F449803

General Info

Members Datasets Scaffolds Average Seq Length
467 243 934 162

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100449036|Ga0070667_1004490362
Length 171
Sequence MVPARVRSWLEQLLHTHDTPRRTAAAYAVGVFFGFSPVLGLHTVLGIVVAFFFNLNRVAVVLGIYSNLPWILPAYYTLATVLGATLLRVDVPPGLLKDLTDALTAAQWGEFRRLAHALWPLAWSFVLGSTIGASILAAVAYRTSLAAIQAHRRRIGLDTADPSKPANRASA

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
173 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 0
Rhizoplane 6
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 21.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100449036 3300005367 Bacteria 1178
2 SwRhRL3b_contig_2226574 2162886006 Bacteria 1084
3 MRS1b_contig_5654573 2162886011 Bacteria 1046
4 JGI24751J29686_10033598 3300002459 Unclassified 1063
5 Ga0065712_10068034 3300005290 Bacteria 16477
6 Ga0065712_10162824 3300005290 Bacteria 1291
7 Ga0065712_10315858 3300005290 Unclassified 817
8 Ga0065715_10057927 3300005293 Bacteria 801
9 Ga0065715_10094273 3300005293 Bacteria 4389
10 Ga0065715_10127093 3300005293 Unclassified 2094
11 Ga0065715_10417567 3300005293 Unclassified 862
12 Ga0065715_10460117 3300005293 Bacteria 817
13 Ga0065707_10327281 3300005295 Bacteria 956
14 Ga0070676_10016839 3300005328 Bacteria 4040
15 Ga0070676_10240474 3300005328 Unclassified 1204
16 Ga0070676_10371114 3300005328 Bacteria 988
17 Ga0070683_100000193 3300005329 Bacteria 40749
18 Ga0070690_100020536 3300005330 Bacteria 4024
19 Ga0070670_100025222 3300005331 Bacteria 5116
20 Ga0070670_100064678 3300005331 Bacteria 3138
21 Ga0070670_100206800 3300005331 Bacteria 1706
22 Ga0070670_100327419 3300005331 Unclassified 1343
23 Ga0070677_10200038 3300005333 Bacteria 963
24 Ga0070677_10491542 3300005333 Unclassified 663
25 Ga0068869_100195227 3300005334 Bacteria 1594
26 Ga0068869_101008708 3300005334 Unclassified 725
27 Ga0070666_10062106 3300005335 Bacteria 2530
28 Ga0070666_10719816 3300005335 Bacteria 732
29 Ga0070682_100645663 3300005337 Bacteria 842
30 Ga0068868_100331131 3300005338 Bacteria 1300
31 Ga0070689_100009046 3300005340 Bacteria 7051
32 Ga0070689_100162271 3300005340 Bacteria 1807
33 Ga0070691_10033920 3300005341 Bacteria 2402
34 Ga0070687_100110272 3300005343 Bacteria 1556
35 Ga0070661_100437096 3300005344 Bacteria 1039
36 Ga0070668_100324443 3300005347 Bacteria 1297
37 Ga0070668_100672050 3300005347 Bacteria 911
38 Ga0070669_100006705 3300005353 Bacteria 8290
39 Ga0070669_100202582 3300005353 Bacteria 1562
40 Ga0070675_100016779 3300005354 Bacteria 5815
41 Ga0070675_100222869 3300005354 Bacteria 1643
42 Ga0070671_100011259 3300005355 Bacteria 7186
43 Ga0070671_100697608 3300005355 Unclassified 880
44 Ga0070674_100128486 3300005356 Bacteria 1886
45 Ga0070674_100187465 3300005356 Bacteria 1589
46 Ga0070674_100500204 3300005356 Bacteria 1012
47 Ga0070673_100002838 3300005364 Bacteria 10664
48 Ga0070673_100260413 3300005364 Bacteria 1515
49 Ga0070673_100292292 3300005364 Unclassified 1432
50 Ga0070688_100872787 3300005365 Unclassified 708
51 Ga0070659_100096307 3300005366 Bacteria 2377
52 Ga0070659_100163826 3300005366 Bacteria 1819
53 Ga0070659_100251018 3300005366 Bacteria 1466
54 Ga0070659_100880433 3300005366 Unclassified 782
55 Ga0070667_100083289 3300005367 Bacteria 2740
56 Ga0070667_101589812 3300005367 Unclassified 614
57 Ga0070701_10070173 3300005438 Bacteria 1871
58 Ga0070711_100670262 3300005439 Unclassified 871
59 Ga0070705_100021919 3300005440 Bacteria 3405
60 Ga0070705_100814113 3300005440 Unclassified 744
61 Ga0070700_100049774 3300005441 Bacteria 2603
62 Ga0070700_100370349 3300005441 Bacteria 1068
63 Ga0070700_100569445 3300005441 Unclassified 883
64 Ga0070694_100251183 3300005444 Bacteria 1338
65 Ga0070678_100125197 3300005456 Bacteria 2033
66 Ga0070678_100377332 3300005456 Unclassified 1226
67 Ga0070662_100264049 3300005457 Bacteria 1388
68 Ga0070662_100314121 3300005457 Unclassified 1276
69 Ga0070662_100428064 3300005457 Unclassified 1096
70 Ga0070681_10422874 3300005458 Bacteria 1244
71 Ga0068867_100020896 3300005459 Bacteria 4669
72 Ga0068867_100263471 3300005459 Bacteria 1406
73 Ga0070706_100197188 3300005467 Bacteria 1881
74 Ga0070706_100707284 3300005467 Bacteria 934
75 Ga0070699_100475965 3300005518 Bacteria 1133
76 Ga0070699_101206238 3300005518 Bacteria 694
77 Ga0070679_100100418 3300005530 Bacteria 2880
78 Ga0070679_100370603 3300005530 Bacteria 1379
79 Ga0070684_100004130 3300005535 Bacteria 10989
80 Ga0070684_100019207 3300005535 Bacteria 5650
81 Ga0070684_100743471 3300005535 Bacteria 915
82 Ga0068853_100901032 3300005539 Bacteria 849
83 Ga0070672_100092676 3300005543 Bacteria 2439
84 Ga0070686_100214723 3300005544 Bacteria 1387
85 Ga0070686_101482711 3300005544 Unclassified 571
86 Ga0070693_100012590 3300005547 Bacteria 4284
87 Ga0070693_100250659 3300005547 Bacteria 1173
88 Ga0070665_100186842 3300005548 Bacteria 2073
89 Ga0070704_100067049 3300005549 Bacteria 2590
90 Ga0068855_100259649 3300005563 Bacteria 1936
91 Ga0070664_100002758 3300005564 Bacteria 14176
92 Ga0070664_100193062 3300005564 Bacteria 1815
93 Ga0070664_100263513 3300005564 Bacteria 1551
94 Ga0068857_100247410 3300005577 Bacteria 1634
95 Ga0068854_100293187 3300005578 Bacteria 1313
96 Ga0068854_100638437 3300005578 Bacteria 913
97 Ga0068854_100840099 3300005578 Unclassified 803
98 Ga0068856_100873521 3300005614 Bacteria 918
99 Ga0070702_100092439 3300005615 Bacteria 1837
100 Ga0068852_100042156 3300005616 Bacteria 3862
101 Ga0068859_100019436 3300005617 Bacteria 6823
102 Ga0068859_100374543 3300005617 Bacteria 1519
103 Ga0068864_100161465 3300005618 Bacteria 2037
104 Ga0068864_101212888 3300005618 Unclassified 753
105 Ga0068861_100014910 3300005719 Bacteria 5463
106 Ga0068861_100076231 3300005719 Bacteria 2613
107 Ga0068851_10133789 3300005834 Bacteria 1343
108 Ga0068870_10879663 3300005840 Unclassified 631
109 Ga0068863_100099782 3300005841 Bacteria 2759
110 Ga0068863_100920051 3300005841 Bacteria 875
111 Ga0068862_100086755 3300005844 Bacteria 2722
112 Ga0068862_100214511 3300005844 Bacteria 1740
113 Ga0068862_101032713 3300005844 Bacteria 814
114 Ga0075365_10018216 3300006038 Bacteria 4314
115 Ga0075365_10099224 3300006038 Bacteria 1993
116 Ga0075365_10188749 3300006038 Bacteria 1442
117 Ga0075365_10444091 3300006038 Bacteria 916
118 Ga0075368_10058590 3300006042 Bacteria 1539
119 Ga0075364_10022438 3300006051 Bacteria 3986
120 Ga0075364_10023038 3300006051 Bacteria 3939
121 Ga0075364_10030276 3300006051 Bacteria 3473
122 Ga0075362_10004081 3300006177 Bacteria 5205
123 Ga0075367_10056992 3300006178 Bacteria 2322
124 Ga0075367_10136711 3300006178 Bacteria 1517
125 Ga0075367_10522211 3300006178 Unclassified 754
126 Ga0075366_10004151 3300006195 Bacteria 7759
127 Ga0075370_10129903 3300006353 Bacteria 1470
128 Ga0075428_100019703 3300006844 Bacteria 7465
129 Ga0075428_100034492 3300006844 Bacteria 5581
130 Ga0075428_100236058 3300006844 Unclassified 1973
131 Ga0075428_100335256 3300006844 Bacteria 1625
132 Ga0075428_102081571 3300006844 Unclassified 587
133 Ga0075430_100002063 3300006846 Bacteria 16577
134 Ga0075430_100441491 3300006846 Bacteria 1074
135 Ga0075430_100597922 3300006846 Bacteria 910
136 Ga0075430_101097593 3300006846 Bacteria 655
137 Ga0075431_100001582 3300006847 Bacteria 21175
138 Ga0075433_10004517 3300006852 Bacteria 10847
139 Ga0075433_10036295 3300006852 Bacteria 4245
140 Ga0075433_10179022 3300006852 Unclassified 1886
141 Ga0075433_10417152 3300006852 Bacteria 1184
142 Ga0075433_10463190 3300006852 Bacteria 1117
143 Ga0075434_100012678 3300006871 Bacteria 7995
144 Ga0075434_100217328 3300006871 Bacteria 1931
145 Ga0075434_100247339 3300006871 Unclassified 1803
146 Ga0075434_100608226 3300006871 Unclassified 1112
147 Ga0075429_100887763 3300006880 Unclassified 780
148 Ga0075429_100907153 3300006880 Bacteria 771
149 Ga0068865_100211743 3300006881 Bacteria 1511
150 Ga0075436_100178554 3300006914 Bacteria 1500
151 Ga0097620_100019436 3300006931 Bacteria 6823
152 Ga0097620_100374543 3300006931 Bacteria 1519
153 Ga0075435_100006585 3300007076 Bacteria 8222
154 Ga0075435_100078138 3300007076 Bacteria 2714
155 Ga0075435_100149681 3300007076 Bacteria 1961
156 Ga0075435_100346525 3300007076 Unclassified 1273
157 Ga0099795_10332620 3300007788 Unclassified 675
158 Ga0105240_10155037 3300009093 Bacteria 2725
159 Ga0111539_10001863 3300009094 Bacteria 28020
160 Ga0111539_10043549 3300009094 Bacteria 5380
161 Ga0111539_10071966 3300009094 Bacteria 4078
162 Ga0111539_10079344 3300009094 Bacteria 3861
163 Ga0111539_10407818 3300009094 Bacteria 1583
164 Ga0105245_10186885 3300009098 Bacteria 1983
165 Ga0114129_10000946 3300009147 Bacteria 37881
166 Ga0114129_10022439 3300009147 Bacteria 8961
167 Ga0114129_10184866 3300009147 Bacteria 2833
168 Ga0114129_10195938 3300009147 Bacteria 2740
169 Ga0105243_10016072 3300009148 Bacteria 5662
170 Ga0105243_10223453 3300009148 Bacteria 1666
171 Ga0105243_10339920 3300009148 Bacteria 1375
172 Ga0105242_10346569 3300009176 Bacteria 1371
173 Ga0105242_11375542 3300009176 Bacteria 732
174 Ga0105242_11979704 3300009176 Bacteria 624
175 Ga0105248_10387992 3300009177 Bacteria 1572
176 Ga0105248_10443596 3300009177 Unclassified 1462
177 Ga0105248_10503227 3300009177 Unclassified 1366
178 Ga0105248_12627832 3300009177 Unclassified 574
179 Ga0105249_10000559 3300009553 Bacteria 34278
180 Ga0105249_10399130 3300009553 Unclassified 1405
181 Ga0105249_10440919 3300009553 Bacteria 1339
182 Ga0105249_10596704 3300009553 Unclassified 1159
183 Ga0105239_12239946 3300010375 Bacteria 635
184 Ga0105246_10129742 3300011119 Unclassified 1881
185 Ga0105246_10388695 3300011119 Bacteria 1155
186 Ga0105246_11035527 3300011119 Bacteria 745
187 Ga0157370_10255746 3300013104 Unclassified 1619
188 Ga0157372_10160993 3300013307 Bacteria 2594
189 Ga0157375_10185242 3300013308 Bacteria 2235
190 Ga0157375_10571515 3300013308 Bacteria 1291
191 Ga0157380_10004299 3300014326 Bacteria 9872
192 Ga0157380_10601020 3300014326 Unclassified 1088
193 Ga0157377_10008907 3300014745 Bacteria 4910
194 Ga0157379_10162550 3300014968 Bacteria 2015
195 Ga0157379_10164636 3300014968 Bacteria 2001
196 Ga0157376_10382707 3300014969 Bacteria 1356
197 Ga0157376_11641971 3300014969 Unclassified 677
198 Ga0206353_11443212 3300020082 Bacteria 1838
199 Ga0207697_10007834 3300025315 Bacteria 4723
200 Ga0207697_10023961 3300025315 Bacteria 2499
201 Ga0207682_10069220 3300025893 Bacteria 1492
202 Ga0207642_10190043 3300025899 Unclassified 1126
203 Ga0207688_10294836 3300025901 Bacteria 991
204 Ga0207645_10011420 3300025907 Bacteria 6064
205 Ga0207684_10116961 3300025910 Bacteria 2284
206 Ga0207707_10356550 3300025912 Bacteria 1260
207 Ga0207695_10763796 3300025913 Bacteria 847
208 Ga0207660_10075350 3300025917 Bacteria 2465
209 Ga0207662_10000763 3300025918 Bacteria 14776
210 Ga0207662_10344744 3300025918 Unclassified 999
211 Ga0207652_10175242 3300025921 Bacteria 1926
212 Ga0207681_10000533 3300025923 Bacteria 26280
213 Ga0207681_10052966 3300025923 Bacteria 2754
214 Ga0207650_10045261 3300025925 Bacteria 3238
215 Ga0207650_10053011 3300025925 Bacteria 3006
216 Ga0207650_10208387 3300025925 Bacteria 1569
217 Ga0207659_10224883 3300025926 Unclassified 1511
218 Ga0207659_10928484 3300025926 Bacteria 748
219 Ga0207687_10044265 3300025927 Bacteria 3071
220 Ga0207700_10024199 3300025928 Bacteria 4199
221 Ga0207644_10010775 3300025931 Bacteria 6031
222 Ga0207644_10401520 3300025931 Bacteria 1120
223 Ga0207690_10118347 3300025932 Bacteria 1920
224 Ga0207690_10259019 3300025932 Unclassified 1347
225 Ga0207706_10062558 3300025933 Bacteria 3277
226 Ga0207706_10294924 3300025933 Bacteria 1413
227 Ga0207706_10376631 3300025933 Bacteria 1232
228 Ga0207706_10463175 3300025933 Unclassified 1096
229 Ga0207686_10421088 3300025934 Bacteria 1021
230 Ga0207709_10050218 3300025935 Bacteria 2550
231 Ga0207709_11178617 3300025935 Unclassified 631
232 Ga0207670_10115048 3300025936 Bacteria 1945
233 Ga0207670_10718618 3300025936 Bacteria 828
234 Ga0207669_10099086 3300025937 Bacteria 1921
235 Ga0207669_10229175 3300025937 Bacteria 1369
236 Ga0207704_10022145 3300025938 Bacteria 3399
237 Ga0207691_10022348 3300025940 Bacteria 5966
238 Ga0207711_10025728 3300025941 Bacteria 4935
239 Ga0207689_10018755 3300025942 Bacteria 5835
240 Ga0207689_11227360 3300025942 Unclassified 631
241 Ga0207661_10001610 3300025944 Bacteria 15363
242 Ga0207679_10001939 3300025945 Bacteria 12830
243 Ga0207679_11578288 3300025945 Unclassified 601
244 Ga0207679_11884471 3300025945 Unclassified 545
245 Ga0207651_10139979 3300025960 Unclassified 1867
246 Ga0207651_11089193 3300025960 Unclassified 716
247 Ga0207712_10003591 3300025961 Bacteria 9782
248 Ga0207712_10630312 3300025961 Unclassified 930
249 Ga0207712_10720779 3300025961 Bacteria 872
250 Ga0207668_10287576 3300025972 Bacteria 1351
251 Ga0207668_10566747 3300025972 Bacteria 986
252 Ga0207640_10728242 3300025981 Bacteria 853
253 Ga0207640_10798701 3300025981 Bacteria 817
254 Ga0207658_10577688 3300025986 Unclassified 1008
255 Ga0207677_10178416 3300026023 Bacteria 1668
256 Ga0207639_10867371 3300026041 Bacteria 843
257 Ga0207678_10128215 3300026067 Bacteria 2164
258 Ga0207708_10016205 3300026075 Bacteria 5600
259 Ga0207708_10392818 3300026075 Unclassified 1146
260 Ga0207702_10849081 3300026078 Bacteria 904
261 Ga0207641_10030944 3300026088 Bacteria 4436
262 Ga0207648_10012690 3300026089 Bacteria 7876
263 Ga0207648_10135475 3300026089 Bacteria 2169
264 Ga0207676_10205835 3300026095 Bacteria 1742
265 Ga0207676_10493129 3300026095 Bacteria 1162
266 Ga0207674_10214196 3300026116 Bacteria 1875
267 Ga0207675_100003680 3300026118 Bacteria 14943
268 Ga0207675_102595128 3300026118 Unclassified 516
269 Ga0207683_10057177 3300026121 Bacteria 3424
270 Ga0207683_10395360 3300026121 Bacteria 1271
271 Ga0207698_10114755 3300026142 Bacteria 2267
272 Ga0207698_10695885 3300026142 Bacteria 1011
273 Ga0209967_1054127 3300027364 Unclassified 618
274 Ga0209982_1026505 3300027552 Unclassified 904
275 Ga0209983_1017864 3300027665 Bacteria 1470
276 Ga0207428_10064052 3300027907 Bacteria 2903
277 Ga0207428_10239002 3300027907 Bacteria 1357
278 Ga0268266_10319274 3300028379 Bacteria 1453
279 Ga0268265_10412752 3300028380 Unclassified 1251
280 Ga0268265_10532549 3300028380 Bacteria 1112
281 Ga0268265_11006701 3300028380 Bacteria 823
282 Ga0268264_10073308 3300028381 Bacteria 2905
283 Ga0307408_100026788 3300031548 Bacteria 3965
284 Ga0307408_100396093 3300031548 Unclassified 1184
285 Ga0307408_100401705 3300031548 Unclassified 1177
286 Ga0307408_100529729 3300031548 Bacteria 1036
287 Ga0307413_10230860 3300031824 Unclassified 1359
288 Ga0307413_10384394 3300031824 Bacteria 1095
289 Ga0307413_10492620 3300031824 Unclassified 982
290 Ga0307406_10107270 3300031901 Archaea 1915
291 Ga0307406_10462158 3300031901 Unclassified 1021
292 Ga0307407_10532909 3300031903 Bacteria 865
293 Ga0307412_10027941 3300031911 Bacteria 3524
294 Ga0307412_10145241 3300031911 Bacteria 1743
295 Ga0307416_100207797 3300032002 Archaea 1864
296 Ga0307416_100261435 3300032002 Unclassified 1692
297 Ga0307416_101545790 3300032002 Unclassified 769
298 Ga0307414_10305956 3300032004 Bacteria 1347
299 Ga0307411_10192318 3300032005 Bacteria 1559
300 Ga0373929_0012639 3300035085 Bacteria 1607
301 Ga0373951_0048294 3300035091 Bacteria 1042
302 Ga0373936_0160403 3300035113 Bacteria 979
303 Ga0373941_0075632 3300035115 Bacteria 1127
304 Ga0373931_0102754 3300035691 Bacteria 1610
305 Ga0373931_0495321 3300035691 Bacteria 787
306 Ga0373947_0079406 3300035725 Bacteria 2028
307 Ga0373947_0129119 3300035725 Bacteria 1612
308 Ga0373937_0003495 3300036401 Bacteria 13215
309 Ga0373937_0565168 3300036401 Bacteria 1080
310 Ga0373925_0006743 3300037068 Bacteria 8418
311 Ga0436365_1472987 3300039437 Unclassified 1015
312 Ga0439439_0131266 3300041406 Unclassified 703
313 Ga0439433_0064189 3300041999 Unclassified 879
314 Ga0439446_0102638 3300042156 Unclassified 906
315 Ga0439434_0017151 3300042435 Bacteria 2166
316 Ga0439434_0041023 3300042435 Bacteria 1422
317 Ga0439435_0000338 3300042436 Bacteria 7099
318 Ga0450916_041213 3300042530 Unclassified 703
319 Ga0451577_0032887 3300042876 Bacteria 4675
320 Ga0453684_0159566 3300044712 Bacteria 2669
321 Ga0453684_0227344 3300044712 Unclassified 2156
322 Ga0451576_0246601 3300045051 Bacteria 1867
323 Ga0451576_1879441 3300045051 Bacteria 618
324 Ga0466967_0350340 3300045976 Bacteria 1429
325 Ga0466967_1086008 3300045976 Unclassified 797
326 Ga0495603_0057148 3300046455 Bacteria 2309
327 Ga0495651_0401220 3300046462 Bacteria 895
328 Ga0495582_0356140 3300046473 Bacteria 843
329 Ga0495594_0600629 3300046499 Bacteria 624
330 Ga0495658_0202226 3300046683 Bacteria 1238
331 Ga0495613_0393109 3300046689 Bacteria 947
332 Ga0495613_0417844 3300046689 Bacteria 913
333 Ga0495680_0811711 3300047322 Bacteria 610
334 Ga0496102_0080046 3300048905 Bacteria 3010
335 Ga0496104_0027139 3300048907 Bacteria 5297
336 Ga0496104_0266275 3300048907 Bacteria 1626
337 Ga0496104_0895281 3300048907 Unclassified 793
338 Ga0496105_0220416 3300048908 Bacteria 1544
339 Ga0496105_0272975 3300048908 Bacteria 1365
340 Ga0496106_0100259 3300048909 Bacteria 2246
341 Ga0496106_0353392 3300048909 Bacteria 1181
342 Ga0496106_0968962 3300048909 Bacteria 670
343 Ga0496107_0389470 3300048910 Bacteria 1037
344 Ga0496108_0006612 3300048911 Bacteria 9401
345 Ga0496108_0787623 3300048911 Bacteria 821
346 Ga0496109_0000914 3300048912 Bacteria 24543
347 Ga0496109_0990311 3300048912 Bacteria 778
348 Ga0496109_1233498 3300048912 Unclassified 684
349 Ga0496110_0008686 3300048913 Bacteria 8181
350 Ga0496110_0071879 3300048913 Bacteria 3069
351 Ga0496111_0026842 3300048914 Bacteria 4069
352 Ga0496111_0198456 3300048914 Bacteria 1492
353 Ga0496112_0003596 3300048915 Bacteria 12898
354 Ga0496112_0033981 3300048915 Bacteria 4961
355 Ga0496112_0062062 3300048915 Bacteria 3686
356 Ga0496112_0083148 3300048915 Bacteria 3166
357 Ga0496112_0672894 3300048915 Unclassified 964
358 Ga0496112_1366288 3300048915 Bacteria 623
359 Ga0496113_1018749 3300048916 Unclassified 652
360 Ga0496114_0226115 3300048917 Bacteria 1643
361 Ga0496114_1046345 3300048917 Bacteria 700
362 Ga0501296_046484 3300049519 Unclassified 625
363 Ga0501031_0281483 3300049568 Unclassified 1079
364 Ga0501034_0192895 3300049571 Bacteria 1999
365 Ga0501036_0122588 3300049572 Bacteria 2195
366 Ga0501036_0339508 3300049572 Unclassified 1255
367 Ga0501036_0526812 3300049572 Bacteria 982
368 Ga0501038_0490977 3300049574 Bacteria 940
369 Ga0501039_0518498 3300049575 Bacteria 936
370 Ga0501039_0866894 3300049575 Unclassified 703
371 Ga0501039_0903739 3300049575 Bacteria 687
372 Ga0501040_0017998 3300049576 Bacteria 4691
373 Ga0501040_0135181 3300049576 Bacteria 1736
374 Ga0501040_0293341 3300049576 Bacteria 1162
375 Ga0501040_0817267 3300049576 Bacteria 674
376 Ga0501041_0199595 3300049577 Bacteria 1254
377 Ga0501041_0422354 3300049577 Unclassified 845
378 Ga0501042_0170534 3300049578 Bacteria 1570
379 Ga0501046_0066036 3300049580 Bacteria 2821
380 Ga0501048_0021851 3300049582 Bacteria 4683
381 Ga0501048_0110508 3300049582 Bacteria 1941
382 Ga0501067_0028604 3300049583 Bacteria 3089
383 Ga0501069_0048924 3300049585 Bacteria 2349
384 Ga0501069_0560742 3300049585 Unclassified 684
385 Ga0501069_0744689 3300049585 Unclassified 592
386 Ga0501070_0830811 3300049586 Unclassified 724
387 Ga0501071_0021616 3300049587 Bacteria 4483
388 Ga0501071_0135051 3300049587 Unclassified 1835
389 Ga0501071_0142479 3300049587 Bacteria 1785
390 Ga0501071_0271848 3300049587 Bacteria 1281
391 Ga0501071_0510419 3300049587 Bacteria 922
392 Ga0501071_0688830 3300049587 Unclassified 787
393 Ga0501072_0020081 3300049588 Bacteria 5173
394 Ga0501072_0024381 3300049588 Bacteria 4705
395 Ga0501072_0058741 3300049588 Bacteria 3031
396 Ga0501072_0495700 3300049588 Bacteria 966
397 Ga0501072_0719302 3300049588 Bacteria 784
398 Ga0501074_0090989 3300049590 Bacteria 2185
399 Ga0501074_0133023 3300049590 Bacteria 1779
400 Ga0501074_0251472 3300049590 Bacteria 1257
401 Ga0501075_0002437 3300049591 Bacteria 12391
402 Ga0501076_0025479 3300049592 Bacteria 4577
403 Ga0501076_0025794 3300049592 Bacteria 4551
404 Ga0501077_0043588 3300049593 Bacteria 2852
405 Ga0501077_0088533 3300049593 Bacteria 1962
406 Ga0501079_0083552 3300049741 Bacteria 2470
407 Ga0501079_0160135 3300049741 Bacteria 1755
408 Ga0501080_0143972 3300049742 Bacteria 2203
409 Ga0501080_0492004 3300049742 Unclassified 1097
410 Ga0501080_1383455 3300049742 Bacteria 601
411 Ga0501081_0163194 3300049743 Unclassified 1606
412 Ga0501081_0345843 3300049743 Bacteria 1095
413 Ga0501268_026925 3300049765 Bacteria 1019
414 Ga0501035_0227381 3300049822 Bacteria 1591
415 Ga0501044_1371164 3300049823 Unclassified 573
416 Ga0501045_0252626 3300049824 Unclassified 1312
417 Ga0501045_0339232 3300049824 Unclassified 1118
418 nmdc:mga03683_114419_c1 3300050489 Unclassified 1196
419 nmdc:mga00v17_35294_c1 3300050491 Bacteria 2975
420 nmdc:mga00v17_39808_c1 3300050491 Bacteria 2816
421 nmdc:mga00v17_8986_c1 3300050491 Bacteria 5392
422 nmdc:mga0yw44_188308_c1 3300050492 Bacteria 1360
423 nmdc:mga0yw44_315904_c1 3300050492 Bacteria 1048
424 nmdc:mga0yw44_6943_c1 3300050492 Bacteria 5523
425 nmdc:mga0k408_23354_c1 3300050493 Bacteria 3487
426 nmdc:mga0k408_2536_c1 3300050493 Bacteria 9705
427 nmdc:mga06z11_120868_c1 3300050494 Bacteria 1461
428 nmdc:mga06z11_304102_c1 3300050494 Bacteria 949
429 nmdc:mga06z11_89958_c1 3300050494 Bacteria 1664
430 nmdc:mga07m45_342546_c1 3300050496 Bacteria 869
431 nmdc:mga05p37_114357_c1 3300050507 Bacteria 3317
432 nmdc:mga05p37_21277_c1 3300050507 Bacteria 7852
433 nmdc:mga05p37_5703_c1 3300050507 Bacteria 14639
434 nmdc:mga05p37_62729_c1 3300050507 Bacteria 4574
435 nmdc:mga09592_773112_c1 3300050508 Unclassified 814
436 nmdc:mga0qj67_1158524_c1 3300050509 Unclassified 602
437 nmdc:mga0qj67_558649_c1 3300050509 Bacteria 918
438 nmdc:mga0qj67_995250_c1 3300050509 Bacteria 658
439 nmdc:mga08y16_306740_c1 3300050511 Bacteria 1635
440 nmdc:mga08y16_477597_c1 3300050511 Bacteria 1269
441 nmdc:mga08y16_60840_c1 3300050511 Bacteria 3943
442 nmdc:mga08y16_67052_c1 3300050511 Bacteria 3745
443 nmdc:mga08y16_71839_c1 3300050511 Bacteria 3606
444 nmdc:mga08y16_771188_c1 3300050511 Bacteria 956
445 nmdc:mga0n895_1260688_c1 3300050512 Unclassified 711
446 nmdc:mga0n895_162838_c1 3300050512 Bacteria 2262
447 nmdc:mga0n895_748641_c1 3300050512 Bacteria 970
448 nmdc:mga0n895_87817_c1 3300050512 Bacteria 3108
449 nmdc:mga0rr50_147749_c1 3300050513 Bacteria 1896
450 nmdc:mga0rr50_223444_c1 3300050513 Bacteria 1556
451 nmdc:mga0rr50_66445_c1 3300050513 Bacteria 2736
452 nmdc:mga08x19_167800_c1 3300050514 Bacteria 1493
453 nmdc:mga08x19_172036_c1 3300050514 Bacteria 1475
454 nmdc:mga0a205_248469_c1 3300050515 Unclassified 1659
455 nmdc:mga0a205_274273_c1 3300050515 Unclassified 1563
456 nmdc:mga0a205_326076_c1 3300050515 Bacteria 1406
457 Ga0495601_0072574 3300053077 Bacteria 2199
458 Ga0495619_0169747 3300053085 Bacteria 1508
459 Ga0495619_0563244 3300053085 Bacteria 781
460 Ga0501084_0048512 3300054114 Bacteria 3555
461 Ga0501084_0060738 3300054114 Bacteria 3164
462 Ga0501084_0089153 3300054114 Bacteria 2589
463 Ga0590074_048412 3300059423 Unclassified 775
464 Ga0501082_0136431 3300060353 Bacteria 2129
465 Ga0501082_0573252 3300060353 Unclassified 987
466 Ga0530510_0005273 3300061734 Bacteria 8927
467 Ga0530510_0644407 3300061734 Unclassified 807
468 Ga0070667_100449036
469 SwRhRL3b_contig_2226574
470 MRS1b_contig_5654573
471 JGI24751J29686_10033598
472 Ga0065712_10068034
473 Ga0065712_10162824
474 Ga0065712_10315858
475 Ga0065715_10057927
476 Ga0065715_10094273
477 Ga0065715_10127093
478 Ga0065715_10417567
479 Ga0065715_10460117
480 Ga0065707_10327281
481 Ga0070676_10016839
482 Ga0070676_10240474
483 Ga0070676_10371114
484 Ga0070683_100000193
485 Ga0070690_100020536
486 Ga0070670_100025222
487 Ga0070670_100064678
488 Ga0070670_100206800
489 Ga0070670_100327419
490 Ga0070677_10200038
491 Ga0070677_10491542
492 Ga0068869_100195227
493 Ga0068869_101008708
494 Ga0070666_10062106
495 Ga0070666_10719816
496 Ga0070682_100645663
497 Ga0068868_100331131
498 Ga0070689_100009046
499 Ga0070689_100162271
500 Ga0070691_10033920
501 Ga0070687_100110272
502 Ga0070661_100437096
503 Ga0070668_100324443
504 Ga0070668_100672050
505 Ga0070669_100006705
506 Ga0070669_100202582
507 Ga0070675_100016779
508 Ga0070675_100222869
509 Ga0070671_100011259
510 Ga0070671_100697608
511 Ga0070674_100128486
512 Ga0070674_100187465
513 Ga0070674_100500204
514 Ga0070673_100002838
515 Ga0070673_100260413
516 Ga0070673_100292292
517 Ga0070688_100872787
518 Ga0070659_100096307
519 Ga0070659_100163826
520 Ga0070659_100251018
521 Ga0070659_100880433
522 Ga0070667_100083289
523 Ga0070667_101589812
524 Ga0070701_10070173
525 Ga0070711_100670262
526 Ga0070705_100021919
527 Ga0070705_100814113
528 Ga0070700_100049774
529 Ga0070700_100370349
530 Ga0070700_100569445
531 Ga0070694_100251183
532 Ga0070678_100125197
533 Ga0070678_100377332
534 Ga0070662_100264049
535 Ga0070662_100314121
536 Ga0070662_100428064
537 Ga0070681_10422874
538 Ga0068867_100020896
539 Ga0068867_100263471
540 Ga0070706_100197188
541 Ga0070706_100707284
542 Ga0070699_100475965
543 Ga0070699_101206238
544 Ga0070679_100100418
545 Ga0070679_100370603
546 Ga0070684_100004130
547 Ga0070684_100019207
548 Ga0070684_100743471
549 Ga0068853_100901032
550 Ga0070672_100092676
551 Ga0070686_100214723
552 Ga0070686_101482711
553 Ga0070693_100012590
554 Ga0070693_100250659
555 Ga0070665_100186842
556 Ga0070704_100067049
557 Ga0068855_100259649
558 Ga0070664_100002758
559 Ga0070664_100193062
560 Ga0070664_100263513
561 Ga0068857_100247410
562 Ga0068854_100293187
563 Ga0068854_100638437
564 Ga0068854_100840099
565 Ga0068856_100873521
566 Ga0070702_100092439
567 Ga0068852_100042156
568 Ga0068859_100019436
569 Ga0068859_100374543
570 Ga0068864_100161465
571 Ga0068864_101212888
572 Ga0068861_100014910
573 Ga0068861_100076231
574 Ga0068851_10133789
575 Ga0068870_10879663
576 Ga0068863_100099782
577 Ga0068863_100920051
578 Ga0068862_100086755
579 Ga0068862_100214511
580 Ga0068862_101032713
581 Ga0075365_10018216
582 Ga0075365_10099224
583 Ga0075365_10188749
584 Ga0075365_10444091
585 Ga0075368_10058590
586 Ga0075364_10022438
587 Ga0075364_10023038
588 Ga0075364_10030276
589 Ga0075362_10004081
590 Ga0075367_10056992
591 Ga0075367_10136711
592 Ga0075367_10522211
593 Ga0075366_10004151
594 Ga0075370_10129903
595 Ga0075428_100019703
596 Ga0075428_100034492
597 Ga0075428_100236058
598 Ga0075428_100335256
599 Ga0075428_102081571
600 Ga0075430_100002063
601 Ga0075430_100441491
602 Ga0075430_100597922
603 Ga0075430_101097593
604 Ga0075431_100001582
605 Ga0075433_10004517
606 Ga0075433_10036295
607 Ga0075433_10179022
608 Ga0075433_10417152
609 Ga0075433_10463190
610 Ga0075434_100012678
611 Ga0075434_100217328
612 Ga0075434_100247339
613 Ga0075434_100608226
614 Ga0075429_100887763
615 Ga0075429_100907153
616 Ga0068865_100211743
617 Ga0075436_100178554
618 Ga0097620_100019436
619 Ga0097620_100374543
620 Ga0075435_100006585
621 Ga0075435_100078138
622 Ga0075435_100149681
623 Ga0075435_100346525
624 Ga0099795_10332620
625 Ga0105240_10155037
626 Ga0111539_10001863
627 Ga0111539_10043549
628 Ga0111539_10071966
629 Ga0111539_10079344
630 Ga0111539_10407818
631 Ga0105245_10186885
632 Ga0114129_10000946
633 Ga0114129_10022439
634 Ga0114129_10184866
635 Ga0114129_10195938
636 Ga0105243_10016072
637 Ga0105243_10223453
638 Ga0105243_10339920
639 Ga0105242_10346569
640 Ga0105242_11375542
641 Ga0105242_11979704
642 Ga0105248_10387992
643 Ga0105248_10443596
644 Ga0105248_10503227
645 Ga0105248_12627832
646 Ga0105249_10000559
647 Ga0105249_10399130
648 Ga0105249_10440919
649 Ga0105249_10596704
650 Ga0105239_12239946
651 Ga0105246_10129742
652 Ga0105246_10388695
653 Ga0105246_11035527
654 Ga0157370_10255746
655 Ga0157372_10160993
656 Ga0157375_10185242
657 Ga0157375_10571515
658 Ga0157380_10004299
659 Ga0157380_10601020
660 Ga0157377_10008907
661 Ga0157379_10162550
662 Ga0157379_10164636
663 Ga0157376_10382707
664 Ga0157376_11641971
665 Ga0206353_11443212
666 Ga0207697_10007834
667 Ga0207697_10023961
668 Ga0207682_10069220
669 Ga0207642_10190043
670 Ga0207688_10294836
671 Ga0207645_10011420
672 Ga0207684_10116961
673 Ga0207707_10356550
674 Ga0207695_10763796
675 Ga0207660_10075350
676 Ga0207662_10000763
677 Ga0207662_10344744
678 Ga0207652_10175242
679 Ga0207681_10000533
680 Ga0207681_10052966
681 Ga0207650_10045261
682 Ga0207650_10053011
683 Ga0207650_10208387
684 Ga0207659_10224883
685 Ga0207659_10928484
686 Ga0207687_10044265
687 Ga0207700_10024199
688 Ga0207644_10010775
689 Ga0207644_10401520
690 Ga0207690_10118347
691 Ga0207690_10259019
692 Ga0207706_10062558
693 Ga0207706_10294924
694 Ga0207706_10376631
695 Ga0207706_10463175
696 Ga0207686_10421088
697 Ga0207709_10050218
698 Ga0207709_11178617
699 Ga0207670_10115048
700 Ga0207670_10718618
701 Ga0207669_10099086
702 Ga0207669_10229175
703 Ga0207704_10022145
704 Ga0207691_10022348
705 Ga0207711_10025728
706 Ga0207689_10018755
707 Ga0207689_11227360
708 Ga0207661_10001610
709 Ga0207679_10001939
710 Ga0207679_11578288
711 Ga0207679_11884471
712 Ga0207651_10139979
713 Ga0207651_11089193
714 Ga0207712_10003591
715 Ga0207712_10630312
716 Ga0207712_10720779
717 Ga0207668_10287576
718 Ga0207668_10566747
719 Ga0207640_10728242
720 Ga0207640_10798701
721 Ga0207658_10577688
722 Ga0207677_10178416
723 Ga0207639_10867371
724 Ga0207678_10128215
725 Ga0207708_10016205
726 Ga0207708_10392818
727 Ga0207702_10849081
728 Ga0207641_10030944
729 Ga0207648_10012690
730 Ga0207648_10135475
731 Ga0207676_10205835
732 Ga0207676_10493129
733 Ga0207674_10214196
734 Ga0207675_100003680
735 Ga0207675_102595128
736 Ga0207683_10057177
737 Ga0207683_10395360
738 Ga0207698_10114755
739 Ga0207698_10695885
740 Ga0209967_1054127
741 Ga0209982_1026505
742 Ga0209983_1017864
743 Ga0207428_10064052
744 Ga0207428_10239002
745 Ga0268266_10319274
746 Ga0268265_10412752
747 Ga0268265_10532549
748 Ga0268265_11006701
749 Ga0268264_10073308
750 Ga0307408_100026788
751 Ga0307408_100396093
752 Ga0307408_100401705
753 Ga0307408_100529729
754 Ga0307413_10230860
755 Ga0307413_10384394
756 Ga0307413_10492620
757 Ga0307406_10107270
758 Ga0307406_10462158
759 Ga0307407_10532909
760 Ga0307412_10027941
761 Ga0307412_10145241
762 Ga0307416_100207797
763 Ga0307416_100261435
764 Ga0307416_101545790
765 Ga0307414_10305956
766 Ga0307411_10192318
767 Ga0373929_0012639
768 Ga0373951_0048294
769 Ga0373936_0160403
770 Ga0373941_0075632
771 Ga0373931_0102754
772 Ga0373931_0495321
773 Ga0373947_0079406
774 Ga0373947_0129119
775 Ga0373937_0003495
776 Ga0373937_0565168
777 Ga0373925_0006743
778 Ga0436365_1472987
779 Ga0439439_0131266
780 Ga0439433_0064189
781 Ga0439446_0102638
782 Ga0439434_0017151
783 Ga0439434_0041023
784 Ga0439435_0000338
785 Ga0450916_041213
786 Ga0451577_0032887
787 Ga0453684_0159566
788 Ga0453684_0227344
789 Ga0451576_0246601
790 Ga0451576_1879441
791 Ga0466967_0350340
792 Ga0466967_1086008
793 Ga0495603_0057148
794 Ga0495651_0401220
795 Ga0495582_0356140
796 Ga0495594_0600629
797 Ga0495658_0202226
798 Ga0495613_0393109
799 Ga0495613_0417844
800 Ga0495680_0811711
801 Ga0496102_0080046
802 Ga0496104_0027139
803 Ga0496104_0266275
804 Ga0496104_0895281
805 Ga0496105_0220416
806 Ga0496105_0272975
807 Ga0496106_0100259
808 Ga0496106_0353392
809 Ga0496106_0968962
810 Ga0496107_0389470
811 Ga0496108_0006612
812 Ga0496108_0787623
813 Ga0496109_0000914
814 Ga0496109_0990311
815 Ga0496109_1233498
816 Ga0496110_0008686
817 Ga0496110_0071879
818 Ga0496111_0026842
819 Ga0496111_0198456
820 Ga0496112_0003596
821 Ga0496112_0033981
822 Ga0496112_0062062
823 Ga0496112_0083148
824 Ga0496112_0672894
825 Ga0496112_1366288
826 Ga0496113_1018749
827 Ga0496114_0226115
828 Ga0496114_1046345
829 Ga0501296_046484
830 Ga0501031_0281483
831 Ga0501034_0192895
832 Ga0501036_0122588
833 Ga0501036_0339508
834 Ga0501036_0526812
835 Ga0501038_0490977
836 Ga0501039_0518498
837 Ga0501039_0866894
838 Ga0501039_0903739
839 Ga0501040_0017998
840 Ga0501040_0135181
841 Ga0501040_0293341
842 Ga0501040_0817267
843 Ga0501041_0199595
844 Ga0501041_0422354
845 Ga0501042_0170534
846 Ga0501046_0066036
847 Ga0501048_0021851
848 Ga0501048_0110508
849 Ga0501067_0028604
850 Ga0501069_0048924
851 Ga0501069_0560742
852 Ga0501069_0744689
853 Ga0501070_0830811
854 Ga0501071_0021616
855 Ga0501071_0135051
856 Ga0501071_0142479
857 Ga0501071_0271848
858 Ga0501071_0510419
859 Ga0501071_0688830
860 Ga0501072_0020081
861 Ga0501072_0024381
862 Ga0501072_0058741
863 Ga0501072_0495700
864 Ga0501072_0719302
865 Ga0501074_0090989
866 Ga0501074_0133023
867 Ga0501074_0251472
868 Ga0501075_0002437
869 Ga0501076_0025479
870 Ga0501076_0025794
871 Ga0501077_0043588
872 Ga0501077_0088533
873 Ga0501079_0083552
874 Ga0501079_0160135
875 Ga0501080_0143972
876 Ga0501080_0492004
877 Ga0501080_1383455
878 Ga0501081_0163194
879 Ga0501081_0345843
880 Ga0501268_026925
881 Ga0501035_0227381
882 Ga0501044_1371164
883 Ga0501045_0252626
884 Ga0501045_0339232
885 nmdc:mga03683_114419_c1
886 nmdc:mga00v17_35294_c1
887 nmdc:mga00v17_39808_c1
888 nmdc:mga00v17_8986_c1
889 nmdc:mga0yw44_188308_c1
890 nmdc:mga0yw44_315904_c1
891 nmdc:mga0yw44_6943_c1
892 nmdc:mga0k408_23354_c1
893 nmdc:mga0k408_2536_c1
894 nmdc:mga06z11_120868_c1
895 nmdc:mga06z11_304102_c1
896 nmdc:mga06z11_89958_c1
897 nmdc:mga07m45_342546_c1
898 nmdc:mga05p37_114357_c1
899 nmdc:mga05p37_21277_c1
900 nmdc:mga05p37_5703_c1
901 nmdc:mga05p37_62729_c1
902 nmdc:mga09592_773112_c1
903 nmdc:mga0qj67_1158524_c1
904 nmdc:mga0qj67_558649_c1
905 nmdc:mga0qj67_995250_c1
906 nmdc:mga08y16_306740_c1
907 nmdc:mga08y16_477597_c1
908 nmdc:mga08y16_60840_c1
909 nmdc:mga08y16_67052_c1
910 nmdc:mga08y16_71839_c1
911 nmdc:mga08y16_771188_c1
912 nmdc:mga0n895_1260688_c1
913 nmdc:mga0n895_162838_c1
914 nmdc:mga0n895_748641_c1
915 nmdc:mga0n895_87817_c1
916 nmdc:mga0rr50_147749_c1
917 nmdc:mga0rr50_223444_c1
918 nmdc:mga0rr50_66445_c1
919 nmdc:mga08x19_167800_c1
920 nmdc:mga08x19_172036_c1
921 nmdc:mga0a205_248469_c1
922 nmdc:mga0a205_274273_c1
923 nmdc:mga0a205_326076_c1
924 Ga0495601_0072574
925 Ga0495619_0169747
926 Ga0495619_0563244
927 Ga0501084_0048512
928 Ga0501084_0060738
929 Ga0501084_0089153
930 Ga0590074_048412
931 Ga0501082_0136431
932 Ga0501082_0573252
933 Ga0530510_0005273
934 Ga0530510_0644407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09835

DUF2062

Uncharacterized protein conserved in bacteria (DUF2062)

4

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6njx-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with mercury 0.3598 79 150
6b87-assembly3.cif.gz_D crystal structure of transmembrane protein tmhc2_e 0.359 73 165
7upq-assembly2.cif.gz_E crystal structure of designed heterotrimeric assembly dht03_1arm_a21/b/c 0.3495 76 152
6njw-assembly1.cif.gz_A c-terminal region of the xanthomonas campestris pv. campestris old protein phased with platinum 0.3262 79 155
8j2f-assembly1.cif.gz_B human neutral shpingomyelinase 0.3239 77 162
ID Description Score Start End Superfamily
af_Q54TU2_879_984_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5101 75 133 1.20.120.230
af_Q7Z7G8_3735_4022_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.4506 76 158 2.30.29.30
af_Q2QQ58_1_256_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3724 76 163 1.20.1270.60
af_C1P645_6_169_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3705 79 149 1.20.1270.60
af_C6ZS22_189_299_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3551 79 164 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A843SV08-F1-model_v4 DUF2062 domain-containing protein 0.9208 1 164 GO:0016020
AF-A0A2M7CE79-F1-model_v4 DUF2062 domain-containing protein 0.9154 2 158 GO:0016020
AF-A0A521SXN3-F1-model_v4 DUF2062 domain-containing protein 0.9129 1 161 GO:0016020
AF-A0A843SV08-F1-model_v4 DUF2062 domain-containing protein 0.9102 1 164 GO:0016020
AF-A0A1F9DXK4-F1-model_v4 DUF2062 domain-containing protein 0.8965 10 159 GO:0016020

Map