F450436

General Info

Members Datasets Scaffolds Average Seq Length
470 253 940 216

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10149892|Ga0307410_101498922
Length 246
Sequence MFAATDDLGPLQLTWTDLHWEKAMHQRPVRVFVVDDHTVVRRGLRAYLELVDDMEVVGEAADGQEALEDIAALVAAGRPPDVALMDLLMPGMDGVAATAAITQRYPAMEVVAMTSFTRADLVHGALQAGAAGYLLKDAEADEVAAAIRAACRGEVHLDPAIAKQLTRSLVAPKPQPLQALTDREREVLILVAEGLSNQQIADSLVISERTARTHVSNILSKLGVASRTQAALVAIRGGIAPAPPAS

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
144 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
165 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
166 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
167 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
168 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
169 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
247 2643221578 Streptomyces sp. Root63 Isolate Unclassified
248 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
249 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
250 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
251 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
252 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
253 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 5.96
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 5.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10149892 3300031852 Bacteria 1735
2 SwRhRL2b_contig_2023360 2162886007 Bacteria 2776
3 JGI24743J22301_10038336 3300001991 Bacteria 957
4 JGI24748J21848_1015541 3300002074 Bacteria 906
5 JGI25406J46586_10004317 3300003203 Bacteria 6631
6 JGI25406J46586_10081113 3300003203 Bacteria 995
7 JGI25407J50210_10000464 3300003373 Bacteria 7993
8 JGI25407J50210_10004204 3300003373 Bacteria 3503
9 JGI25407J50210_10006550 3300003373 Bacteria 2903
10 JGI25407J50210_10007784 3300003373 Bacteria 2691
11 JGI25407J50210_10043990 3300003373 Bacteria 1141
12 JGI25407J50210_10049658 3300003373 Bacteria 1065
13 Ga0065704_10003630 3300005289 Viruses 6179
14 Ga0065707_10000654 3300005295 Bacteria 16208
15 Ga0065707_10001744 3300005295 Bacteria 6635
16 Ga0070683_100176129 3300005329 Bacteria 2030
17 Ga0070683_100265004 3300005329 Bacteria 1634
18 Ga0068869_100060890 3300005334 Bacteria 2767
19 Ga0070680_100117533 3300005336 Bacteria 2217
20 Ga0070680_100235945 3300005336 Bacteria 1545
21 Ga0070682_100098255 3300005337 Bacteria 1928
22 Ga0068868_100251561 3300005338 Bacteria 1487
23 Ga0068868_100293477 3300005338 Bacteria 1379
24 Ga0070689_100174533 3300005340 Bacteria 1743
25 Ga0070689_100594521 3300005340 Bacteria 958
26 Ga0070687_100003043 3300005343 Bacteria 6450
27 Ga0070692_10003822 3300005345 Bacteria 6195
28 Ga0070668_100190024 3300005347 Bacteria 1682
29 Ga0070675_100186943 3300005354 Bacteria 1793
30 Ga0070674_100010344 3300005356 Bacteria 5635
31 Ga0070673_100067751 3300005364 Bacteria 2856
32 Ga0070713_100176097 3300005436 Bacteria 1920
33 Ga0070710_10052685 3300005437 Bacteria 2289
34 Ga0070710_10237013 3300005437 Unclassified 1167
35 Ga0070701_10011756 3300005438 Bacteria 3928
36 Ga0070701_10514437 3300005438 Bacteria 779
37 Ga0070700_100081380 3300005441 Bacteria 2092
38 Ga0070694_100203668 3300005444 Bacteria 1476
39 Ga0070694_100534740 3300005444 Unclassified 937
40 Ga0070708_100019281 3300005445 Bacteria 5729
41 Ga0070708_100197282 3300005445 Bacteria 1883
42 Ga0070663_100229054 3300005455 Bacteria 1462
43 Ga0070678_100388792 3300005456 Bacteria 1209
44 Ga0070681_10035489 3300005458 Bacteria 5010
45 Ga0068867_100007841 3300005459 Bacteria 7544
46 Ga0068867_100080424 3300005459 Bacteria 2454
47 Ga0070707_100683114 3300005468 Unclassified 989
48 Ga0070698_100006636 3300005471 Bacteria 12548
49 Ga0070698_100021365 3300005471 Bacteria 6780
50 Ga0070698_100029566 3300005471 Bacteria 5689
51 Ga0070698_100139224 3300005471 Bacteria 2380
52 Ga0070698_100158516 3300005471 Bacteria 2208
53 Ga0070699_100174247 3300005518 Bacteria 1907
54 Ga0070699_100355849 3300005518 Unclassified 1319
55 Ga0070679_100012170 3300005530 Bacteria 8219
56 Ga0070684_100048745 3300005535 Bacteria 3675
57 Ga0068853_100961637 3300005539 Unclassified 821
58 Ga0070672_100215815 3300005543 Bacteria 1608
59 Ga0070686_100027513 3300005544 Bacteria 3442
60 Ga0070664_100058219 3300005564 Bacteria 3286
61 Ga0070664_100394233 3300005564 Bacteria 1265
62 Ga0068854_100360879 3300005578 Bacteria 1192
63 Ga0070702_100005196 3300005615 Bacteria 6031
64 Ga0068852_100044578 3300005616 Bacteria 3768
65 Ga0068852_101158557 3300005616 Bacteria 794
66 Ga0068859_100058200 3300005617 Bacteria 3892
67 Ga0068866_10246843 3300005718 Bacteria 1090
68 Ga0068861_100157853 3300005719 Bacteria 1868
69 Ga0068870_10049095 3300005840 Bacteria 2224
70 Ga0068863_100050474 3300005841 Bacteria 3943
71 Ga0068858_100289587 3300005842 Bacteria 1561
72 Ga0068860_100191781 3300005843 Bacteria 1978
73 Ga0068862_100158630 3300005844 Bacteria 2018
74 Ga0081455_10021532 3300005937 Bacteria 6045
75 Ga0081455_10085756 3300005937 Bacteria 2567
76 Ga0081538_10001303 3300005981 Bacteria 25819
77 Ga0081538_10001587 3300005981 Bacteria 23317
78 Ga0081538_10001925 3300005981 Bacteria 20812
79 Ga0081538_10002068 3300005981 Bacteria 20015
80 Ga0081538_10002987 3300005981 Bacteria 16123
81 Ga0081538_10004172 3300005981 Bacteria 13410
82 Ga0081538_10006075 3300005981 Bacteria 10734
83 Ga0081538_10008090 3300005981 Bacteria 8979
84 Ga0081538_10008522 3300005981 Bacteria 8689
85 Ga0081538_10009033 3300005981 Bacteria 8370
86 Ga0081538_10009679 3300005981 Bacteria 8003
87 Ga0081538_10036538 3300005981 Bacteria 3203
88 Ga0081538_10086342 3300005981 Bacteria 1643
89 Ga0081538_10116185 3300005981 Bacteria 1299
90 Ga0081538_10132909 3300005981 Bacteria 1165
91 Ga0081540_1044189 3300005983 Bacteria 2277
92 Ga0081539_10000037 3300005985 Bacteria 296160
93 Ga0081539_10002255 3300005985 Bacteria 28035
94 Ga0081539_10004050 3300005985 Bacteria 16791
95 Ga0081539_10004311 3300005985 Bacteria 15902
96 Ga0081539_10004958 3300005985 Bacteria 14110
97 Ga0081539_10037173 3300005985 Bacteria 2903
98 Ga0070717_10186276 3300006028 Bacteria 1812
99 Ga0075432_10012258 3300006058 Bacteria 2914
100 Ga0075432_10135662 3300006058 Bacteria 935
101 Ga0070716_100016034 3300006173 Unclassified 3862
102 Ga0075427_10003119 3300006194 Bacteria 2268
103 Ga0097621_100282910 3300006237 Unclassified 1460
104 Ga0075428_100007475 3300006844 Bacteria 12106
105 Ga0075428_100338323 3300006844 Bacteria 1616
106 Ga0075428_100497190 3300006844 Bacteria 1305
107 Ga0075430_100001574 3300006846 Bacteria 18657
108 Ga0075430_100010055 3300006846 Bacteria 8005
109 Ga0075430_100192301 3300006846 Bacteria 1696
110 Ga0075431_100029881 3300006847 Bacteria 5610
111 Ga0075431_100038657 3300006847 Bacteria 4915
112 Ga0075431_100074849 3300006847 Bacteria 3494
113 Ga0075431_100093367 3300006847 Bacteria 3105
114 Ga0075431_100602007 3300006847 Bacteria 1083
115 Ga0075433_10007180 3300006852 Bacteria 8821
116 Ga0075433_10009759 3300006852 Bacteria 7691
117 Ga0075433_10036024 3300006852 Bacteria 4259
118 Ga0075433_10187145 3300006852 Bacteria 1842
119 Ga0075434_100164502 3300006871 Bacteria 2238
120 Ga0075429_100004947 3300006880 Bacteria 11477
121 Ga0075429_100146970 3300006880 Bacteria 2063
122 Ga0075429_100428280 3300006880 Bacteria 1159
123 Ga0068865_100058029 3300006881 Bacteria 2702
124 Ga0097620_100058199 3300006931 Bacteria 3892
125 Ga0099794_10026345 3300007265 Bacteria 2687
126 Ga0111539_10012980 3300009094 Bacteria 10424
127 Ga0111539_10023432 3300009094 Bacteria 7586
128 Ga0111539_10049476 3300009094 Bacteria 5011
129 Ga0111539_10052016 3300009094 Bacteria 4877
130 Ga0111539_10206606 3300009094 Bacteria 2289
131 Ga0111539_11679947 3300009094 Bacteria 736
132 Ga0105245_10004866 3300009098 Bacteria 11827
133 Ga0105245_10811156 3300009098 Bacteria 974
134 Ga0114129_10003721 3300009147 Bacteria 21500
135 Ga0114129_10036052 3300009147 Bacteria 6986
136 Ga0114129_10160095 3300009147 Bacteria 3076
137 Ga0114129_10272091 3300009147 Bacteria 2266
138 Ga0114129_10388545 3300009147 Bacteria 1841
139 Ga0114129_10658615 3300009147 Bacteria 1350
140 Ga0105243_10067861 3300009148 Bacteria 2873
141 Ga0105243_10158766 3300009148 Bacteria 1948
142 Ga0105242_10072967 3300009176 Bacteria 2852
143 Ga0105249_10012552 3300009553 Bacteria 7468
144 Ga0099796_10007829 3300010159 Bacteria 2815
145 Ga0105239_10081252 3300010375 Bacteria 3567
146 Ga0105239_10607646 3300010375 Bacteria 1248
147 Ga0105246_10397588 3300011119 Bacteria 1143
148 Ga0157378_10144057 3300013297 Bacteria 2215
149 Ga0157375_10010060 3300013308 Bacteria 8317
150 Ga0163163_10541949 3300014325 Unclassified 1226
151 Ga0157380_10050242 3300014326 Bacteria 3293
152 Ga0157377_10002969 3300014745 Bacteria 7589
153 Ga0157379_10891374 3300014968 Bacteria 843
154 Ga0213876_10033819 3300021384 Bacteria 2695
155 Ga0213871_10016844 3300021441 Bacteria 1767
156 Ga0207692_10100388 3300025898 Bacteria 1587
157 Ga0207685_10017843 3300025905 Bacteria 2305
158 Ga0207685_10070901 3300025905 Bacteria 1412
159 Ga0207643_10003623 3300025908 Bacteria 8322
160 Ga0207684_10249205 3300025910 Bacteria 1532
161 Ga0207707_10021886 3300025912 Bacteria 5589
162 Ga0207693_10048077 3300025915 Bacteria 3350
163 Ga0207693_10324656 3300025915 Bacteria 1205
164 Ga0207660_10144019 3300025917 Bacteria 1824
165 Ga0207662_10000687 3300025918 Bacteria 15401
166 Ga0207662_10109683 3300025918 Bacteria 1719
167 Ga0207652_10008589 3300025921 Bacteria 8220
168 Ga0207646_10025583 3300025922 Bacteria 5398
169 Ga0207646_10073315 3300025922 Bacteria 3058
170 Ga0207646_10888333 3300025922 Unclassified 791
171 Ga0207694_10094657 3300025924 Bacteria 2360
172 Ga0207650_10131982 3300025925 Bacteria 1955
173 Ga0207659_10678768 3300025926 Bacteria 881
174 Ga0207700_10154176 3300025928 Bacteria 1902
175 Ga0207690_10284226 3300025932 Bacteria 1289
176 Ga0207706_10007027 3300025933 Bacteria 10408
177 Ga0207686_10005065 3300025934 Bacteria 7092
178 Ga0207686_10046252 3300025934 Bacteria 2683
179 Ga0207709_10020831 3300025935 Bacteria 3704
180 Ga0207670_10041345 3300025936 Bacteria 3031
181 Ga0207669_10025949 3300025937 Bacteria 3178
182 Ga0207704_10142296 3300025938 Bacteria 1680
183 Ga0207665_10012466 3300025939 Bacteria 5582
184 Ga0207691_10071679 3300025940 Bacteria 3126
185 Ga0207689_10073975 3300025942 Bacteria 2800
186 Ga0207661_10081316 3300025944 Bacteria 2676
187 Ga0207661_10258769 3300025944 Bacteria 1549
188 Ga0207712_10042694 3300025961 Bacteria 3125
189 Ga0207668_10224710 3300025972 Bacteria 1510
190 Ga0207640_10100708 3300025981 Bacteria 2025
191 Ga0207677_10174895 3300026023 Bacteria 1683
192 Ga0207703_10832775 3300026035 Bacteria 882
193 Ga0207639_10083242 3300026041 Bacteria 2539
194 Ga0207678_10014403 3300026067 Bacteria 6952
195 Ga0207708_10001746 3300026075 Bacteria 16058
196 Ga0207708_10079246 3300026075 Bacteria 2523
197 Ga0207708_10307909 3300026075 Bacteria 1290
198 Ga0207641_10059152 3300026088 Bacteria 3263
199 Ga0207648_10002341 3300026089 Bacteria 20444
200 Ga0207648_10076945 3300026089 Bacteria 2908
201 Ga0207648_10983770 3300026089 Bacteria 790
202 Ga0207676_10122023 3300026095 Bacteria 2199
203 Ga0207674_10010663 3300026116 Bacteria 10392
204 Ga0207675_100148071 3300026118 Bacteria 2233
205 Ga0207683_10012149 3300026121 Bacteria 7351
206 Ga0207683_10695567 3300026121 Bacteria 942
207 Ga0207698_10697943 3300026142 Bacteria 1009
208 Ga0207428_10008189 3300027907 Bacteria 9458
209 Ga0207428_10045924 3300027907 Bacteria 3514
210 Ga0207428_10230319 3300027907 Bacteria 1387
211 Ga0268265_10055724 3300028380 Bacteria 3005
212 Ga0268264_10073472 3300028381 Bacteria 2902
213 Ga0265323_10097847 3300028653 Unclassified 974
214 Ga0268256_1021386 3300030500 Bacteria 1722
215 Ga0307408_100015877 3300031548 Bacteria 5019
216 Ga0316579_10008074 3300031691 Bacteria 4373
217 Ga0316579_10117462 3300031691 Unclassified 1277
218 Ga0316576_10009589 3300031727 Bacteria 6256
219 Ga0316576_10169047 3300031727 Unclassified 1650
220 Ga0316576_10276220 3300031727 Unclassified 1259
221 Ga0307405_10003723 3300031731 Bacteria 7078
222 Ga0316577_10000026 3300031733 Bacteria 32923
223 Ga0316577_10011661 3300031733 Unclassified 4768
224 Ga0316577_10175693 3300031733 Bacteria 1209
225 Ga0316577_10305919 3300031733 Bacteria 901
226 Ga0307413_10187569 3300031824 Bacteria 1481
227 Ga0307410_10006777 3300031852 Bacteria 6213
228 Ga0326468_10006387 3300031889 Bacteria 1090
229 Ga0307406_10230592 3300031901 Bacteria 1382
230 Ga0307409_100004570 3300031995 Bacteria 7803
231 Ga0307409_100035571 3300031995 Bacteria 3651
232 Ga0307409_100159497 3300031995 Bacteria 1970
233 Ga0307409_100990462 3300031995 Bacteria 858
234 Ga0307416_100004535 3300032002 Bacteria 8388
235 Ga0307416_100039080 3300032002 Bacteria 3669
236 Ga0307416_100077100 3300032002 Bacteria 2798
237 Ga0307416_100321836 3300032002 Bacteria 1549
238 Ga0307414_10599433 3300032004 Bacteria 988
239 Ga0307414_10884767 3300032004 Bacteria 818
240 Ga0307415_100000277 3300032126 Bacteria 22179
241 Ga0307415_100024803 3300032126 Bacteria 3752
242 Ga0307415_100363807 3300032126 Bacteria 1222
243 Ga0316585_10005188 3300032137 Unclassified 3670
244 Ga0316580_10030375 3300032139 Bacteria 1673
245 Ga0373949_0030635 3300035090 Bacteria 1280
246 Ga0373939_0112831 3300035114 Bacteria 949
247 Ga0373941_0052603 3300035115 Bacteria 1300
248 Ga0373931_0274969 3300035691 Bacteria 1032
249 Ga0373937_0148141 3300036401 Bacteria 2198
250 Ga0316582_0002666 3300036647 Bacteria 8451
251 Ga0316582_0089686 3300036647 Unclassified 2022
252 Ga0316582_0230149 3300036647 Bacteria 1269
253 Ga0316584_0011590 3300036712 Bacteria 6199
254 Ga0316584_0013121 3300036712 Bacteria 5856
255 Ga0316584_0016180 3300036712 Bacteria 5345
256 Ga0316584_0103992 3300036712 Bacteria 2126
257 Ga0316584_0105983 3300036712 Bacteria 2104
258 Ga0395899_0464639 3300037312 Bacteria 826
259 Ga0395900_0078337 3300037418 Bacteria 3396
260 Ga0395900_0100972 3300037418 Bacteria 2963
261 Ga0395900_0110493 3300037418 Bacteria 2824
262 Ga0395900_0178644 3300037418 Bacteria 2158
263 Ga0395900_0195602 3300037418 Bacteria 2049
264 Ga0395898_0012332 3300037466 Bacteria 8839
265 Ga0395898_0120795 3300037466 Bacteria 2510
266 Ga0395905_0009849 3300037471 Bacteria 9316
267 Ga0395905_0338327 3300037471 Bacteria 1396
268 Ga0395905_0614488 3300037471 Bacteria 989
269 Ga0316581_0024664 3300037588 Unclassified 1785
270 Ga0436364_0832268 3300037853 Bacteria 2918
271 Ga0436364_1451732 3300037853 Unclassified 899
272 Ga0395901_0040099 3300038443 Bacteria 4848
273 Ga0395901_0159083 3300038443 Bacteria 2372
274 Ga0395901_0578898 3300038443 Bacteria 1134
275 Ga0395901_0808221 3300038443 Bacteria 926
276 Ga0436365_0417044 3300039437 Bacteria 4322
277 Ga0436365_0910243 3300039437 Unclassified 1434
278 Ga0436365_0960932 3300039437 Bacteria 8562
279 Ga0436365_1651544 3300039437 Bacteria 2484
280 Ga0436361_0598979 3300039447 Bacteria 7131
281 Ga0436363_0979902 3300039450 Bacteria 14761
282 Ga0436363_1044242 3300039450 Unclassified 2103
283 Ga0436362_0316236 3300039453 Bacteria 1402
284 Ga0436362_0384331 3300039453 Bacteria 1575
285 Ga0436362_0526364 3300039453 Bacteria 3635
286 Ga0439466_0028648 3300041411 Bacteria 1921
287 Ga0439450_000147 3300042008 Bacteria 7749
288 Ga0439450_011374 3300042008 Bacteria 1742
289 Ga0439454_003735 3300042011 Bacteria 1713
290 Ga0439455_0022079 3300042012 Bacteria 1522
291 Ga0439455_0068905 3300042012 Bacteria 948
292 Ga0439463_061128 3300042016 Bacteria 963
293 Ga0450900_010751 3300042136 Bacteria 1178
294 Ga0439444_0000119 3300042437 Bacteria 6520
295 Ga0439464_0012512 3300042439 Bacteria 2261
296 Ga0439460_0001986 3300042461 Bacteria 4890
297 Ga0439460_0026636 3300042461 Bacteria 1619
298 Ga0451577_0001549 3300042876 Bacteria 30178
299 Ga0451577_0029208 3300042876 Bacteria 4982
300 Ga0439440_0000443 3300042993 Bacteria 6923
301 Ga0466966_0023029 3300044684 Bacteria 4081
302 Ga0466963_0039608 3300044694 Bacteria 3087
303 Ga0453684_0000764 3300044712 Bacteria 111547
304 Ga0453684_0022771 3300044712 Bacteria 9276
305 Ga0453684_0471009 3300044712 Bacteria 1395
306 Ga0466957_0411261 3300044842 Bacteria 927
307 Ga0466959_0033082 3300045049 Bacteria 3826
308 Ga0466958_0585583 3300045836 Bacteria 725
309 Ga0466967_0085173 3300045976 Bacteria 2861
310 Ga0466967_0291281 3300045976 Bacteria 1569
311 Ga0466967_0404974 3300045976 Bacteria 1328
312 Ga0495653_0311044 3300046463 Bacteria 1024
313 Ga0495652_0023029 3300046529 Bacteria 5524
314 Ga0495640_0360147 3300046533 Bacteria 897
315 Ga0495658_0359864 3300046683 Bacteria 925
316 Ga0495613_0386939 3300046689 Bacteria 956
317 Ga0495581_0324298 3300047315 Bacteria 900
318 Ga0496100_0033479 3300048903 Bacteria 3216
319 Ga0496100_0056448 3300048903 Bacteria 2569
320 Ga0496100_0158484 3300048903 Bacteria 1621
321 Ga0496100_0322527 3300048903 Bacteria 1161
322 Ga0496101_0042223 3300048904 Bacteria 3255
323 Ga0496101_0366254 3300048904 Bacteria 1133
324 Ga0496102_0027404 3300048905 Bacteria 5088
325 Ga0496102_0051288 3300048905 Bacteria 3759
326 Ga0496104_0065971 3300048907 Bacteria 3436
327 Ga0496104_0070442 3300048907 Bacteria 3324
328 Ga0496105_0017427 3300048908 Bacteria 5759
329 Ga0496106_0003757 3300048909 Bacteria 11324
330 Ga0496106_0093733 3300048909 Bacteria 2321
331 Ga0496107_0040461 3300048910 Bacteria 3346
332 Ga0496108_0000093 3300048911 Bacteria 93493
333 Ga0496108_0007272 3300048911 Bacteria 8978
334 Ga0496108_0033755 3300048911 Bacteria 4250
335 Ga0496108_0064421 3300048911 Bacteria 3088
336 Ga0496109_0038912 3300048912 Bacteria 4302
337 Ga0496109_0316946 3300048912 Bacteria 1471
338 Ga0496109_0722118 3300048912 Bacteria 934
339 Ga0496110_0062102 3300048913 Bacteria 3299
340 Ga0496110_0101503 3300048913 Bacteria 2579
341 Ga0496110_0284727 3300048913 Bacteria 1505
342 Ga0496111_0058348 3300048914 Bacteria 2794
343 Ga0496112_0238236 3300048915 Bacteria 1773
344 Ga0496114_0063427 3300048917 Bacteria 3094
345 Ga0496114_0369764 3300048917 Bacteria 1269
346 Ga0501031_0004336 3300049568 Bacteria 9181
347 Ga0501031_0176869 3300049568 Bacteria 1394
348 Ga0501032_0025558 3300049569 Bacteria 4070
349 Ga0501032_0552549 3300049569 Bacteria 734
350 Ga0501033_0003321 3300049570 Bacteria 13286
351 Ga0501034_0188122 3300049571 Unclassified 2027
352 Ga0501034_0796139 3300049571 Bacteria 838
353 Ga0501036_0000787 3300049572 Bacteria 23494
354 Ga0501036_0068099 3300049572 Bacteria 3012
355 Ga0501036_0114184 3300049572 Unclassified 2282
356 Ga0501037_0024083 3300049573 Bacteria 4501
357 Ga0501038_0077799 3300049574 Bacteria 2800
358 Ga0501038_0489752 3300049574 Bacteria 941
359 Ga0501039_0009651 3300049575 Bacteria 7357
360 Ga0501039_0041258 3300049575 Bacteria 3564
361 Ga0501039_0082038 3300049575 Bacteria 2510
362 Ga0501040_0001366 3300049576 Bacteria 15412
363 Ga0501040_0011001 3300049576 Bacteria 5917
364 Ga0501040_0045322 3300049576 Bacteria 2999
365 Ga0501040_0109607 3300049576 Bacteria 1930
366 Ga0501040_0261002 3300049576 Bacteria 1236
367 Ga0501041_0002497 3300049577 Bacteria 10468
368 Ga0501041_0019491 3300049577 Bacteria 4051
369 Ga0501041_0423235 3300049577 Bacteria 844
370 Ga0501042_0000288 3300049578 Bacteria 24839
371 Ga0501042_0060128 3300049578 Bacteria 2714
372 Ga0501042_0210958 3300049578 Bacteria 1401
373 Ga0501046_0002896 3300049580 Bacteria 15911
374 Ga0501046_0175391 3300049580 Bacteria 1606
375 Ga0501046_0287149 3300049580 Bacteria 1204
376 Ga0501047_0367565 3300049581 Bacteria 1274
377 Ga0501048_0002443 3300049582 Bacteria 14183
378 Ga0501048_0063092 3300049582 Bacteria 2622
379 Ga0501048_0079821 3300049582 Bacteria 2309
380 Ga0501048_0735921 3300049582 Unclassified 708
381 Ga0501067_0009201 3300049583 Bacteria 5470
382 Ga0501068_0090226 3300049584 Bacteria 1890
383 Ga0501068_0291489 3300049584 Bacteria 1044
384 Ga0501068_0442856 3300049584 Bacteria 840
385 Ga0501069_0089739 3300049585 Bacteria 1738
386 Ga0501071_0005054 3300049587 Bacteria 8440
387 Ga0501071_0033930 3300049587 Bacteria 3628
388 Ga0501071_0057174 3300049587 Bacteria 2818
389 Ga0501071_0292937 3300049587 Bacteria 1233
390 Ga0501072_0008856 3300049588 Bacteria 7644
391 Ga0501072_0093652 3300049588 Bacteria 2386
392 Ga0501072_0094046 3300049588 Bacteria 2381
393 Ga0501072_0097480 3300049588 Bacteria 2337
394 Ga0501072_0101980 3300049588 Bacteria 2281
395 Ga0501072_0203366 3300049588 Bacteria 1579
396 Ga0501073_0068208 3300049589 Bacteria 2479
397 Ga0501074_0002753 3300049590 Bacteria 12309
398 Ga0501074_0091074 3300049590 Bacteria 2184
399 Ga0501074_0141648 3300049590 Bacteria 1720
400 Ga0501075_0000437 3300049591 Bacteria 24619
401 Ga0501075_0000981 3300049591 Bacteria 18184
402 Ga0501075_0019913 3300049591 Bacteria 4873
403 Ga0501075_0042948 3300049591 Bacteria 3390
404 Ga0501076_0007797 3300049592 Bacteria 7805
405 Ga0501076_0007938 3300049592 Bacteria 7743
406 Ga0501076_0008382 3300049592 Bacteria 7575
407 Ga0501076_0240894 3300049592 Bacteria 1480
408 Ga0501077_0005575 3300049593 Bacteria 7664
409 Ga0501257_111226 3300049686 Bacteria 726
410 Ga0501079_0001201 3300049741 Bacteria 18150
411 Ga0501080_0108708 3300049742 Bacteria 2570
412 Ga0501080_0921938 3300049742 Bacteria 761
413 Ga0501081_0001540 3300049743 Bacteria 14175
414 Ga0501081_0029395 3300049743 Bacteria 3714
415 Ga0501081_0148342 3300049743 Bacteria 1684
416 Ga0501081_0414958 3300049743 Bacteria 997
417 Ga0501035_0089732 3300049822 Bacteria 2707
418 Ga0501045_0003021 3300049824 Bacteria 11519
419 Ga0501045_0006379 3300049824 Bacteria 8166
420 Ga0501045_0220809 3300049824 Bacteria 1411
421 nmdc:mga0yw44_165458_c1 3300050492 Bacteria 1450
422 nmdc:mga05p37_1720_c1 3300050507 Bacteria 25524
423 nmdc:mga05p37_352819_c1 3300050507 Bacteria 1731
424 nmdc:mga05p37_369113_c1 3300050507 Bacteria 1685
425 nmdc:mga05p37_370162_c1 3300050507 Bacteria 1682
426 nmdc:mga05p37_594067_c1 3300050507 Bacteria 1251
427 nmdc:mga05p37_63997_c1 3300050507 Bacteria 4526
428 nmdc:mga09592_110071_c1 3300050508 Bacteria 2363
429 nmdc:mga09592_198621_c1 3300050508 Bacteria 1737
430 nmdc:mga09592_606397_c1 3300050508 Unclassified 938
431 nmdc:mga0qj67_139307_c1 3300050509 Bacteria 1967
432 nmdc:mga0qj67_3468_c1 3300050509 Bacteria 11362
433 nmdc:mga06r32_40102_c1 3300050510 Bacteria 4445
434 nmdc:mga08y16_32954_c1 3300050511 Bacteria 5444
435 nmdc:mga08y16_36475_c1 3300050511 Bacteria 5164
436 nmdc:mga08y16_537782_c1 3300050511 Bacteria 1184
437 nmdc:mga0n895_161033_c1 3300050512 Bacteria 2276
438 nmdc:mga0n895_216839_c1 3300050512 Bacteria 1943
439 nmdc:mga0rr50_187583_c1 3300050513 Bacteria 1693
440 nmdc:mga0a205_15073_c1 3300050515 Bacteria 7218
441 nmdc:mga0a205_209292_c1 3300050515 Bacteria 1839
442 nmdc:mga0a205_236912_c1 3300050515 Bacteria 1707
443 nmdc:mga0a205_42021_c1 3300050515 Bacteria 4405
444 nmdc:mga0a205_51561_c1 3300050515 Bacteria 3972
445 Ga0495601_0423679 3300053077 Bacteria 862
446 Ga0495619_0301957 3300053085 Bacteria 1109
447 Ga0500641_0202947 3300053096 Bacteria 846
448 Ga0501084_0000414 3300054114 Bacteria 33024
449 Ga0501084_0065451 3300054114 Bacteria 3041
450 Ga0501084_0210786 3300054114 Bacteria 1639
451 Ga0590077_012551 3300059426 Bacteria 1759
452 Ga0501082_0002123 3300060353 Bacteria 17455
453 Ga0501082_0104044 3300060353 Bacteria 2456
454 Ga0501082_0387637 3300060353 Bacteria 1219
455 Ga0501082_0911065 3300060353 Bacteria 769
456 Ga0530510_0000576 3300061734 Bacteria 23667
457 Ga0530510_0005045 3300061734 Bacteria 9108
458 Ga0530510_0011757 3300061734 Bacteria 6142
459 Ga0530510_0020327 3300061734 Bacteria 4720
460 Ga0530510_0021738 3300061734 Bacteria 4566
461 Ga0530510_0271917 3300061734 Bacteria 1264
462 Ga0530510_0421722 3300061734 Bacteria 1007
463 2515855602 2515154155 Bacteria 7985436
464 2643899348 2643221578 Bacteria 9213798
465 2644406917 2643221673 Bacteria 9196637
466 2676492359 2675903060 Bacteria 10051191
467 2964379030 2964375228 Bacteria 4909004
468 8054163739 8054160619 Bacteria 7783213
469 8056063026 8056060235 Bacteria 7259403
470 8056210795 8056207758 Bacteria 8639239
471 Ga0307410_10149892
472 SwRhRL2b_contig_2023360
473 JGI24743J22301_10038336
474 JGI24748J21848_1015541
475 JGI25406J46586_10004317
476 JGI25406J46586_10081113
477 JGI25407J50210_10000464
478 JGI25407J50210_10004204
479 JGI25407J50210_10006550
480 JGI25407J50210_10007784
481 JGI25407J50210_10043990
482 JGI25407J50210_10049658
483 Ga0065704_10003630
484 Ga0065707_10000654
485 Ga0065707_10001744
486 Ga0070683_100176129
487 Ga0070683_100265004
488 Ga0068869_100060890
489 Ga0070680_100117533
490 Ga0070680_100235945
491 Ga0070682_100098255
492 Ga0068868_100251561
493 Ga0068868_100293477
494 Ga0070689_100174533
495 Ga0070689_100594521
496 Ga0070687_100003043
497 Ga0070692_10003822
498 Ga0070668_100190024
499 Ga0070675_100186943
500 Ga0070674_100010344
501 Ga0070673_100067751
502 Ga0070713_100176097
503 Ga0070710_10052685
504 Ga0070710_10237013
505 Ga0070701_10011756
506 Ga0070701_10514437
507 Ga0070700_100081380
508 Ga0070694_100203668
509 Ga0070694_100534740
510 Ga0070708_100019281
511 Ga0070708_100197282
512 Ga0070663_100229054
513 Ga0070678_100388792
514 Ga0070681_10035489
515 Ga0068867_100007841
516 Ga0068867_100080424
517 Ga0070707_100683114
518 Ga0070698_100006636
519 Ga0070698_100021365
520 Ga0070698_100029566
521 Ga0070698_100139224
522 Ga0070698_100158516
523 Ga0070699_100174247
524 Ga0070699_100355849
525 Ga0070679_100012170
526 Ga0070684_100048745
527 Ga0068853_100961637
528 Ga0070672_100215815
529 Ga0070686_100027513
530 Ga0070664_100058219
531 Ga0070664_100394233
532 Ga0068854_100360879
533 Ga0070702_100005196
534 Ga0068852_100044578
535 Ga0068852_101158557
536 Ga0068859_100058200
537 Ga0068866_10246843
538 Ga0068861_100157853
539 Ga0068870_10049095
540 Ga0068863_100050474
541 Ga0068858_100289587
542 Ga0068860_100191781
543 Ga0068862_100158630
544 Ga0081455_10021532
545 Ga0081455_10085756
546 Ga0081538_10001303
547 Ga0081538_10001587
548 Ga0081538_10001925
549 Ga0081538_10002068
550 Ga0081538_10002987
551 Ga0081538_10004172
552 Ga0081538_10006075
553 Ga0081538_10008090
554 Ga0081538_10008522
555 Ga0081538_10009033
556 Ga0081538_10009679
557 Ga0081538_10036538
558 Ga0081538_10086342
559 Ga0081538_10116185
560 Ga0081538_10132909
561 Ga0081540_1044189
562 Ga0081539_10000037
563 Ga0081539_10002255
564 Ga0081539_10004050
565 Ga0081539_10004311
566 Ga0081539_10004958
567 Ga0081539_10037173
568 Ga0070717_10186276
569 Ga0075432_10012258
570 Ga0075432_10135662
571 Ga0070716_100016034
572 Ga0075427_10003119
573 Ga0097621_100282910
574 Ga0075428_100007475
575 Ga0075428_100338323
576 Ga0075428_100497190
577 Ga0075430_100001574
578 Ga0075430_100010055
579 Ga0075430_100192301
580 Ga0075431_100029881
581 Ga0075431_100038657
582 Ga0075431_100074849
583 Ga0075431_100093367
584 Ga0075431_100602007
585 Ga0075433_10007180
586 Ga0075433_10009759
587 Ga0075433_10036024
588 Ga0075433_10187145
589 Ga0075434_100164502
590 Ga0075429_100004947
591 Ga0075429_100146970
592 Ga0075429_100428280
593 Ga0068865_100058029
594 Ga0097620_100058199
595 Ga0099794_10026345
596 Ga0111539_10012980
597 Ga0111539_10023432
598 Ga0111539_10049476
599 Ga0111539_10052016
600 Ga0111539_10206606
601 Ga0111539_11679947
602 Ga0105245_10004866
603 Ga0105245_10811156
604 Ga0114129_10003721
605 Ga0114129_10036052
606 Ga0114129_10160095
607 Ga0114129_10272091
608 Ga0114129_10388545
609 Ga0114129_10658615
610 Ga0105243_10067861
611 Ga0105243_10158766
612 Ga0105242_10072967
613 Ga0105249_10012552
614 Ga0099796_10007829
615 Ga0105239_10081252
616 Ga0105239_10607646
617 Ga0105246_10397588
618 Ga0157378_10144057
619 Ga0157375_10010060
620 Ga0163163_10541949
621 Ga0157380_10050242
622 Ga0157377_10002969
623 Ga0157379_10891374
624 Ga0213876_10033819
625 Ga0213871_10016844
626 Ga0207692_10100388
627 Ga0207685_10017843
628 Ga0207685_10070901
629 Ga0207643_10003623
630 Ga0207684_10249205
631 Ga0207707_10021886
632 Ga0207693_10048077
633 Ga0207693_10324656
634 Ga0207660_10144019
635 Ga0207662_10000687
636 Ga0207662_10109683
637 Ga0207652_10008589
638 Ga0207646_10025583
639 Ga0207646_10073315
640 Ga0207646_10888333
641 Ga0207694_10094657
642 Ga0207650_10131982
643 Ga0207659_10678768
644 Ga0207700_10154176
645 Ga0207690_10284226
646 Ga0207706_10007027
647 Ga0207686_10005065
648 Ga0207686_10046252
649 Ga0207709_10020831
650 Ga0207670_10041345
651 Ga0207669_10025949
652 Ga0207704_10142296
653 Ga0207665_10012466
654 Ga0207691_10071679
655 Ga0207689_10073975
656 Ga0207661_10081316
657 Ga0207661_10258769
658 Ga0207712_10042694
659 Ga0207668_10224710
660 Ga0207640_10100708
661 Ga0207677_10174895
662 Ga0207703_10832775
663 Ga0207639_10083242
664 Ga0207678_10014403
665 Ga0207708_10001746
666 Ga0207708_10079246
667 Ga0207708_10307909
668 Ga0207641_10059152
669 Ga0207648_10002341
670 Ga0207648_10076945
671 Ga0207648_10983770
672 Ga0207676_10122023
673 Ga0207674_10010663
674 Ga0207675_100148071
675 Ga0207683_10012149
676 Ga0207683_10695567
677 Ga0207698_10697943
678 Ga0207428_10008189
679 Ga0207428_10045924
680 Ga0207428_10230319
681 Ga0268265_10055724
682 Ga0268264_10073472
683 Ga0265323_10097847
684 Ga0268256_1021386
685 Ga0307408_100015877
686 Ga0316579_10008074
687 Ga0316579_10117462
688 Ga0316576_10009589
689 Ga0316576_10169047
690 Ga0316576_10276220
691 Ga0307405_10003723
692 Ga0316577_10000026
693 Ga0316577_10011661
694 Ga0316577_10175693
695 Ga0316577_10305919
696 Ga0307413_10187569
697 Ga0307410_10006777
698 Ga0326468_10006387
699 Ga0307406_10230592
700 Ga0307409_100004570
701 Ga0307409_100035571
702 Ga0307409_100159497
703 Ga0307409_100990462
704 Ga0307416_100004535
705 Ga0307416_100039080
706 Ga0307416_100077100
707 Ga0307416_100321836
708 Ga0307414_10599433
709 Ga0307414_10884767
710 Ga0307415_100000277
711 Ga0307415_100024803
712 Ga0307415_100363807
713 Ga0316585_10005188
714 Ga0316580_10030375
715 Ga0373949_0030635
716 Ga0373939_0112831
717 Ga0373941_0052603
718 Ga0373931_0274969
719 Ga0373937_0148141
720 Ga0316582_0002666
721 Ga0316582_0089686
722 Ga0316582_0230149
723 Ga0316584_0011590
724 Ga0316584_0013121
725 Ga0316584_0016180
726 Ga0316584_0103992
727 Ga0316584_0105983
728 Ga0395899_0464639
729 Ga0395900_0078337
730 Ga0395900_0100972
731 Ga0395900_0110493
732 Ga0395900_0178644
733 Ga0395900_0195602
734 Ga0395898_0012332
735 Ga0395898_0120795
736 Ga0395905_0009849
737 Ga0395905_0338327
738 Ga0395905_0614488
739 Ga0316581_0024664
740 Ga0436364_0832268
741 Ga0436364_1451732
742 Ga0395901_0040099
743 Ga0395901_0159083
744 Ga0395901_0578898
745 Ga0395901_0808221
746 Ga0436365_0417044
747 Ga0436365_0910243
748 Ga0436365_0960932
749 Ga0436365_1651544
750 Ga0436361_0598979
751 Ga0436363_0979902
752 Ga0436363_1044242
753 Ga0436362_0316236
754 Ga0436362_0384331
755 Ga0436362_0526364
756 Ga0439466_0028648
757 Ga0439450_000147
758 Ga0439450_011374
759 Ga0439454_003735
760 Ga0439455_0022079
761 Ga0439455_0068905
762 Ga0439463_061128
763 Ga0450900_010751
764 Ga0439444_0000119
765 Ga0439464_0012512
766 Ga0439460_0001986
767 Ga0439460_0026636
768 Ga0451577_0001549
769 Ga0451577_0029208
770 Ga0439440_0000443
771 Ga0466966_0023029
772 Ga0466963_0039608
773 Ga0453684_0000764
774 Ga0453684_0022771
775 Ga0453684_0471009
776 Ga0466957_0411261
777 Ga0466959_0033082
778 Ga0466958_0585583
779 Ga0466967_0085173
780 Ga0466967_0291281
781 Ga0466967_0404974
782 Ga0495653_0311044
783 Ga0495652_0023029
784 Ga0495640_0360147
785 Ga0495658_0359864
786 Ga0495613_0386939
787 Ga0495581_0324298
788 Ga0496100_0033479
789 Ga0496100_0056448
790 Ga0496100_0158484
791 Ga0496100_0322527
792 Ga0496101_0042223
793 Ga0496101_0366254
794 Ga0496102_0027404
795 Ga0496102_0051288
796 Ga0496104_0065971
797 Ga0496104_0070442
798 Ga0496105_0017427
799 Ga0496106_0003757
800 Ga0496106_0093733
801 Ga0496107_0040461
802 Ga0496108_0000093
803 Ga0496108_0007272
804 Ga0496108_0033755
805 Ga0496108_0064421
806 Ga0496109_0038912
807 Ga0496109_0316946
808 Ga0496109_0722118
809 Ga0496110_0062102
810 Ga0496110_0101503
811 Ga0496110_0284727
812 Ga0496111_0058348
813 Ga0496112_0238236
814 Ga0496114_0063427
815 Ga0496114_0369764
816 Ga0501031_0004336
817 Ga0501031_0176869
818 Ga0501032_0025558
819 Ga0501032_0552549
820 Ga0501033_0003321
821 Ga0501034_0188122
822 Ga0501034_0796139
823 Ga0501036_0000787
824 Ga0501036_0068099
825 Ga0501036_0114184
826 Ga0501037_0024083
827 Ga0501038_0077799
828 Ga0501038_0489752
829 Ga0501039_0009651
830 Ga0501039_0041258
831 Ga0501039_0082038
832 Ga0501040_0001366
833 Ga0501040_0011001
834 Ga0501040_0045322
835 Ga0501040_0109607
836 Ga0501040_0261002
837 Ga0501041_0002497
838 Ga0501041_0019491
839 Ga0501041_0423235
840 Ga0501042_0000288
841 Ga0501042_0060128
842 Ga0501042_0210958
843 Ga0501046_0002896
844 Ga0501046_0175391
845 Ga0501046_0287149
846 Ga0501047_0367565
847 Ga0501048_0002443
848 Ga0501048_0063092
849 Ga0501048_0079821
850 Ga0501048_0735921
851 Ga0501067_0009201
852 Ga0501068_0090226
853 Ga0501068_0291489
854 Ga0501068_0442856
855 Ga0501069_0089739
856 Ga0501071_0005054
857 Ga0501071_0033930
858 Ga0501071_0057174
859 Ga0501071_0292937
860 Ga0501072_0008856
861 Ga0501072_0093652
862 Ga0501072_0094046
863 Ga0501072_0097480
864 Ga0501072_0101980
865 Ga0501072_0203366
866 Ga0501073_0068208
867 Ga0501074_0002753
868 Ga0501074_0091074
869 Ga0501074_0141648
870 Ga0501075_0000437
871 Ga0501075_0000981
872 Ga0501075_0019913
873 Ga0501075_0042948
874 Ga0501076_0007797
875 Ga0501076_0007938
876 Ga0501076_0008382
877 Ga0501076_0240894
878 Ga0501077_0005575
879 Ga0501257_111226
880 Ga0501079_0001201
881 Ga0501080_0108708
882 Ga0501080_0921938
883 Ga0501081_0001540
884 Ga0501081_0029395
885 Ga0501081_0148342
886 Ga0501081_0414958
887 Ga0501035_0089732
888 Ga0501045_0003021
889 Ga0501045_0006379
890 Ga0501045_0220809
891 nmdc:mga0yw44_165458_c1
892 nmdc:mga05p37_1720_c1
893 nmdc:mga05p37_352819_c1
894 nmdc:mga05p37_369113_c1
895 nmdc:mga05p37_370162_c1
896 nmdc:mga05p37_594067_c1
897 nmdc:mga05p37_63997_c1
898 nmdc:mga09592_110071_c1
899 nmdc:mga09592_198621_c1
900 nmdc:mga09592_606397_c1
901 nmdc:mga0qj67_139307_c1
902 nmdc:mga0qj67_3468_c1
903 nmdc:mga06r32_40102_c1
904 nmdc:mga08y16_32954_c1
905 nmdc:mga08y16_36475_c1
906 nmdc:mga08y16_537782_c1
907 nmdc:mga0n895_161033_c1
908 nmdc:mga0n895_216839_c1
909 nmdc:mga0rr50_187583_c1
910 nmdc:mga0a205_15073_c1
911 nmdc:mga0a205_209292_c1
912 nmdc:mga0a205_236912_c1
913 nmdc:mga0a205_42021_c1
914 nmdc:mga0a205_51561_c1
915 Ga0495601_0423679
916 Ga0495619_0301957
917 Ga0500641_0202947
918 Ga0501084_0000414
919 Ga0501084_0065451
920 Ga0501084_0210786
921 Ga0590077_012551
922 Ga0501082_0002123
923 Ga0501082_0104044
924 Ga0501082_0387637
925 Ga0501082_0911065
926 Ga0530510_0000576
927 Ga0530510_0005045
928 Ga0530510_0011757
929 Ga0530510_0020327
930 Ga0530510_0021738
931 Ga0530510_0271917
932 Ga0530510_0421722
933 2515855602
934 2643899348
935 2644406917
936 2676492359
937 2964379030
938 8054163739
939 8056063026
940 8056210795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

178

234

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

177

222

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

177

222

0.95

PF00072

Response_reg

Response regulator receiver domain

31

148

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9875 149 211
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9872 149 211
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.985 153 210
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.984 153 211
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9821 149 211
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9931 153 209 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9929 153 205 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9769 149 209 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9767 148 209 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.975 148 209 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C6XHJ4-F1-model_v4 Response regulator transcription factor 0.9884 2 147 GO:0000160
GO:0003677
AF-C8XHH1-F1-model_v4 Response regulator receiver protein 0.9618 7 133 GO:0000160
GO:0003677
AF-A0A399P1L7-F1-model_v4 DNA-binding response regulator 0.9605 8 133 GO:0000160
GO:0003677
AF-A0A850CCC4-F1-model_v4 Response regulator transcription factor 0.9598 5 138 GO:0000160
GO:0003677
AF-A0A536PVN6-F1-model_v4 Response regulator transcription factor 0.9586 2 138 GO:0000160
GO:0003677

Map