F449959

General Info

Members Datasets Scaffolds Average Seq Length
468 319 936 143

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10130478|Ga0065704_101304782
Length 158
Sequence MKEKYRKAGVLWTGDLMNGNGIVSTESRALFEQPFTYRMRFEDEPGTNPEELIAAAHAACLSMSIASTLAKHGYDPVRTDTTATCILAPRDSGGHEISGIQLHIRAEVPGIDADTFQKMIVEADEGCPVSNLLRSGLEIQIDATLLQDDTFREETTHR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
93 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
191 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
258 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
259 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
260 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
269 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
270 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
271 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
272 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
273 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
274 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
275 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
276 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
279 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
280 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
281 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
282 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
283 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
284 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
285 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
286 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
287 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
292 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
293 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
294 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
295 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
296 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
297 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
298 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
301 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
316 2558860280 Kutzneria sp. 744 Isolate Unclassified
317 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
318 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
319 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 1.28
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.21
Nodule 0
Rhizoplane 4.91
Rhizosphere 92.52
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10130478 3300005289 Bacteria 1635
2 JGI24741J21665_1050270 3300001915 Bacteria 613
3 JGI24737J22298_10099906 3300001990 Bacteria 860
4 JGI24735J21928_10112409 3300002067 Bacteria 783
5 JGI24033J26618_1021698 3300002155 Bacteria 826
6 JGI24751J29686_10007523 3300002459 Bacteria 2226
7 rootH2_10243528 3300003320 Bacteria 1567
8 Ga0065704_10239313 3300005289 Bacteria 1020
9 Ga0065715_10150167 3300005293 Bacteria 1692
10 Ga0065715_10581918 3300005293 Bacteria 719
11 Ga0065707_10004553 3300005295 Bacteria 3422
12 Ga0065707_10086184 3300005295 Bacteria 5606
13 Ga0070658_10307081 3300005327 Bacteria 1353
14 Ga0070658_10660150 3300005327 Bacteria 907
15 Ga0070676_10001182 3300005328 Bacteria 13082
16 Ga0070676_10193045 3300005328 Bacteria 1331
17 Ga0070676_10463994 3300005328 Bacteria 893
18 Ga0070670_100026148 3300005331 Bacteria 5024
19 Ga0070666_10401020 3300005335 Bacteria 986
20 Ga0070680_100350264 3300005336 Bacteria 1256
21 Ga0070682_100019705 3300005337 Bacteria 3961
22 Ga0070682_100419918 3300005337 Bacteria 1016
23 Ga0070660_100028917 3300005339 Bacteria 4150
24 Ga0070689_100035966 3300005340 Bacteria 3786
25 Ga0070687_100161275 3300005343 Bacteria 1326
26 Ga0070661_100144720 3300005344 Bacteria 1793
27 Ga0070661_100677194 3300005344 Bacteria 839
28 Ga0070692_10110830 3300005345 Bacteria 1517
29 Ga0070668_100019328 3300005347 Bacteria 5127
30 Ga0070669_100010924 3300005353 Bacteria 6447
31 Ga0070675_100203792 3300005354 Bacteria 1717
32 Ga0070675_100598422 3300005354 Bacteria 1000
33 Ga0070675_101147436 3300005354 Bacteria 715
34 Ga0070671_100039824 3300005355 Bacteria 3901
35 Ga0070673_100693736 3300005364 Bacteria 934
36 Ga0070688_100029292 3300005365 Bacteria 3296
37 Ga0070659_100072311 3300005366 Bacteria 2744
38 Ga0070709_10025376 3300005434 Bacteria 3501
39 Ga0070714_100241275 3300005435 Bacteria 1668
40 Ga0070714_100482420 3300005435 Bacteria 1180
41 Ga0070714_100496720 3300005435 Bacteria 1163
42 Ga0070714_100884384 3300005435 Bacteria 867
43 Ga0070713_100000247 3300005436 Bacteria 35608
44 Ga0070713_100240208 3300005436 Bacteria 1649
45 Ga0070713_100673641 3300005436 Bacteria 986
46 Ga0070710_10024102 3300005437 Bacteria 3206
47 Ga0070701_10009952 3300005438 Bacteria 4187
48 Ga0070711_100066761 3300005439 Bacteria 2521
49 Ga0070711_100226572 3300005439 Bacteria 1456
50 Ga0070705_100018493 3300005440 Bacteria 3654
51 Ga0070705_100116086 3300005440 Bacteria 1720
52 Ga0070700_100005826 3300005441 Bacteria 6539
53 Ga0070700_100746158 3300005441 Bacteria 783
54 Ga0070700_101427476 3300005441 Bacteria 586
55 Ga0070694_100455047 3300005444 Bacteria 1011
56 Ga0070708_100049073 3300005445 Bacteria 3733
57 Ga0070708_101593829 3300005445 Bacteria 608
58 Ga0070663_100000122 3300005455 Bacteria 36697
59 Ga0070663_100039842 3300005455 Bacteria 3286
60 Ga0070663_100367937 3300005455 Bacteria 1168
61 Ga0070663_100689045 3300005455 Bacteria 867
62 Ga0070678_100039845 3300005456 Bacteria 3319
63 Ga0070662_100393432 3300005457 Bacteria 1143
64 Ga0070681_10119812 3300005458 Bacteria 2567
65 Ga0070685_10019291 3300005466 Bacteria 3677
66 Ga0070706_100011008 3300005467 Bacteria 8400
67 Ga0070706_100871866 3300005467 Unclassified 832
68 Ga0070699_100036307 3300005518 Bacteria 4263
69 Ga0070699_102037959 3300005518 Unclassified 524
70 Ga0070679_100373590 3300005530 Bacteria 1372
71 Ga0070697_100326146 3300005536 Bacteria 1323
72 Ga0068853_100006687 3300005539 Bacteria 9181
73 Ga0070672_100059567 3300005543 Bacteria 3005
74 Ga0070696_100220702 3300005546 Bacteria 1422
75 Ga0070696_100389070 3300005546 Bacteria 1088
76 Ga0070693_100013344 3300005547 Bacteria 4183
77 Ga0070693_100150815 3300005547 Bacteria 1472
78 Ga0068855_100298450 3300005563 Bacteria 1785
79 Ga0070664_102281149 3300005564 Bacteria 513
80 Ga0068857_100148982 3300005577 Bacteria 2119
81 Ga0068856_100040294 3300005614 Bacteria 4587
82 Ga0070702_100000097 3300005615 Bacteria 26016
83 Ga0068852_100004097 3300005616 Bacteria 10262
84 Ga0068852_100084086 3300005616 Bacteria 2831
85 Ga0068852_101838283 3300005616 Bacteria 628
86 Ga0068859_100132858 3300005617 Bacteria 2561
87 Ga0068864_100003332 3300005618 Bacteria 13278
88 Ga0068861_100275056 3300005719 Bacteria 1448
89 Ga0068851_10011548 3300005834 Bacteria 4144
90 Ga0068851_11030334 3300005834 Bacteria 520
91 Ga0068870_10003866 3300005840 Bacteria 6386
92 Ga0068870_10583721 3300005840 Bacteria 757
93 Ga0068863_100002971 3300005841 Bacteria 16768
94 Ga0068858_100019403 3300005842 Bacteria 6358
95 Ga0068860_100167057 3300005843 Bacteria 2124
96 Ga0068862_100451650 3300005844 Bacteria 1212
97 Ga0081540_1174555 3300005983 Bacteria 813
98 Ga0070717_10060614 3300006028 Bacteria 3133
99 Ga0070717_10102846 3300006028 Bacteria 2428
100 Ga0070717_10938484 3300006028 Bacteria 788
101 Ga0070716_100592047 3300006173 Unclassified 833
102 Ga0070712_100276059 3300006175 Bacteria 1352
103 Ga0097621_100160112 3300006237 Bacteria 1934
104 Ga0068871_100018100 3300006358 Bacteria 5348
105 Ga0068871_101093949 3300006358 Bacteria 745
106 Ga0075428_101082512 3300006844 Bacteria 847
107 Ga0075433_10131048 3300006852 Bacteria 2228
108 Ga0075433_10341205 3300006852 Bacteria 1324
109 Ga0075434_100006615 3300006871 Bacteria 10633
110 Ga0075434_100030930 3300006871 Bacteria 5276
111 Ga0075434_101346466 3300006871 Unclassified 724
112 Ga0068865_100463545 3300006881 Bacteria 1050
113 Ga0075436_100007397 3300006914 Bacteria 7512
114 Ga0075436_100704864 3300006914 Bacteria 748
115 Ga0097620_100132855 3300006931 Bacteria 2561
116 Ga0075435_100000697 3300007076 Bacteria 20816
117 Ga0075435_100381717 3300007076 Unclassified 1210
118 Ga0105251_10013980 3300009011 Bacteria 4460
119 Ga0111539_10027166 3300009094 Bacteria 6989
120 Ga0111539_10151107 3300009094 Bacteria 2718
121 Ga0105245_10015595 3300009098 Bacteria 6627
122 Ga0105247_10010469 3300009101 Bacteria 5607
123 Ga0114129_10116896 3300009147 Bacteria 3675
124 Ga0114129_10875768 3300009147 Bacteria 1140
125 Ga0114129_11464273 3300009147 Bacteria 840
126 Ga0105243_10050654 3300009148 Bacteria 3282
127 Ga0105241_10379892 3300009174 Bacteria 1234
128 Ga0105248_10011387 3300009177 Bacteria 9803
129 Ga0105248_10477634 3300009177 Bacteria 1405
130 Ga0105237_10068517 3300009545 Bacteria 3542
131 Ga0105237_11875646 3300009545 Bacteria 607
132 Ga0105238_10031294 3300009551 Bacteria 5416
133 Ga0105238_10541339 3300009551 Bacteria 1168
134 Ga0105249_10465065 3300009553 Bacteria 1305
135 Ga0105249_13041439 3300009553 Unclassified 539
136 Ga0105239_10913339 3300010375 Bacteria 1008
137 Ga0105246_10001274 3300011119 Bacteria 14802
138 Ga0157338_1063765 3300012515 Bacteria 559
139 Ga0154010_187916 3300013062 Bacteria 593
140 Ga0157373_10063438 3300013100 Bacteria 2616
141 Ga0157371_10524521 3300013102 Bacteria 876
142 Ga0157370_10113767 3300013104 Bacteria 2528
143 Ga0157369_10613849 3300013105 Bacteria 1122
144 Ga0157374_10105511 3300013296 Bacteria 2706
145 Ga0163162_11091459 3300013306 Bacteria 904
146 Ga0157375_10026182 3300013308 Bacteria 5432
147 Ga0163163_10921987 3300014325 Bacteria 937
148 Ga0157380_10289040 3300014326 Bacteria 1504
149 Ga0182008_10043752 3300014497 Bacteria 2229
150 Ga0182008_10558318 3300014497 Bacteria 637
151 Ga0157377_10012700 3300014745 Bacteria 4242
152 Ga0157379_10024728 3300014968 Bacteria 5331
153 Ga0157379_11040330 3300014968 Unclassified 782
154 Ga0157376_10124755 3300014969 Bacteria 2288
155 Ga0197907_10853160 3300020069 Bacteria 1592
156 Ga0206356_10002194 3300020070 Bacteria 4968
157 Ga0206349_1504317 3300020075 Bacteria 674
158 Ga0206350_10539589 3300020080 Bacteria 1130
159 Ga0206354_10072495 3300020081 Bacteria 1300
160 Ga0213875_10216223 3300021388 Bacteria 903
161 Ga0207656_10005160 3300025321 Bacteria 4593
162 Ga0207642_10869785 3300025899 Bacteria 576
163 Ga0207688_10017879 3300025901 Bacteria 3859
164 Ga0207688_10041441 3300025901 Bacteria 2561
165 Ga0207647_10055979 3300025904 Bacteria 2421
166 Ga0207699_10047398 3300025906 Bacteria 2520
167 Ga0207699_10063614 3300025906 Bacteria 2229
168 Ga0207699_10686332 3300025906 Bacteria 749
169 Ga0207645_10206899 3300025907 Bacteria 1292
170 Ga0207643_10000022 3300025908 Bacteria 105173
171 Ga0207643_10636977 3300025908 Bacteria 687
172 Ga0207705_10005960 3300025909 Bacteria 9067
173 Ga0207684_10044752 3300025910 Bacteria 3754
174 Ga0207671_10108085 3300025914 Bacteria 2114
175 Ga0207693_10010433 3300025915 Bacteria 7538
176 Ga0207660_10053924 3300025917 Bacteria 2868
177 Ga0207660_10622881 3300025917 Bacteria 879
178 Ga0207662_10197744 3300025918 Bacteria 1300
179 Ga0207657_10024714 3300025919 Bacteria 5555
180 Ga0207649_10000514 3300025920 Bacteria 27231
181 Ga0207649_10422792 3300025920 Bacteria 1001
182 Ga0207652_10003705 3300025921 Bacteria 12546
183 Ga0207646_10252860 3300025922 Bacteria 1592
184 Ga0207681_10642950 3300025923 Bacteria 879
185 Ga0207650_10000864 3300025925 Bacteria 22978
186 Ga0207659_10016685 3300025926 Bacteria 4785
187 Ga0207687_10001710 3300025927 Bacteria 15137
188 Ga0207700_10005851 3300025928 Bacteria 7389
189 Ga0207700_10227167 3300025928 Bacteria 1585
190 Ga0207664_10097205 3300025929 Bacteria 2425
191 Ga0207664_10542782 3300025929 Bacteria 1043
192 Ga0207664_11543806 3300025929 Bacteria 586
193 Ga0207644_10004049 3300025931 Bacteria 9508
194 Ga0207644_11868758 3300025931 Bacteria 502
195 Ga0207690_10026337 3300025932 Bacteria 3660
196 Ga0207690_10057943 3300025932 Bacteria 2618
197 Ga0207706_10076065 3300025933 Bacteria 2953
198 Ga0207665_10041858 3300025939 Bacteria 3061
199 Ga0207691_10029400 3300025940 Bacteria 5140
200 Ga0207711_10718764 3300025941 Bacteria 931
201 Ga0207689_10000407 3300025942 Bacteria 40379
202 Ga0207661_10014509 3300025944 Bacteria 5777
203 Ga0207661_10377476 3300025944 Bacteria 1283
204 Ga0207661_10693509 3300025944 Bacteria 936
205 Ga0207679_10002794 3300025945 Bacteria 10813
206 Ga0207679_10140840 3300025945 Bacteria 1949
207 Ga0207679_10502968 3300025945 Bacteria 1082
208 Ga0207679_11461930 3300025945 Bacteria 627
209 Ga0207667_10276833 3300025949 Bacteria 1715
210 Ga0207712_10712230 3300025961 Bacteria 877
211 Ga0207668_10360110 3300025972 Bacteria 1219
212 Ga0207668_10369927 3300025972 Bacteria 1203
213 Ga0207640_10149888 3300025981 Bacteria 1712
214 Ga0207677_10025964 3300026023 Bacteria 3664
215 Ga0207677_10319764 3300026023 Bacteria 1289
216 Ga0207703_10043485 3300026035 Bacteria 3605
217 Ga0207639_10224840 3300026041 Bacteria 1623
218 Ga0207639_10458721 3300026041 Bacteria 1158
219 Ga0207678_10000248 3300026067 Bacteria 48560
220 Ga0207678_10000352 3300026067 Bacteria 41756
221 Ga0207678_10386112 3300026067 Bacteria 1211
222 Ga0207708_10001903 3300026075 Bacteria 15420
223 Ga0207708_10278435 3300026075 Bacteria 1355
224 Ga0207708_11533225 3300026075 Bacteria 586
225 Ga0207702_10000819 3300026078 Bacteria 32866
226 Ga0207702_10007587 3300026078 Bacteria 9236
227 Ga0207641_10004334 3300026088 Bacteria 12319
228 Ga0207641_10270879 3300026088 Bacteria 1593
229 Ga0207641_11788083 3300026088 Bacteria 616
230 Ga0207676_10000606 3300026095 Bacteria 29437
231 Ga0207674_10019849 3300026116 Bacteria 7273
232 Ga0207674_10115238 3300026116 Bacteria 2659
233 Ga0207674_10975192 3300026116 Bacteria 817
234 Ga0207683_10003127 3300026121 Bacteria 14461
235 Ga0207698_10170156 3300026142 Bacteria 1917
236 Ga0209974_10027853 3300027876 Bacteria 1870
237 Ga0207428_10078860 3300027907 Bacteria 2576
238 Ga0207428_10317525 3300027907 Bacteria 1151
239 Ga0268266_10069456 3300028379 Bacteria 3052
240 Ga0268265_10323055 3300028380 Bacteria 1399
241 Ga0268265_11540317 3300028380 Bacteria 669
242 Ga0268264_10241877 3300028381 Bacteria 1672
243 Ga0307515_10143714 3300028794 Bacteria 2541
244 Ga0307511_10014427 3300030521 Bacteria 7695
245 Ga0307408_100020616 3300031548 Unclassified 4452
246 Ga0307408_100552390 3300031548 Unclassified 1016
247 Ga0307408_100857751 3300031548 Unclassified 828
248 Ga0307405_10074572 3300031731 Unclassified 2194
249 Ga0307413_10006141 3300031824 Bacteria 5453
250 Ga0307413_10238729 3300031824 Unclassified 1340
251 Ga0307413_10267214 3300031824 Bacteria 1278
252 Ga0307410_10002142 3300031852 Bacteria 9376
253 Ga0307410_10028067 3300031852 Bacteria 3565
254 Ga0307410_10428510 3300031852 Unclassified 1074
255 Ga0307410_10896800 3300031852 Bacteria 759
256 Ga0307406_10017174 3300031901 Bacteria 4213
257 Ga0307406_10114276 3300031901 Unclassified 1864
258 Ga0307406_11502197 3300031901 Bacteria 593
259 Ga0307407_10025714 3300031903 Bacteria 3107
260 Ga0307407_10035403 3300031903 Bacteria 2743
261 Ga0307412_10115343 3300031911 Unclassified 1925
262 Ga0307409_100021573 3300031995 Bacteria 4419
263 Ga0307409_100144212 3300031995 Bacteria 2056
264 Ga0307409_100283171 3300031995 Bacteria 1533
265 Ga0307409_101108054 3300031995 Unclassified 813
266 Ga0307416_100008227 3300032002 Bacteria 6710
267 Ga0307416_100013593 3300032002 Bacteria 5540
268 Ga0307416_100022243 3300032002 Bacteria 4572
269 Ga0307416_100616750 3300032002 Bacteria 1166
270 Ga0307416_102026719 3300032002 Bacteria 678
271 Ga0307414_10181247 3300032004 Unclassified 1694
272 Ga0307414_10394443 3300032004 Bacteria 1200
273 Ga0307414_10664945 3300032004 Unclassified 940
274 Ga0307411_10000639 3300032005 Bacteria 12710
275 Ga0307411_10119693 3300032005 Bacteria 1902
276 Ga0307415_100027789 3300032126 Bacteria 3589
277 Ga0307415_100100140 3300032126 Unclassified 2123
278 Ga0307415_100197715 3300032126 Unclassified 1592
279 Ga0307415_100411004 3300032126 Bacteria 1158
280 Ga0307415_101101351 3300032126 Unclassified 743
281 Ga0307507_10010928 3300033179 Bacteria 11571
282 Ga0307510_10108828 3300033180 Bacteria 2523
283 Ga0373959_0023039 3300034820 Bacteria 1208
284 Ga0373929_0007118 3300035085 Bacteria 2037
285 Ga0373961_0041543 3300035241 Bacteria 1329
286 Ga0373962_0047826 3300035242 Bacteria 1225
287 Ga0373931_0894741 3300035691 Bacteria 596
288 Ga0373931_1028778 3300035691 Unclassified 558
289 Ga0373925_0089249 3300037068 Bacteria 2355
290 Ga0395900_0232432 3300037418 Bacteria 1854
291 Ga0395905_0087397 3300037471 Bacteria 2923
292 Ga0436364_1036504 3300037853 Bacteria 975
293 Ga0242419_007129 3300038698 Bacteria 821
294 Ga0242420_003779 3300038996 Bacteria 2254
295 Ga0242420_013168 3300038996 Bacteria 1407
296 Ga0439461_0067912 3300041410 Bacteria 821
297 Ga0439445_0260732 3300042004 Bacteria 518
298 Ga0439448_0009421 3300042005 Bacteria 2879
299 Ga0439450_043084 3300042008 Bacteria 1054
300 Ga0439455_0082329 3300042012 Bacteria 876
301 Ga0439462_0107113 3300042015 Bacteria 773
302 Ga0439463_003053 3300042016 Bacteria 4252
303 Ga0451577_0127648 3300042876 Unclassified 2280
304 Ga0466969_0003104 3300044656 Bacteria 8852
305 Ga0466972_0070799 3300044658 Bacteria 1664
306 Ga0453683_0013102 3300044673 Bacteria 5423
307 Ga0453683_0097651 3300044673 Unclassified 1844
308 Ga0453683_0601370 3300044673 Bacteria 717
309 Ga0466965_0069232 3300044683 Bacteria 1773
310 Ga0466966_0014624 3300044684 Bacteria 5195
311 Ga0466966_0059725 3300044684 Bacteria 2408
312 Ga0466966_0104575 3300044684 Bacteria 1748
313 Ga0466961_0001974 3300044693 Bacteria 12762
314 Ga0466961_0073390 3300044693 Bacteria 2170
315 Ga0466961_0432891 3300044693 Bacteria 797
316 Ga0466963_0143056 3300044694 Bacteria 1658
317 Ga0466963_0355676 3300044694 Bacteria 1031
318 Ga0466963_0372020 3300044694 Bacteria 1007
319 Ga0453684_0073614 3300044712 Bacteria 4305
320 Ga0453684_0337294 3300044712 Bacteria 1703
321 Ga0453684_0972285 3300044712 Bacteria 905
322 Ga0453684_2312480 3300044712 Bacteria 534
323 Ga0466971_0164357 3300044719 Bacteria 1040
324 Ga0466971_0461909 3300044719 Bacteria 623
325 Ga0466970_0593587 3300044765 Bacteria 642
326 Ga0466970_0908046 3300044765 Bacteria 518
327 Ga0466960_0218645 3300044901 Unclassified 1047
328 Ga0466959_0000659 3300045049 Bacteria 20113
329 Ga0451576_0002211 3300045051 Bacteria 29937
330 Ga0451576_0020716 3300045051 Bacteria 7157
331 Ga0451576_1870738 3300045051 Unclassified 620
332 Ga0466967_0018321 3300045976 Bacteria 5592
333 Ga0466967_0021074 3300045976 Bacteria 5282
334 Ga0466967_0192229 3300045976 Bacteria 1929
335 Ga0466967_0684454 3300045976 Bacteria 1015
336 Ga0495592_0128242 3300046454 Bacteria 1777
337 Ga0495603_0179171 3300046455 Bacteria 1226
338 Ga0495641_0034535 3300046461 Bacteria 2390
339 Ga0495580_0127178 3300046472 Bacteria 1769
340 Ga0495582_0035593 3300046473 Bacteria 2738
341 Ga0495662_0020854 3300046476 Bacteria 3170
342 Ga0495664_0017891 3300046477 Bacteria 4053
343 Ga0495594_0020180 3300046499 Bacteria 3549
344 Ga0495608_0305216 3300046511 Bacteria 985
345 Ga0495608_0501826 3300046511 Bacteria 735
346 Ga0495618_0021195 3300046514 Bacteria 4006
347 Ga0495630_0005847 3300046517 Bacteria 8692
348 Ga0495644_0024283 3300046523 Bacteria 2306
349 Ga0495644_0063415 3300046523 Bacteria 1389
350 Ga0495666_0009043 3300046526 Bacteria 4984
351 Ga0495652_0221991 3300046529 Bacteria 1420
352 Ga0495652_0275758 3300046529 Bacteria 1234
353 Ga0495652_0397947 3300046529 Bacteria 976
354 Ga0495640_0013025 3300046533 Bacteria 6335
355 Ga0495586_0016543 3300046535 Bacteria 3923
356 Ga0495667_0116346 3300046559 Bacteria 1727
357 Ga0495656_0131807 3300046615 Bacteria 1190
358 Ga0495634_0028047 3300046642 Bacteria 3911
359 Ga0495635_0271609 3300046663 Bacteria 1140
360 Ga0495647_0073688 3300046681 Bacteria 1372
361 Ga0495658_0005850 3300046683 Bacteria 6037
362 Ga0495613_0004425 3300046689 Bacteria 10522
363 Ga0495636_0207242 3300047318 Bacteria 897
364 Ga0495674_0014615 3300047319 Bacteria 7347
365 Ga0495676_0132052 3300047321 Bacteria 1801
366 Ga0495680_0034285 3300047322 Bacteria 4101
367 Ga0495684_0084880 3300047471 Bacteria 2401
368 Ga0495602_0607250 3300048088 Bacteria 752
369 Ga0496101_0031610 3300048904 Bacteria 3723
370 Ga0496101_1464464 3300048904 Bacteria 532
371 Ga0496102_0002740 3300048905 Bacteria 15017
372 Ga0496102_0350525 3300048905 Unclassified 1390
373 Ga0496103_0156463 3300048906 Bacteria 1461
374 Ga0496103_0352550 3300048906 Bacteria 946
375 Ga0496104_0001561 3300048907 Bacteria 19721
376 Ga0496104_0835002 3300048907 Bacteria 827
377 Ga0496105_0088735 3300048908 Bacteria 2555
378 Ga0496106_0007169 3300048909 Bacteria 8235
379 Ga0496106_0116433 3300048909 Bacteria 2085
380 Ga0496106_1261316 3300048909 Bacteria 575
381 Ga0496107_0100609 3300048910 Bacteria 2119
382 Ga0496108_0034395 3300048911 Bacteria 4210
383 Ga0496109_0041018 3300048912 Bacteria 4193
384 Ga0496110_0077413 3300048913 Bacteria 2959
385 Ga0496110_0202745 3300048913 Bacteria 1802
386 Ga0496110_0664806 3300048913 Bacteria 942
387 Ga0496111_0008349 3300048914 Bacteria 6846
388 Ga0496112_0031895 3300048915 Bacteria 5113
389 Ga0496112_1395399 3300048915 Unclassified 615
390 Ga0496113_0035102 3300048916 Bacteria 3664
391 Ga0496114_0207218 3300048917 Bacteria 1719
392 Ga0501295_098279 3300049518 Unclassified 684
393 Ga0501296_006786 3300049519 Bacteria 1305
394 Ga0501298_003067 3300049521 Unclassified 2576
395 Ga0501303_043427 3300049526 Unclassified 570
396 Ga0501033_0619656 3300049570 Bacteria 741
397 Ga0501039_0274940 3300049575 Bacteria 1324
398 Ga0501039_0666487 3300049575 Bacteria 814
399 Ga0501040_0029435 3300049576 Bacteria 3707
400 Ga0501046_0849630 3300049580 Unclassified 638
401 Ga0501067_0090591 3300049583 Bacteria 1698
402 Ga0501072_0179471 3300049588 Bacteria 1689
403 Ga0501075_0218086 3300049591 Bacteria 1455
404 Ga0501209_092785 3300049656 Bacteria 879
405 Ga0501211_009418 3300049658 Bacteria 957
406 Ga0501214_035661 3300049659 Bacteria 702
407 Ga0501214_105795 3300049659 Unclassified 500
408 Ga0501216_012746 3300049660 Bacteria 1384
409 Ga0501217_019328 3300049661 Bacteria 1590
410 Ga0501217_062626 3300049661 Unclassified 997
411 Ga0501217_212335 3300049661 Unclassified 608
412 Ga0501223_131078 3300049663 Unclassified 535
413 Ga0501228_052789 3300049666 Unclassified 558
414 Ga0501230_042173 3300049667 Bacteria 887
415 Ga0501233_048879 3300049668 Bacteria 1019
416 Ga0501235_111457 3300049669 Unclassified 677
417 Ga0501236_026750 3300049670 Bacteria 890
418 Ga0501236_061392 3300049670 Bacteria 668
419 Ga0501239_008268 3300049672 Bacteria 1108
420 Ga0501239_022020 3300049672 Unclassified 788
421 Ga0501242_028556 3300049674 Unclassified 745
422 Ga0501247_001677 3300049677 Unclassified 2197
423 Ga0501249_015806 3300049679 Bacteria 1616
424 Ga0501250_021692 3300049680 Unclassified 836
425 Ga0501253_134882 3300049683 Unclassified 610
426 Ga0501221_051863 3300049704 Unclassified 926
427 Ga0501229_010742 3300049706 Bacteria 1158
428 Ga0501234_069478 3300049707 Unclassified 607
429 Ga0501079_0096198 3300049741 Bacteria 2295
430 Ga0501079_0462494 3300049741 Bacteria 996
431 Ga0501080_0920023 3300049742 Bacteria 761
432 Ga0501081_0318094 3300049743 Bacteria 1143
433 Ga0501264_025066 3300049761 Unclassified 656
434 Ga0501266_033245 3300049763 Unclassified 743
435 Ga0501268_000721 3300049765 Unclassified 3767
436 Ga0501268_002016 3300049765 Bacteria 2618
437 Ga0501270_020108 3300049767 Unclassified 1008
438 Ga0501270_137056 3300049767 Unclassified 547
439 Ga0501271_030138 3300049768 Unclassified 667
440 Ga0501272_003465 3300049769 Bacteria 1606
441 Ga0501278_041674 3300049774 Unclassified 502
442 Ga0501035_0356135 3300049822 Bacteria 1224
443 Ga0501045_0133641 3300049824 Bacteria 1844
444 Ga0501045_0311653 3300049824 Bacteria 1171
445 Ga0501045_0354704 3300049824 Bacteria 1092
446 Ga0501204_110763 3300049850 Unclassified 501
447 Ga0501212_085310 3300049851 Unclassified 576
448 nmdc:mga05p37_1347138_c1 3300050507 Bacteria 723
449 nmdc:mga05p37_2036528_c1 3300050507 Bacteria 541
450 nmdc:mga08y16_36935_c1 3300050511 Bacteria 5131
451 nmdc:mga0n895_55877_c1 3300050512 Bacteria 3887
452 nmdc:mga0rr50_378_c1 3300050513 Bacteria 24389
453 nmdc:mga0rr50_59336_c1 3300050513 Unclassified 2872
454 nmdc:mga08x19_4838_c1 3300050514 Bacteria 7967
455 nmdc:mga0a205_14245_c1 3300050515 Bacteria 7415
456 Ga0495595_0704180 3300053084 Bacteria 518
457 Ga0495619_0786857 3300053085 Bacteria 644
458 Ga0500634_0363940 3300053161 Bacteria 547
459 Ga0501084_0162881 3300054114 Bacteria 1882
460 Ga0590071_116962 3300059421 Bacteria 679
461 Ga0501082_0112592 3300060353 Bacteria 2356
462 Ga0501082_0860080 3300060353 Bacteria 793
463 Ga0466962_0291411 3300061719 Bacteria 806
464 Ga0530510_0549368 3300061734 Unclassified 877
465 2559424720 2558860280 Bacteria 11429938
466 2899361971 2899359706 Bacteria 10940472
467 2917744719 2917736166 Bacteria 9690793
468 8003323763 8003314358 Bacteria 10575343
469 Ga0065704_10130478
470 JGI24741J21665_1050270
471 JGI24737J22298_10099906
472 JGI24735J21928_10112409
473 JGI24033J26618_1021698
474 JGI24751J29686_10007523
475 rootH2_10243528
476 Ga0065704_10239313
477 Ga0065715_10150167
478 Ga0065715_10581918
479 Ga0065707_10004553
480 Ga0065707_10086184
481 Ga0070658_10307081
482 Ga0070658_10660150
483 Ga0070676_10001182
484 Ga0070676_10193045
485 Ga0070676_10463994
486 Ga0070670_100026148
487 Ga0070666_10401020
488 Ga0070680_100350264
489 Ga0070682_100019705
490 Ga0070682_100419918
491 Ga0070660_100028917
492 Ga0070689_100035966
493 Ga0070687_100161275
494 Ga0070661_100144720
495 Ga0070661_100677194
496 Ga0070692_10110830
497 Ga0070668_100019328
498 Ga0070669_100010924
499 Ga0070675_100203792
500 Ga0070675_100598422
501 Ga0070675_101147436
502 Ga0070671_100039824
503 Ga0070673_100693736
504 Ga0070688_100029292
505 Ga0070659_100072311
506 Ga0070709_10025376
507 Ga0070714_100241275
508 Ga0070714_100482420
509 Ga0070714_100496720
510 Ga0070714_100884384
511 Ga0070713_100000247
512 Ga0070713_100240208
513 Ga0070713_100673641
514 Ga0070710_10024102
515 Ga0070701_10009952
516 Ga0070711_100066761
517 Ga0070711_100226572
518 Ga0070705_100018493
519 Ga0070705_100116086
520 Ga0070700_100005826
521 Ga0070700_100746158
522 Ga0070700_101427476
523 Ga0070694_100455047
524 Ga0070708_100049073
525 Ga0070708_101593829
526 Ga0070663_100000122
527 Ga0070663_100039842
528 Ga0070663_100367937
529 Ga0070663_100689045
530 Ga0070678_100039845
531 Ga0070662_100393432
532 Ga0070681_10119812
533 Ga0070685_10019291
534 Ga0070706_100011008
535 Ga0070706_100871866
536 Ga0070699_100036307
537 Ga0070699_102037959
538 Ga0070679_100373590
539 Ga0070697_100326146
540 Ga0068853_100006687
541 Ga0070672_100059567
542 Ga0070696_100220702
543 Ga0070696_100389070
544 Ga0070693_100013344
545 Ga0070693_100150815
546 Ga0068855_100298450
547 Ga0070664_102281149
548 Ga0068857_100148982
549 Ga0068856_100040294
550 Ga0070702_100000097
551 Ga0068852_100004097
552 Ga0068852_100084086
553 Ga0068852_101838283
554 Ga0068859_100132858
555 Ga0068864_100003332
556 Ga0068861_100275056
557 Ga0068851_10011548
558 Ga0068851_11030334
559 Ga0068870_10003866
560 Ga0068870_10583721
561 Ga0068863_100002971
562 Ga0068858_100019403
563 Ga0068860_100167057
564 Ga0068862_100451650
565 Ga0081540_1174555
566 Ga0070717_10060614
567 Ga0070717_10102846
568 Ga0070717_10938484
569 Ga0070716_100592047
570 Ga0070712_100276059
571 Ga0097621_100160112
572 Ga0068871_100018100
573 Ga0068871_101093949
574 Ga0075428_101082512
575 Ga0075433_10131048
576 Ga0075433_10341205
577 Ga0075434_100006615
578 Ga0075434_100030930
579 Ga0075434_101346466
580 Ga0068865_100463545
581 Ga0075436_100007397
582 Ga0075436_100704864
583 Ga0097620_100132855
584 Ga0075435_100000697
585 Ga0075435_100381717
586 Ga0105251_10013980
587 Ga0111539_10027166
588 Ga0111539_10151107
589 Ga0105245_10015595
590 Ga0105247_10010469
591 Ga0114129_10116896
592 Ga0114129_10875768
593 Ga0114129_11464273
594 Ga0105243_10050654
595 Ga0105241_10379892
596 Ga0105248_10011387
597 Ga0105248_10477634
598 Ga0105237_10068517
599 Ga0105237_11875646
600 Ga0105238_10031294
601 Ga0105238_10541339
602 Ga0105249_10465065
603 Ga0105249_13041439
604 Ga0105239_10913339
605 Ga0105246_10001274
606 Ga0157338_1063765
607 Ga0154010_187916
608 Ga0157373_10063438
609 Ga0157371_10524521
610 Ga0157370_10113767
611 Ga0157369_10613849
612 Ga0157374_10105511
613 Ga0163162_11091459
614 Ga0157375_10026182
615 Ga0163163_10921987
616 Ga0157380_10289040
617 Ga0182008_10043752
618 Ga0182008_10558318
619 Ga0157377_10012700
620 Ga0157379_10024728
621 Ga0157379_11040330
622 Ga0157376_10124755
623 Ga0197907_10853160
624 Ga0206356_10002194
625 Ga0206349_1504317
626 Ga0206350_10539589
627 Ga0206354_10072495
628 Ga0213875_10216223
629 Ga0207656_10005160
630 Ga0207642_10869785
631 Ga0207688_10017879
632 Ga0207688_10041441
633 Ga0207647_10055979
634 Ga0207699_10047398
635 Ga0207699_10063614
636 Ga0207699_10686332
637 Ga0207645_10206899
638 Ga0207643_10000022
639 Ga0207643_10636977
640 Ga0207705_10005960
641 Ga0207684_10044752
642 Ga0207671_10108085
643 Ga0207693_10010433
644 Ga0207660_10053924
645 Ga0207660_10622881
646 Ga0207662_10197744
647 Ga0207657_10024714
648 Ga0207649_10000514
649 Ga0207649_10422792
650 Ga0207652_10003705
651 Ga0207646_10252860
652 Ga0207681_10642950
653 Ga0207650_10000864
654 Ga0207659_10016685
655 Ga0207687_10001710
656 Ga0207700_10005851
657 Ga0207700_10227167
658 Ga0207664_10097205
659 Ga0207664_10542782
660 Ga0207664_11543806
661 Ga0207644_10004049
662 Ga0207644_11868758
663 Ga0207690_10026337
664 Ga0207690_10057943
665 Ga0207706_10076065
666 Ga0207665_10041858
667 Ga0207691_10029400
668 Ga0207711_10718764
669 Ga0207689_10000407
670 Ga0207661_10014509
671 Ga0207661_10377476
672 Ga0207661_10693509
673 Ga0207679_10002794
674 Ga0207679_10140840
675 Ga0207679_10502968
676 Ga0207679_11461930
677 Ga0207667_10276833
678 Ga0207712_10712230
679 Ga0207668_10360110
680 Ga0207668_10369927
681 Ga0207640_10149888
682 Ga0207677_10025964
683 Ga0207677_10319764
684 Ga0207703_10043485
685 Ga0207639_10224840
686 Ga0207639_10458721
687 Ga0207678_10000248
688 Ga0207678_10000352
689 Ga0207678_10386112
690 Ga0207708_10001903
691 Ga0207708_10278435
692 Ga0207708_11533225
693 Ga0207702_10000819
694 Ga0207702_10007587
695 Ga0207641_10004334
696 Ga0207641_10270879
697 Ga0207641_11788083
698 Ga0207676_10000606
699 Ga0207674_10019849
700 Ga0207674_10115238
701 Ga0207674_10975192
702 Ga0207683_10003127
703 Ga0207698_10170156
704 Ga0209974_10027853
705 Ga0207428_10078860
706 Ga0207428_10317525
707 Ga0268266_10069456
708 Ga0268265_10323055
709 Ga0268265_11540317
710 Ga0268264_10241877
711 Ga0307515_10143714
712 Ga0307511_10014427
713 Ga0307408_100020616
714 Ga0307408_100552390
715 Ga0307408_100857751
716 Ga0307405_10074572
717 Ga0307413_10006141
718 Ga0307413_10238729
719 Ga0307413_10267214
720 Ga0307410_10002142
721 Ga0307410_10028067
722 Ga0307410_10428510
723 Ga0307410_10896800
724 Ga0307406_10017174
725 Ga0307406_10114276
726 Ga0307406_11502197
727 Ga0307407_10025714
728 Ga0307407_10035403
729 Ga0307412_10115343
730 Ga0307409_100021573
731 Ga0307409_100144212
732 Ga0307409_100283171
733 Ga0307409_101108054
734 Ga0307416_100008227
735 Ga0307416_100013593
736 Ga0307416_100022243
737 Ga0307416_100616750
738 Ga0307416_102026719
739 Ga0307414_10181247
740 Ga0307414_10394443
741 Ga0307414_10664945
742 Ga0307411_10000639
743 Ga0307411_10119693
744 Ga0307415_100027789
745 Ga0307415_100100140
746 Ga0307415_100197715
747 Ga0307415_100411004
748 Ga0307415_101101351
749 Ga0307507_10010928
750 Ga0307510_10108828
751 Ga0373959_0023039
752 Ga0373929_0007118
753 Ga0373961_0041543
754 Ga0373962_0047826
755 Ga0373931_0894741
756 Ga0373931_1028778
757 Ga0373925_0089249
758 Ga0395900_0232432
759 Ga0395905_0087397
760 Ga0436364_1036504
761 Ga0242419_007129
762 Ga0242420_003779
763 Ga0242420_013168
764 Ga0439461_0067912
765 Ga0439445_0260732
766 Ga0439448_0009421
767 Ga0439450_043084
768 Ga0439455_0082329
769 Ga0439462_0107113
770 Ga0439463_003053
771 Ga0451577_0127648
772 Ga0466969_0003104
773 Ga0466972_0070799
774 Ga0453683_0013102
775 Ga0453683_0097651
776 Ga0453683_0601370
777 Ga0466965_0069232
778 Ga0466966_0014624
779 Ga0466966_0059725
780 Ga0466966_0104575
781 Ga0466961_0001974
782 Ga0466961_0073390
783 Ga0466961_0432891
784 Ga0466963_0143056
785 Ga0466963_0355676
786 Ga0466963_0372020
787 Ga0453684_0073614
788 Ga0453684_0337294
789 Ga0453684_0972285
790 Ga0453684_2312480
791 Ga0466971_0164357
792 Ga0466971_0461909
793 Ga0466970_0593587
794 Ga0466970_0908046
795 Ga0466960_0218645
796 Ga0466959_0000659
797 Ga0451576_0002211
798 Ga0451576_0020716
799 Ga0451576_1870738
800 Ga0466967_0018321
801 Ga0466967_0021074
802 Ga0466967_0192229
803 Ga0466967_0684454
804 Ga0495592_0128242
805 Ga0495603_0179171
806 Ga0495641_0034535
807 Ga0495580_0127178
808 Ga0495582_0035593
809 Ga0495662_0020854
810 Ga0495664_0017891
811 Ga0495594_0020180
812 Ga0495608_0305216
813 Ga0495608_0501826
814 Ga0495618_0021195
815 Ga0495630_0005847
816 Ga0495644_0024283
817 Ga0495644_0063415
818 Ga0495666_0009043
819 Ga0495652_0221991
820 Ga0495652_0275758
821 Ga0495652_0397947
822 Ga0495640_0013025
823 Ga0495586_0016543
824 Ga0495667_0116346
825 Ga0495656_0131807
826 Ga0495634_0028047
827 Ga0495635_0271609
828 Ga0495647_0073688
829 Ga0495658_0005850
830 Ga0495613_0004425
831 Ga0495636_0207242
832 Ga0495674_0014615
833 Ga0495676_0132052
834 Ga0495680_0034285
835 Ga0495684_0084880
836 Ga0495602_0607250
837 Ga0496101_0031610
838 Ga0496101_1464464
839 Ga0496102_0002740
840 Ga0496102_0350525
841 Ga0496103_0156463
842 Ga0496103_0352550
843 Ga0496104_0001561
844 Ga0496104_0835002
845 Ga0496105_0088735
846 Ga0496106_0007169
847 Ga0496106_0116433
848 Ga0496106_1261316
849 Ga0496107_0100609
850 Ga0496108_0034395
851 Ga0496109_0041018
852 Ga0496110_0077413
853 Ga0496110_0202745
854 Ga0496110_0664806
855 Ga0496111_0008349
856 Ga0496112_0031895
857 Ga0496112_1395399
858 Ga0496113_0035102
859 Ga0496114_0207218
860 Ga0501295_098279
861 Ga0501296_006786
862 Ga0501298_003067
863 Ga0501303_043427
864 Ga0501033_0619656
865 Ga0501039_0274940
866 Ga0501039_0666487
867 Ga0501040_0029435
868 Ga0501046_0849630
869 Ga0501067_0090591
870 Ga0501072_0179471
871 Ga0501075_0218086
872 Ga0501209_092785
873 Ga0501211_009418
874 Ga0501214_035661
875 Ga0501214_105795
876 Ga0501216_012746
877 Ga0501217_019328
878 Ga0501217_062626
879 Ga0501217_212335
880 Ga0501223_131078
881 Ga0501228_052789
882 Ga0501230_042173
883 Ga0501233_048879
884 Ga0501235_111457
885 Ga0501236_026750
886 Ga0501236_061392
887 Ga0501239_008268
888 Ga0501239_022020
889 Ga0501242_028556
890 Ga0501247_001677
891 Ga0501249_015806
892 Ga0501250_021692
893 Ga0501253_134882
894 Ga0501221_051863
895 Ga0501229_010742
896 Ga0501234_069478
897 Ga0501079_0096198
898 Ga0501079_0462494
899 Ga0501080_0920023
900 Ga0501081_0318094
901 Ga0501264_025066
902 Ga0501266_033245
903 Ga0501268_000721
904 Ga0501268_002016
905 Ga0501270_020108
906 Ga0501270_137056
907 Ga0501271_030138
908 Ga0501272_003465
909 Ga0501278_041674
910 Ga0501035_0356135
911 Ga0501045_0133641
912 Ga0501045_0311653
913 Ga0501045_0354704
914 Ga0501204_110763
915 Ga0501212_085310
916 nmdc:mga05p37_1347138_c1
917 nmdc:mga05p37_2036528_c1
918 nmdc:mga08y16_36935_c1
919 nmdc:mga0n895_55877_c1
920 nmdc:mga0rr50_378_c1
921 nmdc:mga0rr50_59336_c1
922 nmdc:mga08x19_4838_c1
923 nmdc:mga0a205_14245_c1
924 Ga0495595_0704180
925 Ga0495619_0786857
926 Ga0500634_0363940
927 Ga0501084_0162881
928 Ga0590071_116962
929 Ga0501082_0112592
930 Ga0501082_0860080
931 Ga0466962_0291411
932 Ga0530510_0549368
933 2559424720
934 2899361971
935 2917744719
936 8003323763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

41

142

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9577 2 144
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9569 3 144
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9548 2 145
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9526 1 145
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9498 4 145
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9568 2 144 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9436 4 145 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.937 4 145 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.925 2 144 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9046 8 145 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A522GH03-F1-model_v4 OsmC family peroxiredoxin 0.9825 48 145 GO:0004601
GO:0006979
AF-A0A534ZDK2-F1-model_v4 OsmC family peroxiredoxin 0.9808 50 145 GO:0004601
GO:0006979
AF-A0A7V9RMX0-F1-model_v4 OsmC family peroxiredoxin 0.9743 3 145 GO:0004601
GO:0006979
AF-A0A2D6ZZT1-F1-model_v4 Peroxiredoxin 0.9739 2 145 GO:0004601
GO:0006979
AF-G6FF17-F1-model_v4 deleted 0.9738 2 145

Map