207684_10345525 3300025910 Bacteria 1281
167 Ga0207684_10454635 3300025910 Bacteria 1099
168 Ga0207684_10564851 3300025910 Bacteria 973
169 Ga0207684_10786326 3300025910 Bacteria 805
170 Ga0207707_10321002 3300025912 Bacteria 1337
171 Ga0207695_10061370 3300025913 Bacteria 3885
172 Ga0207695_10084828 3300025913 Bacteria 3197
173 Ga0207671_10000104 3300025914 Bacteria 129250
174 Ga0207671_10167962 3300025914 Bacteria 1702
175 Ga0207693_10045246 3300025915 Bacteria 3459
176 Ga0207693_10123319 3300025915 Unclassified 2035
177 Ga0207693_10239956 3300025915 Bacteria 1423
178 Ga0207693_10272244 3300025915 Unclassified 1327
179 Ga0207663_10140670 3300025916 Bacteria 1681
180 Ga0207663_10174087 3300025916 Bacteria 1531
181 Ga0207657_10257895 3300025919 Bacteria 1388
182 Ga0207657_10832880 3300025919 Unclassified 712
183 Ga0207649_10081053 3300025920 Bacteria 2101
184 Ga0207649_10103112 3300025920 Bacteria 1892
185 Ga0207652_10419324 3300025921 Bacteria 1207
186 Ga0207646_10384244 3300025922 Bacteria 1268
187 Ga0207646_10787502 3300025922 Unclassified 847
188 Ga0207694_10022937 3300025924 Bacteria 4736
189 Ga0207694_10221769 3300025924 Bacteria 1543
190 Ga0207700_10977279 3300025928 Unclassified 758
191 Ga0207664_10212122 3300025929 Bacteria 1676
192 Ga0207664_10302927 3300025929 Bacteria 1406
193 Ga0207690_10232092 3300025932 Bacteria 1417
194 Ga0207690_10780905 3300025932 Bacteria 789
195 Ga0207706_10052610 3300025933 Bacteria 3595
196 Ga0207665_10039808 3300025939 Bacteria 3134
197 Ga0207665_10135474 3300025939 Bacteria 1752
198 Ga0207665_10148766 3300025939 Bacteria 1676
199 Ga0207665_10200344 3300025939 Bacteria 1454
200 Ga0207661_11128322 3300025944 Unclassified 722
201 Ga0207679_10130629 3300025945 Bacteria 2014
202 Ga0207679_10183523 3300025945 Bacteria 1733
203 Ga0207679_10255280 3300025945 Bacteria 1493
204 Ga0207667_10005940 3300025949 Bacteria 14865
205 Ga0207667_10134195 3300025949 Bacteria 2549
206 Ga0207667_10166270 3300025949 Bacteria 2268
207 Ga0207667_10295640 3300025949 Bacteria 1654
208 Ga0207668_10619140 3300025972 Bacteria 945
209 Ga0207677_10017491 3300026023 Bacteria 4276
210 Ga0207639_10268102 3300026041 Bacteria 1496
211 Ga0207639_10324828 3300026041 Bacteria 1367
212 Ga0207702_10589527 3300026078 Bacteria 1090
213 Ga0207702_11141080 3300026078 Unclassified 773
214 Ga0207648_10161049 3300026089 Bacteria 1982
215 Ga0207676_11617605 3300026095 Bacteria 646
216 Ga0207674_10010416 3300026116 Bacteria 10534
217 Ga0207674_10147972 3300026116 Bacteria 2306
218 Ga0207683_10123883 3300026121 Bacteria 2322
219 Ga0207698_10128576 3300026142 Bacteria 2160
220 Ga0207698_11101716 3300026142 Unclassified 807
221 Ga0209179_1015292 3300027512 Bacteria 1424
222 Ga0209813_10081483 3300027866 Bacteria 1071
223 Ga0268266_10005891 3300028379 Bacteria 11339
224 Ga0268266_10076560 3300028379 Bacteria 2908
225 Ga0307515_10435952 3300028794 Bacteria 928
226 Ga0265327_10036801 3300031251 Bacteria 2686
227 Ga0307408_101203168 3300031548 Bacteria 707
228 Ga0307516_10002930 3300031730 Bacteria 22351
229 Ga0307516_10711487 3300031730 Bacteria 662
230 Ga0307518_10201328 3300031838 Bacteria 1322
231 Ga0307410_10299075 3300031852 Bacteria 1269
232 Ga0307409_100646731 3300031995 Bacteria 1051
233 Ga0307416_100674019 3300032002 Bacteria 1121
234 Ga0307414_10965241 3300032004 Bacteria 784
235 Ga0373932_0094801 3300035112 Bacteria 963
236 Ga0373941_0316002 3300035115 Bacteria 627
237 Ga0373931_0047986 3300035691 Bacteria 2262
238 Ga0373937_1424617 3300036401 Bacteria 641
239 Ga0395898_0201513 3300037466 Bacteria 1900
240 Ga0395905_0041004 3300037471 Bacteria 4343
241 Ga0395905_0042110 3300037471 Bacteria 4285
242 Ga0436364_0047825 3300037853 Bacteria 1727
243 Ga0436364_1289577 3300037853 Bacteria 1003
244 Ga0242420_070810 3300038996 Bacteria 709
245 Ga0436360_0987912 3300039438 Bacteria 1648
246 Ga0436360_1197819 3300039438 Unclassified 1046
247 Ga0436361_0691906 3300039447 Unclassified 975
248 Ga0436363_0255317 3300039450 Bacteria 1659
249 Ga0439436_0013582 3300041404 Bacteria 2462
250 Ga0439465_0025367 3300041413 Bacteria 1871
251 Ga0439465_0039013 3300041413 Bacteria 1532
252 Ga0439449_0036674 3300042007 Bacteria 1824
253 Ga0439452_067142 3300042010 Bacteria 795
254 Ga0439457_000540 3300042014 Bacteria 11024
255 Ga0439462_0027177 3300042015 Bacteria 1510
256 Ga0439463_100843 3300042016 Bacteria 744
257 Ga0439444_0009390 3300042437 Bacteria 1541
258 Ga0439460_0079090 3300042461 Bacteria 1030
259 Ga0439460_0092115 3300042461 Bacteria 964
260 Ga0466969_0167037 3300044656 Bacteria 1010
261 Ga0453683_0006357 3300044673 Bacteria 8114
262 Ga0453683_0132158 3300044673 Bacteria 1573
263 Ga0466966_0004411 3300044684 Bacteria 9284
264 Ga0466966_0010064 3300044684 Bacteria 6271
265 Ga0466961_0094217 3300044693 Bacteria 1889
266 Ga0466963_0010104 3300044694 Bacteria 5707
267 Ga0453684_0205002 3300044712 Bacteria 2296
268 Ga0466971_0003531 3300044719 Bacteria 6683
269 Ga0466970_0048240 3300044765 Bacteria 2270
270 Ga0466959_0020380 3300045049 Bacteria 4884
271 Ga0466958_0152170 3300045836 Bacteria 1459
272 Ga0495617_000021 3300046452 Bacteria 215885
273 Ga0495603_0001797 3300046455 Bacteria 12664
274 Ga0495590_0000010 3300046457 Bacteria 317890
275 Ga0495590_0061040 3300046457 Bacteria 1320
276 Ga0495629_0001914 3300046459 Bacteria 16216
277 Ga0495638_0000027 3300046460 Bacteria 337569
278 Ga0495638_0052826 3300046460 Bacteria 2530
279 Ga0495638_0238833 3300046460 Bacteria 1007
280 Ga0495638_0241118 3300046460 Bacteria 1001
281 Ga0495651_0309550 3300046462 Bacteria 1057
282 Ga0495653_0000010 3300046463 Bacteria 274131
283 Ga0495650_0000845 3300046471 Bacteria 36844
284 Ga0495650_0002454 3300046471 Bacteria 14955
285 Ga0495650_0002964 3300046471 Bacteria 12844
286 Ga0495650_0005528 3300046471 Bacteria 8169
287 Ga0495580_0078832 3300046472 Bacteria 2297
288 Ga0495605_0144456 3300046474 Bacteria 1065
289 Ga0495585_0003831 3300046492 Bacteria 10011
290 Ga0495594_0048008 3300046499 Bacteria 2345
291 Ga0495607_0049369 3300046501 Bacteria 2454
292 Ga0495583_0000006 3300046506 Bacteria 436893
293 Ga0495583_0225988 3300046506 Bacteria 755
294 Ga0495606_0000128 3300046507 Bacteria 128179
295 Ga0495606_0000798 3300046507 Bacteria 48020
296 Ga0495606_0001610 3300046507 Bacteria 29451
297 Ga0495606_0018452 3300046507 Bacteria 5229
298 Ga0495610_0001153 3300046512 Bacteria 24025
299 Ga0495616_0000040 3300046513 Bacteria 122596
300 Ga0495616_0358037 3300046513 Bacteria 606
301 Ga0495637_0001691 3300046520 Bacteria 12734
302 Ga0495643_0000022 3300046522 Bacteria 289691
303 Ga0495643_0000117 3300046522 Bacteria 129698
304 Ga0495643_0132336 3300046522 Bacteria 1251
305 Ga0495648_0000078 3300046524 Bacteria 127397
306 Ga0495648_0008159 3300046524 Bacteria 8264
307 Ga0495648_0011509 3300046524 Bacteria 6655
308 Ga0495648_0104288 3300046524 Bacteria 1557
309 Ga0495648_0224980 3300046524 Bacteria 922
310 Ga0495642_0000864 3300046528 Bacteria 14340
311 Ga0495642_0062149 3300046528 Bacteria 1551
312 Ga0495654_0000002 3300046530 Bacteria 1021205
313 Ga0495654_0004092 3300046530 Bacteria 8745
314 Ga0495597_0000357 3300046542 Bacteria 40721
315 Ga0495597_0000447 3300046542 Bacteria 35347
316 Ga0495622_0000281 3300046557 Bacteria 38709
317 Ga0495622_0013817 3300046557 Bacteria 3745
318 Ga0495622_0105519 3300046557 Bacteria 1291
319 Ga0495633_0000375 3300046558 Bacteria 47710
320 Ga0495633_0000898 3300046558 Bacteria 25390
321 Ga0495633_0027557 3300046558 Bacteria 2776
322 Ga0495668_0000140 3300046616 Bacteria 109138
323 Ga0495668_0000394 3300046616 Bacteria 57677
324 Ga0495668_0000606 3300046616 Bacteria 43443
325 Ga0495668_0012050 3300046616 Bacteria 5146
326 Ga0495611_0055585 3300046648 Bacteria 1791
327 Ga0495625_0000516 3300046660 Bacteria 56935
328 Ga0495625_0052785 3300046660 Bacteria 2910
329 Ga0495625_0139566 3300046660 Bacteria 1636
330 Ga0495661_0011708 3300046665 Bacteria 5941
331 Ga0495613_0001014 3300046689 Bacteria 21335
332 Ga0495670_0074342 3300046691 Bacteria 1724
333 Ga0495671_0000002 3300046692 Bacteria 1136189
334 Ga0495649_0008856 3300046694 Bacteria 6026
335 Ga0495649_0073996 3300046694 Bacteria 1825
336 Ga0495589_0004169 3300046794 Bacteria 7737
337 Ga0495589_0092847 3300046794 Bacteria 1465
338 Ga0495660_0023936 3300046810 Bacteria 3480
339 Ga0495660_0197602 3300046810 Bacteria 962
340 Ga0495581_0183481 3300047315 Bacteria 1224
341 Ga0495636_0026703 3300047318 Bacteria 2350
342 Ga0495636_0044682 3300047318 Bacteria 1845
343 Ga0495674_0000766 3300047319 Bacteria 30487
344 Ga0495672_0000022 3300047320 Bacteria 420632
345 Ga0495672_0000095 3300047320 Bacteria 143883
346 Ga0495672_0192001 3300047320 Bacteria 1026
347 Ga0495676_0002929 3300047321 Bacteria 15419
348 Ga0495676_0005195 3300047321 Bacteria 11910
349 Ga0495676_0029500 3300047321 Bacteria 4669
350 Ga0495683_0008183 3300047323 Bacteria 5611
351 Ga0495683_0229638 3300047323 Bacteria 823
352 Ga0495687_005420 3300047443 Bacteria 8137
353 Ga0495687_006107 3300047443 Bacteria 7480
354 Ga0495685_001995 3300047447 Bacteria 6329
355 Ga0495685_004624 3300047447 Bacteria 4459
356 Ga0495685_009005 3300047447 Bacteria 3327
357 Ga0495673_0000005 3300047469 Bacteria 943364
358 Ga0495673_0000064 3300047469 Bacteria 225793
359 Ga0495673_0000109 3300047469 Bacteria 166877
360 Ga0495686_0117145 3300047472 Bacteria 1592
361 Ga0495614_0023851 3300048089 Bacteria 2640
362 Ga0495626_0017436 3300048091 Bacteria 3625
363 Ga0496100_0000040 3300048903 Bacteria 92907
364 Ga0496101_0000175 3300048904 Bacteria 51289
365 Ga0496102_0000203 3300048905 Bacteria 79868
366 Ga0496102_0576745 3300048905 Bacteria 1048
367 Ga0496103_0000387 3300048906 Bacteria 39388
368 Ga0496104_0033257 3300048907 Bacteria 4802
369 Ga0496104_0065602 3300048907 Bacteria 3445
370 Ga0496105_0034466 3300048908 Bacteria 4163
371 Ga0496106_0158640 3300048909 Bacteria 1788
372 Ga0496106_0693278 3300048909 Unclassified 812
373 Ga0496107_0583114 3300048910 Bacteria 827
374 Ga0496108_0207846 3300048911 Bacteria 1699
375 Ga0496108_0449304 3300048911 Bacteria 1126
376 Ga0496109_0039690 3300048912 Bacteria 4262
377 Ga0496109_0280061 3300048912 Bacteria 1572
378 Ga0496111_0271223 3300048914 Bacteria 1259
379 Ga0496112_0040582 3300048915 Bacteria 4551
380 Ga0496112_0570120 3300048915 Bacteria 1065
381 Ga0496113_0003005 3300048916 Bacteria 9988
382 Ga0496114_0107175 3300048917 Bacteria 2391
383 Ga0496115_0501396 3300048918 Bacteria 975
384 Ga0496116_0211869 3300048919 Bacteria 1003
385 Ga0496117_0000532 3300048920 Bacteria 62597
386 Ga0496118_0000206 3300048921 Bacteria 104093
387 Ga0496119_0041446 3300048922 Bacteria 2932
388 Ga0496120_0201240 3300048923 Bacteria 964
389 Ga0496121_0000455 3300048924 Bacteria 80555
390 Ga0496121_0004347 3300048924 Bacteria 19158
391 Ga0496121_0021004 3300048924 Bacteria 6423
392 Ga0496121_0036169 3300048924 Bacteria 4405
393 Ga0496121_0110846 3300048924 Bacteria 2093
394 Ga0496121_0347645 3300048924 Bacteria 989
395 Ga0496122_0037538 3300048925 Bacteria 3897
396 Ga0496122_0064507 3300048925 Bacteria 2664
397 Ga0496123_0003249 3300048926 Bacteria 18466
398 Ga0496124_0566266 3300048927 Bacteria 747
399 Ga0496126_0039191 3300048929 Bacteria 4399
400 Ga0496126_0744828 3300048929 Unclassified 757
401 Ga0495678_000497 3300049459 Bacteria 38848
402 Ga0495678_001609 3300049459 Bacteria 17284
403 Ga0495678_012131 3300049459 Bacteria 4092
404 Ga0495682_0130871 3300049460 Bacteria 897
405 Ga0501034_0348631 3300049571 Bacteria 1409
406 Ga0501067_0180220 3300049583 Bacteria 1177
407 Ga0501069_0891987 3300049585 Unclassified 541
408 Ga0501044_0851320 3300049823 Bacteria 789
409 nmdc:mga03n38_45040_c1 3300050490 Bacteria 1941
410 nmdc:mga0yw44_543_c1 3300050492 Bacteria 13568
411 nmdc:mga04h51_105180_c1 3300050495 Bacteria 1034
412 nmdc:mga05p37_12623_c1 3300050507 Bacteria 10089
413 nmdc:mga05p37_779272_c1 3300050507 Unclassified 1050
414 nmdc:mga08y16_864316_c1 3300050511 Bacteria 893
415 nmdc:mga0n895_480034_c1 3300050512 Unclassified 1254
416 nmdc:mga0n895_674341_c1 3300050512 Bacteria 1031
417 nmdc:mga0rr50_474809_c1 3300050513 Bacteria 1062
418 nmdc:mga08x19_278713_c1 3300050514 Unclassified 1158
419 nmdc:mga0a205_404053_c1 3300050515 Unclassified 1230
420 Ga0500562_097706 3300053108 Bacteria 799
421 Ga0500594_0009186 3300053118 Bacteria 2271
422 Ga0500594_0035911 3300053118 Bacteria 1331
423 Ga0500618_000032 3300053125 Bacteria 126990
424 Ga0500658_0047739 3300053134 Bacteria 1739
425 Ga0500564_004912 3300053138 Bacteria 5412
426 Ga0500568_0096242 3300053139 Bacteria 1113
427 Ga0500586_105063 3300053145 Bacteria 988
428 Ga0500616_0000102 3300053153 Bacteria 168834
429 Ga0500616_0045139 3300053153 Bacteria 2349
430 Ga0500627_0019277 3300053158 Bacteria 2715
431 Ga0500627_0220683 3300053158 Bacteria 846
432 Ga0466962_0011757 3300061719 Bacteria 4216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10257895 Ga0207657_102578952 156
2 3300049585 Ga0501069_0891987 Ga0501069_0891987_11_493 157
3 3300025939 Ga0207665_10200344 Ga0207665_102003441 161
4 3300005439 Ga0070711_100208251 Ga0070711_1002082511 168
5 3300026095 Ga0207676_11617605 Ga0207676_116176052 168
6 3300037466 Ga0395898_0201513 Ga0395898_0201513_311_847 171
7 3300005468 Ga0070707_100696757 Ga0070707_1006967571 173
8 3300025933 Ga0207706_10052610 Ga0207706_100526102 173
9 3300048929 Ga0496126_0744828 Ga0496126_0744828_224_745 173
10 3300003791 Ga0055530_10050156 Ga0055530_100501562 175
11 3300003794 Ga0055531_10001469 Ga0055531_100014699 175
12 3300025303 Ga0209051_1039495 Ga0209051_10394952 175
13 3300025304 Ga0209257_1004194 Ga0209257_10041948 175
14 3300005445 Ga0070708_100269130 Ga0070708_1002691303 176
15 3300005471 Ga0070698_100322499 Ga0070698_1003224992 176
16 3300007265 Ga0099794_10537402 Ga0099794_105374021 176
17 3300025910 Ga0207684_10226763 Ga0207684_102267632 176
18 3300053134 Ga0500658_0047739 Ga0500658_0047739_1050_1580 176
19 3300003781 Ga0055536_1012112 Ga0055536_10121124 177
20 3300006175 Ga0070712_100484562 Ga0070712_1004845622 177
21 3300025910 Ga0207684_10002651 Ga0207684_100026519 177
22 iso_pu_bacteria 2643221578 2643898740 177
23 iso_pu_bacteria 2643221673 2644402087 177
24 3300010159 Ga0099796_10068699 Ga0099796_100686992 178
25 3300044694 Ga0466963_0010104 Ga0466963_0010104_4945_5556 178
26 iso_pu_bacteria 2643221548 2643762781 178
27 iso_pu_bacteria 2643221587 2643946629 178
28 iso_pu_bacteria 2643221677 2644434433 178
29 iso_pu_bacteria 2784132148 2784585431 178
30 iso_pu_bacteria 2808606448 2809228810 178
31 iso_pu_bacteria 2873151551 2873151782 178
32 iso_pu_bacteria 2946045630 2946052539 178
33 iso_pu_bacteria 2946045630 2946053151 178
34 iso_pu_bacteria 2966598605 2966605290 178
35 iso_pu_bacteria 8023623736 8023623934 178
36 3300005548 Ga0070665_100044075 Ga0070665_1000440752 179
37 3300007265 Ga0099794_10252076 Ga0099794_102520762 179
38 3300009147 Ga0114129_10351079 Ga0114129_103510792 179
39 3300028379 Ga0268266_10076560 Ga0268266_100765604 179
40 3300046616 Ga0495668_0000140 Ga0495668_0000140_45572_46153 179
41 3300050507 nmdc:mga05p37_12623_c1 nmdc:mga05p37_12623_c1_1293_1871 179
42 iso_pu_bacteria 2643221629 2644164826 179
43 iso_pu_bacteria 2643221662 2644345903 179
44 iso_pu_bacteria 2687453257 2688070010 179
45 iso_pu_bacteria 2922554459 2922555125 179
46 3300005437 Ga0070710_10087922 Ga0070710_100879222 180
47 3300005439 Ga0070711_100125227 Ga0070711_1001252272 180
48 3300005549 Ga0070704_101080970 Ga0070704_1010809701 180
49 3300006163 Ga0070715_10354744 Ga0070715_103547441 180
50 3300006173 Ga0070716_100051111 Ga0070716_1000511112 180
51 3300007788 Ga0099795_10109943 Ga0099795_101099432 180
52 3300025898 Ga0207692_10685220 Ga0207692_106852201 180
53 3300025916 Ga0207663_10140670 Ga0207663_101406702 180
54 3300025922 Ga0207646_10787502 Ga0207646_107875021 180
55 3300025939 Ga0207665_10135474 Ga0207665_101354742 180
56 3300039438 Ga0436360_0987912 Ga0436360_0987912_980_1522 180
57 iso_pu_bacteria 2862574272 2862582410 180
58 3300005536 Ga0070697_100491530 Ga0070697_1004915301 181
59 3300031852 Ga0307410_10299075 Ga0307410_102990751 181
60 3300032002 Ga0307416_100674019 Ga0307416_1006740192 181
61 3300041404 Ga0439436_0013582 Ga0439436_0013582_561_1121 181
62 3300042014 Ga0439457_000540 Ga0439457_000540_9253_9813 181
63 3300042015 Ga0439462_0027177 Ga0439462_0027177_436_996 181
64 3300046455 Ga0495603_0001797 Ga0495603_0001797_3737_4297 181
65 3300046459 Ga0495629_0001914 Ga0495629_0001914_12715_13275 181
66 3300046460 Ga0495638_0241118 Ga0495638_0241118_226_786 181
67 3300046499 Ga0495594_0048008 Ga0495594_0048008_17_577 181
68 3300046506 Ga0495583_0225988 Ga0495583_0225988_52_627 181
69 3300046524 Ga0495648_0104288 Ga0495648_0104288_898_1476 181
70 3300046557 Ga0495622_0105519 Ga0495622_0105519_74_634 181
71 3300046648 Ga0495611_0055585 Ga0495611_0055585_341_901 181
72 3300046689 Ga0495613_0001014 Ga0495613_0001014_16201_16761 181
73 3300046691 Ga0495670_0074342 Ga0495670_0074342_1102_1662 181
74 3300046794 Ga0495589_0004169 Ga0495589_0004169_5025_5585 181
75 3300046794 Ga0495589_0092847 Ga0495589_0092847_760_1335 181
76 3300047315 Ga0495581_0183481 Ga0495581_0183481_523_1083 181
77 3300047318 Ga0495636_0026703 Ga0495636_0026703_96_656 181
78 3300047318 Ga0495636_0044682 Ga0495636_0044682_889_1464 181
79 3300047321 Ga0495676_0002929 Ga0495676_0002929_7470_8030 181
80 3300047321 Ga0495676_0005195 Ga0495676_0005195_6225_6785 181
81 3300047321 Ga0495676_0029500 Ga0495676_0029500_2281_2841 181
82 3300047447 Ga0495685_001995 Ga0495685_001995_4028_4588 181
83 3300047447 Ga0495685_004624 Ga0495685_004624_1690_2265 181
84 3300047447 Ga0495685_009005 Ga0495685_009005_754_1314 181
85 3300048089 Ga0495614_0023851 Ga0495614_0023851_986_1546 181
86 3300053153 Ga0500616_0000102 Ga0500616_0000102_78325_78912 181
87 3300005518 Ga0070699_100350617 Ga0070699_1003506173 182
88 3300039438 Ga0436360_1197819 Ga0436360_1197819_26_574 182
89 3300044673 Ga0453683_0006357 Ga0453683_0006357_6165_6719 182
90 iso_pu_bacteria 2818991463 2819697633 182
91 3300003316 rootH1_10025322 rootH1_100253223 183
92 3300003322 rootL2_10036323 rootL2_100363234 183
93 3300005328 Ga0070676_10023373 Ga0070676_100233732 183
94 3300005339 Ga0070660_100544908 Ga0070660_1005449082 183
95 3300005344 Ga0070661_100094231 Ga0070661_1000942314 183
96 3300005356 Ga0070674_100009568 Ga0070674_1000095683 183
97 3300005364 Ga0070673_100041601 Ga0070673_1000416014 183
98 3300005366 Ga0070659_100215504 Ga0070659_1002155042 183
99 3300005366 Ga0070659_100739100 Ga0070659_1007391001 183
100 3300005535 Ga0070684_100058572 Ga0070684_1000585725 183
101 3300005539 Ga0068853_100022700 Ga0068853_1000227004 183
102 3300005548 Ga0070665_100109439 Ga0070665_1001094393 183
103 3300005563 Ga0068855_100044135 Ga0068855_1000441354 183
104 3300005564 Ga0070664_100027105 Ga0070664_1000271054 183
105 3300005577 Ga0068857_100020890 Ga0068857_1000208907 183
106 3300005614 Ga0068856_100123679 Ga0068856_1001236792 183
107 3300005616 Ga0068852_100007544 Ga0068852_1000075447 183
108 3300006237 Ga0097621_100269923 Ga0097621_1002699233 183
109 3300006358 Ga0068871_100207410 Ga0068871_1002074102 183
110 3300009174 Ga0105241_10030539 Ga0105241_100305394 183
111 3300009551 Ga0105238_10073211 Ga0105238_100732112 183
112 3300010375 Ga0105239_10062254 Ga0105239_100622542 183
113 3300011119 Ga0105246_10354430 Ga0105246_103544302 183
114 3300013104 Ga0157370_10075722 Ga0157370_100757225 183
115 3300013296 Ga0157374_10418517 Ga0157374_104185172 183
116 3300013307 Ga0157372_10969212 Ga0157372_109692121 183
117 3300014325 Ga0163163_11645528 Ga0163163_116455281 183
118 3300025907 Ga0207645_10055900 Ga0207645_100559002 183
119 3300025909 Ga0207705_10286657 Ga0207705_102866572 183
120 3300025920 Ga0207649_10103112 Ga0207649_101031122 183
121 3300025932 Ga0207690_10780905 Ga0207690_107809052 183
122 3300025945 Ga0207679_10130629 Ga0207679_101306292 183
123 3300025949 Ga0207667_10134195 Ga0207667_101341954 183
124 3300025972 Ga0207668_10619140 Ga0207668_106191402 183
125 3300026023 Ga0207677_10017491 Ga0207677_100174914 183
126 3300026041 Ga0207639_10268102 Ga0207639_102681022 183
127 3300026089 Ga0207648_10161049 Ga0207648_101610494 183
128 3300026116 Ga0207674_10010416 Ga0207674_100104168 183
129 3300026121 Ga0207683_10123883 Ga0207683_101238832 183
130 3300026142 Ga0207698_10128576 Ga0207698_101285764 183
131 3300031838 Ga0307518_10201328 Ga0307518_102013282 183
132 3300035112 Ga0373932_0094801 Ga0373932_0094801_199_759 183
133 3300035115 Ga0373941_0316002 Ga0373941_0316002_30_590 183
134 3300035691 Ga0373931_0047986 Ga0373931_0047986_928_1488 183
135 3300046513 Ga0495616_0000040 Ga0495616_0000040_115680_116234 183
136 3300046616 Ga0495668_0012050 Ga0495668_0012050_3316_3870 183
137 3300048911 Ga0496108_0207846 Ga0496108_0207846_668_1237 183
138 3300048912 Ga0496109_0039690 Ga0496109_0039690_2076_2645 183
139 3300048912 Ga0496109_0280061 Ga0496109_0280061_322_882 183
140 3300048914 Ga0496111_0271223 Ga0496111_0271223_76_645 183
141 3300053158 Ga0500627_0019277 Ga0500627_0019277_450_1004 183
142 3300005327 Ga0070658_10044516 Ga0070658_100445162 184
143 3300005563 Ga0068855_100037537 Ga0068855_1000375377 184
144 3300025909 Ga0207705_10016241 Ga0207705_100162417 184
145 3300025949 Ga0207667_10005940 Ga0207667_100059405 184
146 iso_pu_bacteria 2738541297 2738828625 184
147 iso_pu_bacteria 2738541357 2739152421 184
148 iso_pu_bacteria 2738543003 2739194341 184
149 iso_pu_bacteria 2738543026 2739320817 184
150 iso_pu_bacteria 2738543029 2739339058 184
151 iso_pu_bacteria 2857564685 2857568777 184
152 3300005467 Ga0070706_100327054 Ga0070706_1003270541 185
153 3300006048 Ga0075363_100020719 Ga0075363_1000207193 185
154 3300006178 Ga0075367_10111998 Ga0075367_101119982 185
155 3300009147 Ga0114129_11869790 Ga0114129_118697901 185
156 3300025910 Ga0207684_10454635 Ga0207684_104546351 185
157 3300050490 nmdc:mga03n38_45040_c1 nmdc:mga03n38_45040_c1_905_1513 185
158 iso_pu_bacteria 2565956761 2566997060 185
159 iso_pu_bacteria 2904535858 2904536667 185
160 3300013306 Ga0163162_10000389 Ga0163162_1000038938 186
161 3300047469 Ga0495673_0000109 Ga0495673_0000109_17022_17582 186
162 3300053118 Ga0500594_0035911 Ga0500594_0035911_123_683 186
163 3300053125 Ga0500618_000032 Ga0500618_000032_99469_100029 186
164 iso_pu_bacteria 2510917026 2511172894 186
165 iso_pu_bacteria 2562617112 2563064988 186
166 iso_pu_bacteria 2585427633 2585996290 186
167 iso_pu_bacteria 2585427634 2586000902 186
168 iso_pu_bacteria 2711768613 2713482023 186
169 iso_pu_bacteria 2932401849 2932405774 186
170 3300031995 Ga0307409_100646731 Ga0307409_1006467312 187
171 3300037471 Ga0395905_0041004 Ga0395905_0041004_684_1250 187
172 3300042016 Ga0439463_100843 Ga0439463_100843_39_614 187
173 3300042437 Ga0439444_0009390 Ga0439444_0009390_875_1450 187
174 3300042461 Ga0439460_0079090 Ga0439460_0079090_387_962 187
175 3300042461 Ga0439460_0092115 Ga0439460_0092115_212_787 187
176 3300046524 Ga0495648_0224980 Ga0495648_0224980_44_607 187
177 3300053108 Ga0500562_097706 Ga0500562_097706_206_784 187
178 3300053118 Ga0500594_0009186 Ga0500594_0009186_50_613 187
179 iso_pu_bacteria 2919171160 2919174618 187
180 3300003323 rootH1_10274655 rootH1_102746552 188
181 3300005344 Ga0070661_100106358 Ga0070661_1001063581 188
182 3300005434 Ga0070709_10042307 Ga0070709_100423072 188
183 3300005467 Ga0070706_100609163 Ga0070706_1006091631 188
184 3300005614 Ga0068856_100376746 Ga0068856_1003767462 188
185 3300005616 Ga0068852_100467954 Ga0068852_1004679541 188
186 3300005981 Ga0081538_10023055 Ga0081538_100230555 188
187 3300010375 Ga0105239_10649316 Ga0105239_106493162 188
188 3300025910 Ga0207684_10564851 Ga0207684_105648512 188
189 3300025910 Ga0207684_10786326 Ga0207684_107863261 188
190 3300025920 Ga0207649_10081053 Ga0207649_100810532 188
191 3300025932 Ga0207690_10232092 Ga0207690_102320923 188
192 3300026116 Ga0207674_10147972 Ga0207674_101479724 188
193 3300041413 Ga0439465_0039013 Ga0439465_0039013_223_804 188
194 3300046452 Ga0495617_000021 Ga0495617_000021_21843_22409 188
195 3300046460 Ga0495638_0052826 Ga0495638_0052826_146_712 188
196 3300046471 Ga0495650_0000845 Ga0495650_0000845_514_1080 188
197 3300046492 Ga0495585_0003831 Ga0495585_0003831_6741_7307 188
198 3300046507 Ga0495606_0001610 Ga0495606_0001610_229_825 188
199 3300046524 Ga0495648_0008159 Ga0495648_0008159_2796_3362 188
200 3300046524 Ga0495648_0011509 Ga0495648_0011509_4896_5462 188
201 3300046530 Ga0495654_0004092 Ga0495654_0004092_3890_4456 188
202 3300046558 Ga0495633_0027557 Ga0495633_0027557_2171_2737 188
203 3300046616 Ga0495668_0000606 Ga0495668_0000606_21078_21644 188
204 3300046665 Ga0495661_0011708 Ga0495661_0011708_1017_1583 188
205 3300046692 Ga0495671_0000002 Ga0495671_0000002_732366_732932 188
206 3300047320 Ga0495672_0000022 Ga0495672_0000022_38677_39276 188
207 3300047323 Ga0495683_0008183 Ga0495683_0008183_1205_1771 188
208 3300047469 Ga0495673_0000005 Ga0495673_0000005_552663_553229 188
209 3300047469 Ga0495673_0000064 Ga0495673_0000064_117468_118034 188
210 3300047472 Ga0495686_0117145 Ga0495686_0117145_922_1488 188
211 3300048905 Ga0496102_0576745 Ga0496102_0576745_405_1004 188
212 3300048915 Ga0496112_0570120 Ga0496112_0570120_45_611 188
213 3300048924 Ga0496121_0347645 Ga0496121_0347645_215_781 188
214 3300048925 Ga0496122_0037538 Ga0496122_0037538_106_672 188
215 3300048929 Ga0496126_0039191 Ga0496126_0039191_3730_4296 188
216 3300053138 Ga0500564_004912 Ga0500564_004912_3736_4302 188
217 3300053139 Ga0500568_0096242 Ga0500568_0096242_239_820 188
218 3300053145 Ga0500586_105063 Ga0500586_105063_141_707 188
219 3300053158 Ga0500627_0220683 Ga0500627_0220683_226_807 188
220 iso_pu_bacteria 2842711865 2842714543 188
221 iso_pu_bacteria 2857558681 2857563535 188
222 3300005336 Ga0070680_100084223 Ga0070680_1000842232 189
223 3300005339 Ga0070660_100789423 Ga0070660_1007894231 189
224 3300005458 Ga0070681_10059821 Ga0070681_100598213 189
225 3300005530 Ga0070679_100086935 Ga0070679_1000869353 189
226 3300005535 Ga0070684_101076402 Ga0070684_1010764021 189
227 3300005564 Ga0070664_100157554 Ga0070664_1001575543 189
228 3300005616 Ga0068852_100003487 Ga0068852_1000034878 189
229 3300005616 Ga0068852_101271517 Ga0068852_1012715172 189
230 3300009093 Ga0105240_10028665 Ga0105240_100286656 189
231 3300009093 Ga0105240_10036629 Ga0105240_100366295 189
232 3300009545 Ga0105237_10776994 Ga0105237_107769942 189
233 3300013104 Ga0157370_10048435 Ga0157370_100484352 189
234 3300013307 Ga0157372_10440209 Ga0157372_104402092 189
235 3300025233 Ga0209437_105103 Ga0209437_1051032 189
236 3300025912 Ga0207707_10321002 Ga0207707_103210022 189
237 3300025913 Ga0207695_10061370 Ga0207695_100613703 189
238 3300025919 Ga0207657_10832880 Ga0207657_108328801 189
239 3300025921 Ga0207652_10419324 Ga0207652_104193242 189
240 3300025924 Ga0207694_10221769 Ga0207694_102217692 189
241 3300025944 Ga0207661_11128322 Ga0207661_111283221 189
242 3300025945 Ga0207679_10255280 Ga0207679_102552802 189
243 3300025949 Ga0207667_10166270 Ga0207667_101662702 189
244 3300026078 Ga0207702_11141080 Ga0207702_111410801 189
245 3300026142 Ga0207698_11101716 Ga0207698_111017161 189
246 3300032004 Ga0307414_10965241 Ga0307414_109652411 189
247 3300046542 Ga0495597_0000447 Ga0495597_0000447_22899_23507 189
248 3300048924 Ga0496121_0110846 Ga0496121_0110846_624_1193 189
249 iso_pu_bacteria 2821131069 2821132866 189
250 iso_pu_bacteria 2841911363 2841916442 189
251 iso_pu_bacteria 2841917233 2841922339 189
252 3300003771 Ga0055526_1000013 Ga0055526_100001310 190
253 3300003771 Ga0055526_1039916 Ga0055526_10399162 190
254 3300005262 Ga0065165_1000203 Ga0065165_100020343 190
255 3300005468 Ga0070707_100370486 Ga0070707_1003704862 190
256 3300005564 Ga0070664_100221977 Ga0070664_1002219772 190
257 3300005937 Ga0081455_10110035 Ga0081455_101100352 190
258 3300005981 Ga0081538_10020583 Ga0081538_100205833 190
259 3300005981 Ga0081538_10147308 Ga0081538_101473082 190
260 3300006038 Ga0075365_10000779 Ga0075365_100007795 190
261 3300025295 Ga0209564_1000002 Ga0209564_10000021000 190
262 3300025295 Ga0209564_1009160 Ga0209564_10091607 190
263 3300025297 Ga0209758_1000237 Ga0209758_100023720 190
264 3300025302 Ga0207426_1000018 Ga0207426_1000018290 190
265 3300025922 Ga0207646_10384244 Ga0207646_103842442 190
266 3300025945 Ga0207679_10183523 Ga0207679_101835233 190
267 3300028794 Ga0307515_10435952 Ga0307515_104359522 190
268 3300031548 Ga0307408_101203168 Ga0307408_1012031681 190
269 3300041413 Ga0439465_0025367 Ga0439465_0025367_167_739 190
270 3300042007 Ga0439449_0036674 Ga0439449_0036674_541_1113 190
271 3300044673 Ga0453683_0132158 Ga0453683_0132158_10_588 190
272 3300044712 Ga0453684_0205002 Ga0453684_0205002_1417_1989 190
273 3300046457 Ga0495590_0000010 Ga0495590_0000010_201375_201947 190
274 3300046457 Ga0495590_0061040 Ga0495590_0061040_736_1308 190
275 3300046460 Ga0495638_0000027 Ga0495638_0000027_316873_317475 190
276 3300046463 Ga0495653_0000010 Ga0495653_0000010_46957_47529 190
277 3300046471 Ga0495650_0002454 Ga0495650_0002454_2077_2679 190
278 3300046471 Ga0495650_0002964 Ga0495650_0002964_911_1498 190
279 3300046471 Ga0495650_0005528 Ga0495650_0005528_260_832 190
280 3300046472 Ga0495580_0078832 Ga0495580_0078832_288_860 190
281 3300046474 Ga0495605_0144456 Ga0495605_0144456_210_782 190
282 3300046506 Ga0495583_0000006 Ga0495583_0000006_235549_236151 190
283 3300046507 Ga0495606_0000128 Ga0495606_0000128_10268_10840 190
284 3300046513 Ga0495616_0358037 Ga0495616_0358037_23_595 190
285 3300046520 Ga0495637_0001691 Ga0495637_0001691_4083_4670 190
286 3300046524 Ga0495648_0000078 Ga0495648_0000078_13194_13796 190
287 3300046528 Ga0495642_0000864 Ga0495642_0000864_5995_6597 190
288 3300046528 Ga0495642_0062149 Ga0495642_0062149_554_1126 190
289 3300046530 Ga0495654_0000002 Ga0495654_0000002_673772_674359 190
290 3300046557 Ga0495622_0000281 Ga0495622_0000281_17774_18376 190
291 3300046557 Ga0495622_0013817 Ga0495622_0013817_1335_1907 190
292 3300046558 Ga0495633_0000375 Ga0495633_0000375_18295_18897 190
293 3300046616 Ga0495668_0000394 Ga0495668_0000394_18162_18764 190
294 3300046660 Ga0495625_0000516 Ga0495625_0000516_23938_24540 190
295 3300046660 Ga0495625_0139566 Ga0495625_0139566_729_1316 190
296 3300046810 Ga0495660_0197602 Ga0495660_0197602_347_934 190
297 3300047319 Ga0495674_0000766 Ga0495674_0000766_749_1321 190
298 3300047320 Ga0495672_0192001 Ga0495672_0192001_154_726 190
299 3300047323 Ga0495683_0229638 Ga0495683_0229638_190_762 190
300 3300047443 Ga0495687_005420 Ga0495687_005420_3349_3921 190
301 3300047443 Ga0495687_006107 Ga0495687_006107_3348_3920 190
302 3300048091 Ga0495626_0017436 Ga0495626_0017436_1641_2213 190
303 3300048903 Ga0496100_0000040 Ga0496100_0000040_31843_32415 190
304 3300048904 Ga0496101_0000175 Ga0496101_0000175_9081_9653 190
305 3300048905 Ga0496102_0000203 Ga0496102_0000203_57524_58096 190
306 3300048906 Ga0496103_0000387 Ga0496103_0000387_28653_29225 190
307 3300048907 Ga0496104_0033257 Ga0496104_0033257_2351_2923 190
308 3300048907 Ga0496104_0065602 Ga0496104_0065602_79_651 190
309 3300048908 Ga0496105_0034466 Ga0496105_0034466_1654_2226 190
310 3300048909 Ga0496106_0158640 Ga0496106_0158640_39_611 190
311 3300048910 Ga0496107_0583114 Ga0496107_0583114_162_734 190
312 3300048911 Ga0496108_0449304 Ga0496108_0449304_58_630 190
313 3300048915 Ga0496112_0040582 Ga0496112_0040582_1475_2047 190
314 3300048916 Ga0496113_0003005 Ga0496113_0003005_5695_6267 190
315 3300048919 Ga0496116_0211869 Ga0496116_0211869_364_936 190
316 3300048920 Ga0496117_0000532 Ga0496117_0000532_1612_2184 190
317 3300048921 Ga0496118_0000206 Ga0496118_0000206_60409_60981 190
318 3300048922 Ga0496119_0041446 Ga0496119_0041446_525_1097 190
319 3300048923 Ga0496120_0201240 Ga0496120_0201240_127_699 190
320 3300048924 Ga0496121_0000455 Ga0496121_0000455_60486_61058 190
321 3300048924 Ga0496121_0004347 Ga0496121_0004347_14669_15241 190
322 3300048925 Ga0496122_0064507 Ga0496122_0064507_373_945 190
323 3300048926 Ga0496123_0003249 Ga0496123_0003249_4481_5053 190
324 3300048927 Ga0496124_0566266 Ga0496124_0566266_158_730 190
325 3300049459 Ga0495678_001609 Ga0495678_001609_895_1497 190
326 3300049459 Ga0495678_012131 Ga0495678_012131_1370_1972 190
327 3300049460 Ga0495682_0130871 Ga0495682_0130871_211_783 190
328 3300050492 nmdc:mga0yw44_543_c1 nmdc:mga0yw44_543_c1_8894_9466 190
329 3300003320 rootH2_10051586 rootH2_100515862 191
330 3300003322 rootL2_10166893 rootL2_101668931 191
331 3300003322 rootL2_10166900 rootL2_101669001 191
332 3300003323 rootH1_10024353 rootH1_100243531 191
333 3300003763 Ga0055529_1000068 Ga0055529_100006839 191
334 3300005435 Ga0070714_100612029 Ga0070714_1006120291 191
335 3300005437 Ga0070710_10382912 Ga0070710_103829121 191
336 3300005445 Ga0070708_100396396 Ga0070708_1003963962 191
337 3300005467 Ga0070706_100219344 Ga0070706_1002193442 191
338 3300005468 Ga0070707_100194718 Ga0070707_1001947181 191
339 3300005983 Ga0081540_1025106 Ga0081540_10251064 191
340 3300006028 Ga0070717_10765816 Ga0070717_107658161 191
341 3300006163 Ga0070715_10129057 Ga0070715_101290571 191
342 3300006173 Ga0070716_100053684 Ga0070716_1000536844 191
343 3300006871 Ga0075434_100699170 Ga0075434_1006991701 191
344 3300007265 Ga0099794_10141096 Ga0099794_101410961 191
345 3300010159 Ga0099796_10084327 Ga0099796_100843272 191
346 3300013104 Ga0157370_10072896 Ga0157370_100728962 191
347 3300013306 Ga0163162_10451972 Ga0163162_104519721 191
348 3300025272 Ga0209455_1000026 Ga0209455_1000026473 191
349 3300025905 Ga0207685_10379422 Ga0207685_103794221 191
350 3300025906 Ga0207699_10144888 Ga0207699_101448881 191
351 3300025910 Ga0207684_10345525 Ga0207684_103455252 191
352 3300025915 Ga0207693_10045246 Ga0207693_100452463 191
353 3300025939 Ga0207665_10039808 Ga0207665_100398082 191
354 3300025939 Ga0207665_10148766 Ga0207665_101487663 191
355 3300026078 Ga0207702_10589527 Ga0207702_105895273 191
356 3300027512 Ga0209179_1015292 Ga0209179_10152922 191
357 3300046501 Ga0495607_0049369 Ga0495607_0049369_1292_1882 191
358 3300046507 Ga0495606_0000798 Ga0495606_0000798_26734_27309 191
359 3300046512 Ga0495610_0001153 Ga0495610_0001153_12029_12604 191
360 3300046522 Ga0495643_0000022 Ga0495643_0000022_173803_174378 191
361 3300046694 Ga0495649_0008856 Ga0495649_0008856_798_1373 191
362 3300047320 Ga0495672_0000095 Ga0495672_0000095_17200_17775 191
363 3300049459 Ga0495678_000497 Ga0495678_000497_21042_21617 191
364 3300049571 Ga0501034_0348631 Ga0501034_0348631_640_1215 191
365 3300050512 nmdc:mga0n895_674341_c1 nmdc:mga0n895_674341_c1_27_626 191
366 3300005329 Ga0070683_100550390 Ga0070683_1005503901 192
367 3300005339 Ga0070660_100644905 Ga0070660_1006449051 192
368 3300005434 Ga0070709_10181030 Ga0070709_101810302 192
369 3300005436 Ga0070713_100678182 Ga0070713_1006781822 192
370 3300005530 Ga0070679_100545481 Ga0070679_1005454812 192
371 3300009093 Ga0105240_10114455 Ga0105240_101144554 192
372 3300009545 Ga0105237_10276437 Ga0105237_102764372 192
373 3300025906 Ga0207699_10160496 Ga0207699_101604962 192
374 3300025913 Ga0207695_10084828 Ga0207695_100848282 192
375 3300025914 Ga0207671_10167962 Ga0207671_101679622 192
376 3300046460 Ga0495638_0238833 Ga0495638_0238833_98_706 192
377 3300046522 Ga0495643_0132336 Ga0495643_0132336_71_652 192
378 3300046558 Ga0495633_0000898 Ga0495633_0000898_14950_15564 192
379 3300046660 Ga0495625_0052785 Ga0495625_0052785_1172_1750 192
380 3300003320 rootH2_10096546 rootH2_100965462 193
381 3300003323 rootH1_10075453 rootH1_100754535 193
382 3300005436 Ga0070713_101538194 Ga0070713_1015381941 193
383 3300005981 Ga0081538_10037185 Ga0081538_100371857 193
384 3300009545 Ga0105237_10000075 Ga0105237_10000075133 193
385 3300009551 Ga0105238_10025580 Ga0105238_100255804 193
386 3300013297 Ga0157378_10617133 Ga0157378_106171331 193
387 3300013306 Ga0163162_10000389 Ga0163162_1000038934 193
388 3300025914 Ga0207671_10000104 Ga0207671_100001048 193
389 3300025915 Ga0207693_10272244 Ga0207693_102722441 193
390 3300025924 Ga0207694_10022937 Ga0207694_100229373 193
391 3300025928 Ga0207700_10977279 Ga0207700_109772791 193
392 3300031251 Ga0265327_10036801 Ga0265327_100368014 193
393 3300037471 Ga0395905_0042110 Ga0395905_0042110_3398_3982 193
394 3300048924 Ga0496121_0021004 Ga0496121_0021004_3256_3852 193
395 3300048924 Ga0496121_0036169 Ga0496121_0036169_2985_3566 193
396 3300003323 rootH1_10232545 rootH1_102325452 194
397 3300005548 Ga0070665_100011328 Ga0070665_1000113285 194
398 3300006042 Ga0075368_10015193 Ga0075368_100151932 194
399 3300006048 Ga0075363_100037667 Ga0075363_1000376672 194
400 3300006051 Ga0075364_10110393 Ga0075364_101103932 194
401 3300006175 Ga0070712_100535819 Ga0070712_1005358192 194
402 3300009545 Ga0105237_10057163 Ga0105237_100571632 194
403 3300014497 Ga0182008_10147109 Ga0182008_101471092 194
404 3300014968 Ga0157379_10064383 Ga0157379_100643833 194
405 3300021388 Ga0213875_10263628 Ga0213875_102636281 194
406 3300025915 Ga0207693_10239956 Ga0207693_102399562 194
407 3300025929 Ga0207664_10302927 Ga0207664_103029271 194
408 3300027866 Ga0209813_10081483 Ga0209813_100814831 194
409 3300028379 Ga0268266_10005891 Ga0268266_100058916 194
410 3300036401 Ga0373937_1424617 Ga0373937_1424617_18_605 194
411 3300037853 Ga0436364_1289577 Ga0436364_1289577_111_728 194
412 3300039447 Ga0436361_0691906 Ga0436361_0691906_283_888 194
413 3300039450 Ga0436363_0255317 Ga0436363_0255317_125_742 194
414 3300042010 Ga0439452_067142 Ga0439452_067142_147_779 194
415 3300044656 Ga0466969_0167037 Ga0466969_0167037_280_897 194
416 3300044684 Ga0466966_0004411 Ga0466966_0004411_3564_4154 194
417 3300044684 Ga0466966_0010064 Ga0466966_0010064_5614_6231 194
418 3300044693 Ga0466961_0094217 Ga0466961_0094217_680_1270 194
419 3300044719 Ga0466971_0003531 Ga0466971_0003531_3851_4441 194
420 3300044765 Ga0466970_0048240 Ga0466970_0048240_50_640 194
421 3300045049 Ga0466959_0020380 Ga0466959_0020380_3868_4458 194
422 3300045836 Ga0466958_0152170 Ga0466958_0152170_299_889 194
423 3300046522 Ga0495643_0000117 Ga0495643_0000117_107553_108170 194
424 3300046542 Ga0495597_0000357 Ga0495597_0000357_184_801 194
425 3300046694 Ga0495649_0073996 Ga0495649_0073996_502_1104 194
426 3300046810 Ga0495660_0023936 Ga0495660_0023936_1099_1716 194
427 3300048917 Ga0496114_0107175 Ga0496114_0107175_1591_2181 194
428 3300048918 Ga0496115_0501396 Ga0496115_0501396_123_713 194
429 3300049583 Ga0501067_0180220 Ga0501067_0180220_460_1044 194
430 3300049823 Ga0501044_0851320 Ga0501044_0851320_111_716 194
431 3300050495 nmdc:mga04h51_105180_c1 nmdc:mga04h51_105180_c1_61_669 194
432 3300053153 Ga0500616_0045139 Ga0500616_0045139_1224_1808 194
433 3300061719 Ga0466962_0011757 Ga0466962_0011757_1543_2133 194
434 3300003316 rootH1_10003596 rootH1_100035963 195
435 3300003322 rootL2_10018938 rootL2_100189383 195
436 3300005445 Ga0070708_100201476 Ga0070708_1002014762 195
437 3300005467 Ga0070706_100815594 Ga0070706_1008155942 195
438 3300005468 Ga0070707_100642652 Ga0070707_1006426521 195
439 3300005471 Ga0070698_100535002 Ga0070698_1005350021 195
440 3300005518 Ga0070699_100400769 Ga0070699_1004007692 195
441 3300005536 Ga0070697_100140014 Ga0070697_1001400141 195
442 3300005539 Ga0068853_100483202 Ga0068853_1004832022 195
443 3300006173 Ga0070716_100378894 Ga0070716_1003788942 195
444 3300006844 Ga0075428_100404980 Ga0075428_1004049803 195
445 3300006852 Ga0075433_10293959 Ga0075433_102939591 195
446 3300006914 Ga0075436_100314284 Ga0075436_1003142842 195
447 3300007265 Ga0099794_10146840 Ga0099794_101468402 195
448 3300007788 Ga0099795_10221738 Ga0099795_102217381 195
449 3300009094 Ga0111539_10709644 Ga0111539_107096442 195
450 3300009147 Ga0114129_10332231 Ga0114129_103322311 195
451 3300010159 Ga0099796_10205448 Ga0099796_102054481 195
452 3300013307 Ga0157372_10352162 Ga0157372_103521622 195
453 3300025898 Ga0207692_10209173 Ga0207692_102091731 195
454 3300025915 Ga0207693_10123319 Ga0207693_101233192 195
455 3300025916 Ga0207663_10174087 Ga0207663_101740872 195
456 3300025929 Ga0207664_10212122 Ga0207664_102121222 195
457 3300025939 Ga0207665_10200344 Ga0207665_102003442 195
458 3300025949 Ga0207667_10295640 Ga0207667_102956402 195
459 3300026041 Ga0207639_10324828 Ga0207639_103248282 195
460 3300031730 Ga0307516_10002930 Ga0307516_100029304 195
461 3300031730 Ga0307516_10711487 Ga0307516_107114871 195
462 3300037853 Ga0436364_0047825 Ga0436364_0047825_290_916 195
463 3300038996 Ga0242420_070810 Ga0242420_070810_16_624 195
464 3300046462 Ga0495651_0309550 Ga0495651_0309550_255_878 195
465 3300046507 Ga0495606_0018452 Ga0495606_0018452_3051_3662 195
466 3300048909 Ga0496106_0693278 Ga0496106_0693278_13_678 195
467 3300050507 nmdc:mga05p37_779272_c1 nmdc:mga05p37_779272_c1_120_728 195
468 3300050511 nmdc:mga08y16_864316_c1 nmdc:mga08y16_864316_c1_24_689 195
469 3300050512 nmdc:mga0n895_480034_c1 nmdc:mga0n895_480034_c1_581_1189 195
470 3300050513 nmdc:mga0rr50_474809_c1 nmdc:mga0rr50_474809_c1_43_708 195
471 3300050514 nmdc:mga08x19_278713_c1 nmdc:mga08x19_278713_c1_298_906 195
472 3300050515 nmdc:mga0a205_404053_c1 nmdc:mga0a205_404053_c1_550_1158 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

34

80

0.97

PF21993

TetR_C_13_2

Transcriptional regulator LmrA/YxaF-like, C-terminal domain

102

201

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.8382 10 189
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8272 8 189
4yze-assembly1.cif.gz_C crystal structure of e.coli nemr reduced form 0.8265 11 190
4yze-assembly2.cif.gz_D crystal structure of e.coli nemr reduced form 0.8178 10 190
4yze-assembly2.cif.gz_B crystal structure of e.coli nemr reduced form 0.8109 11 194
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9407 11 57 1.10.10.60
2i10B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9372 15 64 1.10.10.60
1jt6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9319 11 57 1.10.10.60
1jusB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9293 12 57 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9293 11 57 1.10.10.60
ID Description Score Start End GO Terms
AF-B0T975-F1-model_v4 Transcriptional regulator, TetR family 0.9518 8 192 GO:0003677
GO:0006355
AF-A0A562RME9-F1-model_v4 TetR family transcriptional regulator 0.9503 1 188 GO:0003677
GO:0006355
AF-A0A1M5LM70-F1-model_v4 Transcriptional regulator, TetR family 0.9468 1 189 GO:0003677
GO:0006355
AF-A0A5P2HAA7-F1-model_v4 TetR family transcriptional regulator 0.9452 1 189 GO:0003677
GO:0006355
AF-A0A7W4N5W1-F1-model_v4 deleted 0.945 16 190

Feature Viewer

pLDDT pTM Quality
91.63 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map