F449566

General Info

Members Datasets Scaffolds Average Seq Length
465 310 930 177

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0000127|Ga0501083_0000127_1668_2288
Length 206
Sequence VKLFARFGKGKHMSRVGKKPVVIPSGVTADISAQGGSASGGKDTFLKVKGPKGELTLAIHPKVSVEKTDEGMVVKVKHETNKQERALWGLFRALINNMVVGVTEGFTKTLEINGVGYKAAMSGKKLVLNLGYSHPIEMEVPAGLETKVDKNVITITGADRQAVGQFAAVIRIQRPPEPYKGKGIKYSDETIRRKAGKVVKAVGGGK

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
162 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
298 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
299 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
300 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
301 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
302 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
303 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
304 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
305 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
306 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
307 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
308 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
309 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
310 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 5.16
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 1.51
Rhizoplane 2.15
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0000127 3300049744 Bacteria 52007
2 JGI24736J21556_1000535 3300001904 Bacteria 7069
3 JGI24736J21556_1007818 3300001904 Bacteria 1791
4 JGI24743J22301_10010320 3300001991 Bacteria 1666
5 JGI24735J21928_10012565 3300002067 Bacteria 2674
6 JGI25406J46586_10000001 3300003203 Bacteria 251772
7 Ga0058859_10022019 3300004798 Bacteria 1452
8 Ga0058863_11792460 3300004799 Bacteria 1940
9 Ga0058861_12054136 3300004800 Bacteria 3266
10 Ga0058862_12698388 3300004803 Bacteria 1963
11 Ga0065714_10252458 3300005288 Bacteria 751
12 Ga0065712_10267158 3300005290 Unclassified 924
13 Ga0065712_10301275 3300005290 Bacteria 859
14 Ga0065715_10212898 3300005293 Bacteria 1305
15 Ga0065707_10133191 3300005295 Bacteria 1885
16 Ga0070658_10012380 3300005327 Bacteria 6848
17 Ga0070658_10322598 3300005327 Archaea 1319
18 Ga0070658_10562326 3300005327 Bacteria 987
19 Ga0070676_10032758 3300005328 Bacteria 2979
20 Ga0070683_100003081 3300005329 Bacteria 13424
21 Ga0070683_100140844 3300005329 Bacteria 2285
22 Ga0070690_100167796 3300005330 Unclassified 1509
23 Ga0070690_100175638 3300005330 Bacteria 1477
24 Ga0070677_10077247 3300005333 Bacteria 1416
25 Ga0068869_100268537 3300005334 Bacteria 1368
26 Ga0070666_10002665 3300005335 Bacteria 10770
27 Ga0070666_10254245 3300005335 Bacteria 1244
28 Ga0070680_101133331 3300005336 Bacteria 676
29 Ga0070682_100115504 3300005337 Bacteria 1795
30 Ga0070689_100292113 3300005340 Bacteria 1355
31 Ga0070687_100035423 3300005343 Bacteria 2478
32 Ga0070668_100316003 3300005347 Bacteria 1314
33 Ga0070675_100195349 3300005354 Bacteria 1755
34 Ga0070674_100061977 3300005356 Bacteria 2612
35 Ga0070674_100477710 3300005356 Bacteria 1034
36 Ga0070673_100025448 3300005364 Bacteria 4356
37 Ga0070673_100179188 3300005364 Bacteria 1813
38 Ga0070667_100541668 3300005367 Bacteria 1069
39 Ga0070714_100287287 3300005435 Bacteria 1530
40 Ga0070701_10013814 3300005438 Bacteria 3684
41 Ga0070705_100217179 3300005440 Bacteria 1322
42 Ga0070705_101234394 3300005440 Bacteria 617
43 Ga0070700_100037218 3300005441 Bacteria 2958
44 Ga0070694_100080432 3300005444 Bacteria 2264
45 Ga0070708_100091045 3300005445 Bacteria 2777
46 Ga0070708_100594236 3300005445 Bacteria 1043
47 Ga0070685_10015156 3300005466 Bacteria 4091
48 Ga0070706_100357086 3300005467 Bacteria 1362
49 Ga0070707_100000292 3300005468 Bacteria 49172
50 Ga0070707_100528407 3300005468 Bacteria 1142
51 Ga0070698_100007384 3300005471 Bacteria 11891
52 Ga0070698_100326511 3300005471 Bacteria 1465
53 Ga0070699_100202470 3300005518 Bacteria 1766
54 Ga0070679_100234077 3300005530 Bacteria 1796
55 Ga0070679_100243390 3300005530 Bacteria 1756
56 Ga0070679_100881841 3300005530 Bacteria 838
57 Ga0070684_100056547 3300005535 Bacteria 3424
58 Ga0070684_100095201 3300005535 Bacteria 2653
59 Ga0070684_100202332 3300005535 Bacteria 1809
60 Ga0070684_100950737 3300005535 Bacteria 806
61 Ga0068853_100083191 3300005539 Bacteria 2804
62 Ga0070672_100223373 3300005543 Bacteria 1580
63 Ga0070672_100522321 3300005543 Bacteria 1029
64 Ga0070672_101018380 3300005543 Bacteria 734
65 Ga0070686_100088453 3300005544 Bacteria 2067
66 Ga0070695_100008633 3300005545 Bacteria 6053
67 Ga0070696_100148598 3300005546 Bacteria 1718
68 Ga0070665_100474722 3300005548 Bacteria 1261
69 Ga0070704_100089057 3300005549 Bacteria 2294
70 Ga0070704_100464119 3300005549 Bacteria 1093
71 Ga0068855_100293461 3300005563 Bacteria 1802
72 Ga0068855_100305522 3300005563 Bacteria 1761
73 Ga0068855_100384175 3300005563 Bacteria 1541
74 Ga0068855_100808242 3300005563 Unclassified 996
75 Ga0068857_100192841 3300005577 Bacteria 1856
76 Ga0068852_100604169 3300005616 Bacteria 1101
77 Ga0068859_100342824 3300005617 Bacteria 1588
78 Ga0068851_10019197 3300005834 Bacteria 3301
79 Ga0068863_100038569 3300005841 Bacteria 4544
80 Ga0068863_100342260 3300005841 Bacteria 1455
81 Ga0068858_100020832 3300005842 Bacteria 6128
82 Ga0068858_100594385 3300005842 Bacteria 1073
83 Ga0068860_100111708 3300005843 Bacteria 2613
84 Ga0081455_10344702 3300005937 Bacteria 1053
85 Ga0081539_10059040 3300005985 Bacteria 2114
86 Ga0081539_10077680 3300005985 Bacteria 1754
87 Ga0070717_11166309 3300006028 Bacteria 701
88 Ga0075368_10002415 3300006042 Bacteria 6093
89 Ga0075363_100009208 3300006048 Bacteria 4637
90 Ga0075363_100063933 3300006048 Bacteria 1987
91 Ga0075364_10024908 3300006051 Bacteria 3804
92 Ga0075364_10114644 3300006051 Bacteria 1801
93 Ga0070716_100099735 3300006173 Bacteria 1778
94 Ga0075362_10025610 3300006177 Bacteria 2513
95 Ga0075367_10035085 3300006178 Bacteria 2901
96 Ga0097621_100907756 3300006237 Bacteria 821
97 Ga0075428_100010507 3300006844 Bacteria 10286
98 Ga0075430_100148259 3300006846 Bacteria 1954
99 Ga0075431_100373156 3300006847 Bacteria 1431
100 Ga0075433_10045975 3300006852 Bacteria 3796
101 Ga0075433_10108788 3300006852 Bacteria 2459
102 Ga0075433_10129756 3300006852 Bacteria 2239
103 Ga0075434_100072156 3300006871 Bacteria 3444
104 Ga0075434_100156699 3300006871 Bacteria 2296
105 Ga0075429_100087811 3300006880 Bacteria 2710
106 Ga0068865_100170664 3300006881 Bacteria 1667
107 Ga0075436_100032597 3300006914 Bacteria 3592
108 Ga0075436_100184363 3300006914 Bacteria 1476
109 Ga0075436_100691897 3300006914 Bacteria 755
110 Ga0097620_100342811 3300006931 Bacteria 1588
111 Ga0079104_1000280 3300006946 Bacteria 65859
112 Ga0079104_1010677 3300006946 Bacteria 3002
113 Ga0079104_1028321 3300006946 Bacteria 1424
114 Ga0079104_1040574 3300006946 Bacteria 1089
115 Ga0075435_100011633 3300007076 Bacteria 6486
116 Ga0105251_10017161 3300009011 Bacteria 3889
117 Ga0105240_10068403 3300009093 Bacteria 4398
118 Ga0105240_11713787 3300009093 Bacteria 656
119 Ga0105245_10004821 3300009098 Bacteria 11893
120 Ga0105245_10093563 3300009098 Bacteria 2769
121 Ga0114129_10065627 3300009147 Bacteria 5065
122 Ga0105241_10051425 3300009174 Bacteria 3142
123 Ga0105248_10113808 3300009177 Bacteria 3051
124 Ga0105237_10056200 3300009545 Bacteria 3940
125 Ga0105238_10011584 3300009551 Bacteria 8885
126 Ga0105249_10664651 3300009553 Bacteria 1100
127 Ga0105239_10032725 3300010375 Bacteria 5713
128 Ga0105239_10102431 3300010375 Bacteria 3168
129 Ga0157373_10001369 3300013100 Bacteria 18710
130 Ga0157370_10198056 3300013104 Bacteria 1864
131 Ga0157370_10257422 3300013104 Bacteria 1613
132 Ga0157378_10005509 3300013297 Bacteria 11097
133 Ga0157378_10044546 3300013297 Bacteria 3940
134 Ga0157378_10174062 3300013297 Unclassified 2021
135 Ga0163162_10907605 3300013306 Bacteria 994
136 Ga0157375_12109976 3300013308 Bacteria 671
137 Ga0163163_10053826 3300014325 Bacteria 3974
138 Ga0157380_10140157 3300014326 Bacteria 2076
139 Ga0157377_10135165 3300014745 Bacteria 1510
140 Ga0182006_1062258 3300015261 Bacteria 1404
141 Ga0182006_1079482 3300015261 Bacteria 1199
142 Ga0206355_1444440 3300020076 Bacteria 811
143 Ga0206351_10771532 3300020077 Bacteria 2259
144 Ga0206352_11184891 3300020078 Bacteria 1832
145 Ga0206350_10810608 3300020080 Bacteria 5805
146 Ga0213876_10156320 3300021384 Bacteria 1213
147 Ga0224712_10000184 3300022467 Bacteria 10959
148 Ga0207656_10021980 3300025321 Bacteria 2555
149 Ga0207713_1028456 3300025735 Bacteria 2520
150 Ga0207682_10028076 3300025893 Bacteria 2244
151 Ga0207680_10001681 3300025903 Bacteria 10452
152 Ga0207680_10023603 3300025903 Bacteria 3362
153 Ga0207647_10000001 3300025904 Bacteria 506349
154 Ga0207647_10054869 3300025904 Bacteria 2450
155 Ga0207647_10056801 3300025904 Bacteria 2401
156 Ga0207705_10011835 3300025909 Bacteria 6304
157 Ga0207684_10216735 3300025910 Bacteria 1652
158 Ga0207654_10027464 3300025911 Bacteria 3093
159 Ga0207707_10625759 3300025912 Bacteria 909
160 Ga0207695_10010441 3300025913 Bacteria 11360
161 Ga0207671_10098988 3300025914 Bacteria 2206
162 Ga0207693_10350498 3300025915 Bacteria 1155
163 Ga0207662_10005790 3300025918 Bacteria 6615
164 Ga0207657_10032769 3300025919 Bacteria 4690
165 Ga0207652_10198175 3300025921 Bacteria 1807
166 Ga0207652_10541848 3300025921 Bacteria 1046
167 Ga0207652_10588609 3300025921 Bacteria 998
168 Ga0207652_10719467 3300025921 Bacteria 890
169 Ga0207646_10001393 3300025922 Bacteria 29980
170 Ga0207646_10196281 3300025922 Bacteria 1823
171 Ga0207694_10058395 3300025924 Bacteria 3001
172 Ga0207687_10015188 3300025927 Bacteria 5046
173 Ga0207664_10051819 3300025929 Bacteria 3243
174 Ga0207709_11018855 3300025935 Bacteria 677
175 Ga0207669_10043775 3300025937 Bacteria 2624
176 Ga0207665_10056664 3300025939 Bacteria 2646
177 Ga0207691_10271540 3300025940 Bacteria 1460
178 Ga0207691_10312457 3300025940 Bacteria 1348
179 Ga0207691_10452485 3300025940 Bacteria 1093
180 Ga0207661_10002899 3300025944 Bacteria 11851
181 Ga0207661_10103266 3300025944 Bacteria 2399
182 Ga0207667_10276788 3300025949 Bacteria 1715
183 Ga0207667_10379187 3300025949 Bacteria 1441
184 Ga0207651_10025687 3300025960 Bacteria 3666
185 Ga0207658_10134659 3300025986 Bacteria 1990
186 Ga0207677_10125596 3300026023 Bacteria 1938
187 Ga0207703_10043924 3300026035 Bacteria 3589
188 Ga0207639_10132032 3300026041 Bacteria 2069
189 Ga0207708_10061239 3300026075 Bacteria 2873
190 Ga0207702_10407713 3300026078 Bacteria 1312
191 Ga0207641_10185679 3300026088 Bacteria 1907
192 Ga0207648_10332848 3300026089 Bacteria 1366
193 Ga0207674_10217783 3300026116 Bacteria 1857
194 Ga0209281_1000059 3300027111 Bacteria 295913
195 Ga0209281_1000337 3300027111 Bacteria 79938
196 Ga0209281_1000435 3300027111 Bacteria 61761
197 Ga0209813_10000406 3300027866 Bacteria 10561
198 Ga0268266_11386116 3300028379 Bacteria 679
199 Ga0268265_10363120 3300028380 Bacteria 1326
200 Ga0268264_10121832 3300028381 Bacteria 2299
201 Ga0265334_10018557 3300028573 Bacteria 2867
202 Ga0265322_10027648 3300028654 Bacteria 1621
203 Ga0265338_10030478 3300028800 Bacteria 5313
204 Ga0265338_10099324 3300028800 Bacteria 2378
205 Ga0265324_10019999 3300029957 Bacteria 2409
206 Ga0265328_10010665 3300031239 Bacteria 3692
207 Ga0265328_10034301 3300031239 Bacteria 1879
208 Ga0265320_10003506 3300031240 Bacteria 10517
209 Ga0265329_10002134 3300031242 Bacteria 9169
210 Ga0265339_10013165 3300031249 Bacteria 5020
211 Ga0265331_10022569 3300031250 Bacteria 3210
212 Ga0265331_10248136 3300031250 Bacteria 798
213 Ga0265313_10025503 3300031595 Bacteria 3131
214 Ga0316575_10038599 3300031665 Bacteria 1884
215 Ga0265314_10020637 3300031711 Bacteria 5085
216 Ga0316576_10020212 3300031727 Bacteria 4577
217 Ga0316576_10028618 3300031727 Bacteria 3930
218 Ga0316576_10036550 3300031727 Bacteria 3512
219 Ga0316576_10052895 3300031727 Bacteria 2958
220 Ga0316576_10082478 3300031727 Bacteria 2387
221 Ga0316578_10354771 3300031728 Bacteria 873
222 Ga0307413_10001014 3300031824 Bacteria 10155
223 Ga0307416_100037641 3300032002 Bacteria 3725
224 Ga0307414_10000673 3300032004 Bacteria 17502
225 Ga0316580_10030960 3300032139 Bacteria 1657
226 Ga0316593_10200638 3300032168 Bacteria 737
227 Ga0307510_10128269 3300033180 Bacteria 2218
228 Ga0316592_1005208 3300033524 Unclassified 2458
229 Ga0316592_1008100 3300033524 Bacteria 2066
230 Ga0316588_1012952 3300033528 Bacteria 1803
231 Ga0316588_1024940 3300033528 Unclassified 1378
232 Ga0316588_1034897 3300033528 Bacteria 1189
233 Ga0316596_1001043 3300033541 Bacteria 5368
234 Ga0316596_1016449 3300033541 Bacteria 1853
235 Ga0373926_0025205 3300035083 Bacteria 2075
236 Ga0373923_0013935 3300035111 Bacteria 3009
237 Ga0373936_0025847 3300035113 Bacteria 2298
238 Ga0373939_0290036 3300035114 Bacteria 649
239 Ga0373953_0001433 3300035117 Bacteria 6907
240 Ga0373953_0078441 3300035117 Bacteria 1370
241 Ga0373954_0002529 3300035118 Bacteria 7673
242 Ga0373956_0058659 3300035119 Bacteria 1740
243 Ga0373957_0037711 3300035120 Bacteria 1806
244 Ga0373943_0057911 3300035170 Bacteria 1927
245 Ga0373946_0465893 3300035171 Unclassified 645
246 Ga0373955_0008379 3300035172 Bacteria 4800
247 Ga0373955_0012189 3300035172 Bacteria 4127
248 Ga0373955_0323870 3300035172 Bacteria 931
249 Ga0373962_0019963 3300035242 Bacteria 1756
250 Ga0316574_0034560 3300035398 Bacteria 3083
251 Ga0373924_0385641 3300035410 Bacteria 626
252 Ga0373935_0119014 3300035692 Bacteria 1762
253 Ga0373933_0052084 3300035724 Bacteria 2448
254 Ga0373933_0100571 3300035724 Bacteria 1793
255 Ga0373933_0228217 3300035724 Bacteria 1196
256 Ga0373933_0434530 3300035724 Bacteria 858
257 Ga0373937_0039877 3300036401 Bacteria 4280
258 Ga0373937_0050665 3300036401 Bacteria 3803
259 Ga0373925_0022049 3300037068 Bacteria 4642
260 Ga0395899_0021136 3300037312 Bacteria 4936
261 Ga0395900_0130829 3300037418 Bacteria 2572
262 Ga0395900_0169317 3300037418 Bacteria 2225
263 Ga0395898_0259888 3300037466 Bacteria 1656
264 Ga0395898_0519672 3300037466 Bacteria 1132
265 Ga0395901_0342676 3300038443 Bacteria 1544
266 Ga0395901_0554807 3300038443 Bacteria 1164
267 Ga0400486_30747 3300038742 Bacteria 1547
268 Ga0436365_0047289 3300039437 Bacteria 7014
269 Ga0436365_0252966 3300039437 Bacteria 1722
270 Ga0436365_0454085 3300039437 Bacteria 2191
271 Ga0436365_1611975 3300039437 Bacteria 824
272 Ga0436362_0255382 3300039453 Bacteria 1158
273 Ga0451845_0735073 3300041501 Bacteria 1623
274 Ga0451853_2946566 3300041512 Bacteria 2040
275 Ga0451853_3612113 3300041512 Bacteria 834
276 Ga0450910_020842 3300042147 Bacteria 990
277 Ga0451577_0003056 3300042876 Bacteria 19007
278 Ga0451577_0006236 3300042876 Bacteria 11958
279 Ga0451577_0030192 3300042876 Bacteria 4897
280 Ga0451577_0142636 3300042876 Bacteria 2153
281 Ga0466969_0419684 3300044656 Bacteria 608
282 Ga0466963_0395345 3300044694 Bacteria 975
283 Ga0466964_0079439 3300044706 Bacteria 1405
284 Ga0453684_0000041 3300044712 Bacteria 690022
285 Ga0453684_0001066 3300044712 Bacteria 87216
286 Ga0453684_0014647 3300044712 Bacteria 12516
287 Ga0453684_0555181 3300044712 Bacteria 1264
288 Ga0453684_0996925 3300044712 Bacteria 891
289 Ga0466968_0482376 3300044735 Bacteria 616
290 Ga0451576_0062715 3300045051 Bacteria 3874
291 Ga0451576_0063362 3300045051 Bacteria 3853
292 Ga0451576_0306814 3300045051 Bacteria 1660
293 Ga0451576_0455285 3300045051 Bacteria 1343
294 Ga0451576_1141606 3300045051 Bacteria 815
295 Ga0495592_0005667 3300046454 Bacteria 9231
296 Ga0495592_0039694 3300046454 Bacteria 3535
297 Ga0495592_0102898 3300046454 Bacteria 2033
298 Ga0495591_016124 3300046458 Bacteria 2615
299 Ga0495641_0054267 3300046461 Bacteria 1821
300 Ga0495651_0002307 3300046462 Bacteria 14726
301 Ga0495651_0192132 3300046462 Unclassified 1436
302 Ga0495653_0015203 3300046463 Bacteria 6274
303 Ga0495653_0019992 3300046463 Bacteria 5428
304 Ga0495653_0037864 3300046463 Bacteria 3787
305 Ga0495653_0453133 3300046463 Bacteria 807
306 Ga0495582_0159873 3300046473 Bacteria 1281
307 Ga0495608_0000670 3300046511 Bacteria 23642
308 Ga0495618_0026915 3300046514 Bacteria 3578
309 Ga0495620_0017318 3300046515 Bacteria 3595
310 Ga0495628_0019333 3300046516 Bacteria 5632
311 Ga0495628_0040395 3300046516 Bacteria 3728
312 Ga0495628_0042913 3300046516 Bacteria 3605
313 Ga0495630_0017678 3300046517 Bacteria 5227
314 Ga0495630_0293270 3300046517 Bacteria 1243
315 Ga0495652_0018013 3300046529 Bacteria 6301
316 Ga0495652_0133957 3300046529 Bacteria 1957
317 Ga0495652_0146626 3300046529 Bacteria 1849
318 Ga0495652_0240591 3300046529 Bacteria 1347
319 Ga0495654_0110712 3300046530 Bacteria 1253
320 Ga0495640_0122566 3300046533 Bacteria 1688
321 Ga0495640_0156271 3300046533 Bacteria 1464
322 Ga0495640_0360479 3300046533 Unclassified 896
323 Ga0495587_0014842 3300046536 Bacteria 4874
324 Ga0495587_0249964 3300046536 Unclassified 997
325 Ga0495587_0311471 3300046536 Bacteria 879
326 Ga0495645_0059278 3300046543 Bacteria 2776
327 Ga0495645_0063981 3300046543 Bacteria 2662
328 Ga0495667_0050299 3300046559 Bacteria 2751
329 Ga0495667_0397826 3300046559 Unclassified 868
330 Ga0495634_0048412 3300046642 Bacteria 2862
331 Ga0495634_0057228 3300046642 Bacteria 2603
332 Ga0495635_0069461 3300046663 Bacteria 2415
333 Ga0495635_0095252 3300046663 Bacteria 2035
334 Ga0495635_0533199 3300046663 Unclassified 771
335 Ga0495657_0038178 3300046675 Bacteria 3306
336 Ga0495657_0129594 3300046675 Bacteria 1581
337 Ga0495599_0002847 3300046678 Bacteria 10079
338 Ga0495599_0049077 3300046678 Bacteria 2646
339 Ga0495646_0137961 3300046680 Bacteria 1366
340 Ga0495646_0192316 3300046680 Bacteria 1115
341 Ga0495658_0348637 3300046683 Unclassified 941
342 Ga0495658_0538338 3300046683 Bacteria 748
343 Ga0495613_0220347 3300046689 Bacteria 1332
344 Ga0495600_0004535 3300046809 Bacteria 8323
345 Ga0495600_0151608 3300046809 Bacteria 1501
346 Ga0495600_0437035 3300046809 Bacteria 810
347 Ga0495604_0044614 3300047317 Bacteria 3462
348 Ga0495604_0167202 3300047317 Bacteria 1550
349 Ga0495674_0066935 3300047319 Bacteria 3114
350 Ga0495672_0006039 3300047320 Bacteria 9463
351 Ga0495680_0078703 3300047322 Bacteria 2494
352 Ga0495680_0139261 3300047322 Bacteria 1776
353 Ga0495675_0000975 3300047444 Bacteria 17364
354 Ga0495675_0002584 3300047444 Bacteria 10850
355 Ga0495675_0398209 3300047444 Bacteria 803
356 Ga0495684_0057456 3300047471 Bacteria 2965
357 Ga0495684_0095749 3300047471 Bacteria 2247
358 Ga0495684_0164535 3300047471 Unclassified 1653
359 Ga0495684_0226312 3300047471 Bacteria 1369
360 Ga0496100_0217454 3300048903 Bacteria 1401
361 Ga0496101_0347080 3300048904 Bacteria 1166
362 Ga0496102_0067414 3300048905 Bacteria 3283
363 Ga0496106_0112458 3300048909 Bacteria 2122
364 Ga0496108_1577170 3300048911 Bacteria 544
365 Ga0496110_0105501 3300048913 Bacteria 2528
366 Ga0496111_0554903 3300048914 Bacteria 843
367 Ga0496112_0273283 3300048915 Unclassified 1638
368 Ga0496112_0852106 3300048915 Bacteria 835
369 Ga0496114_1062747 3300048917 Bacteria 694
370 Ga0496122_0239688 3300048925 Bacteria 1024
371 Ga0496124_0289073 3300048927 Bacteria 1191
372 Ga0496126_0000190 3300048929 Bacteria 137687
373 Ga0496126_0179750 3300048929 Bacteria 1798
374 Ga0501311_004736 3300049527 Bacteria 1463
375 Ga0501034_0002020 3300049571 Bacteria 25539
376 Ga0501034_0256368 3300049571 Bacteria 1693
377 Ga0501040_0383220 3300049576 Bacteria 1009
378 Ga0501042_0414186 3300049578 Bacteria 976
379 Ga0501042_0728848 3300049578 Bacteria 721
380 Ga0501043_0508829 3300049579 Bacteria 899
381 Ga0501046_0391829 3300049580 Bacteria 1004
382 Ga0501047_0037417 3300049581 Bacteria 4693
383 Ga0501048_0487124 3300049582 Bacteria 884
384 Ga0501068_0041718 3300049584 Bacteria 2758
385 Ga0501070_0097827 3300049586 Bacteria 2427
386 Ga0501070_0133667 3300049586 Bacteria 2048
387 Ga0501071_0160335 3300049587 Bacteria 1681
388 Ga0501071_0514368 3300049587 Bacteria 918
389 Ga0501072_0704799 3300049588 Bacteria 793
390 Ga0501073_0073037 3300049589 Bacteria 2389
391 Ga0501074_0212749 3300049590 Bacteria 1377
392 Ga0501075_0062590 3300049591 Bacteria 2805
393 Ga0501075_0712354 3300049591 Bacteria 764
394 Ga0501076_0079520 3300049592 Bacteria 2631
395 Ga0501076_0259125 3300049592 Bacteria 1424
396 Ga0501076_1227162 3300049592 Bacteria 617
397 Ga0501079_0434321 3300049741 Bacteria 1031
398 Ga0501080_0286093 3300049742 Bacteria 1498
399 Ga0501081_0404243 3300049743 Bacteria 1011
400 Ga0501081_0443239 3300049743 Bacteria 964
401 Ga0501035_0018430 3300049822 Bacteria 6432
402 nmdc:mga03683_58535_c1 3300050489 Bacteria 1624
403 nmdc:mga03683_862_c1 3300050489 Bacteria 8724
404 nmdc:mga03n38_129178_c1 3300050490 Bacteria 1250
405 nmdc:mga03n38_14808_c1 3300050490 Bacteria 2999
406 nmdc:mga03n38_243517_c1 3300050490 Bacteria 947
407 nmdc:mga00v17_21650_c1 3300050491 Bacteria 3698
408 nmdc:mga00v17_98762_c1 3300050491 Bacteria 1841
409 nmdc:mga06z11_18440_c1 3300050494 Bacteria 3188
410 nmdc:mga04h51_11198_c1 3300050495 Bacteria 2484
411 nmdc:mga05p37_78937_c1 3300050507 Bacteria 4053
412 nmdc:mga09592_160521_c1 3300050508 Bacteria 1942
413 nmdc:mga09592_51122_c1 3300050508 Bacteria 3486
414 nmdc:mga0qj67_7823_c1 3300050509 Bacteria 7902
415 nmdc:mga06r32_1143515_c1 3300050510 Bacteria 726
416 nmdc:mga06r32_674179_c1 3300050510 Bacteria 1001
417 nmdc:mga0n895_204846_c1 3300050512 Bacteria 2003
418 nmdc:mga0n895_56240_c1 3300050512 Bacteria 3875
419 nmdc:mga0rr50_354464_c1 3300050513 Bacteria 1234
420 nmdc:mga08x19_572176_c1 3300050514 Bacteria 800
421 nmdc:mga08x19_80561_c1 3300050514 Bacteria 2137
422 nmdc:mga08x19_81630_c1 3300050514 Bacteria 2123
423 nmdc:mga0a205_436525_c1 3300050515 Bacteria 1170
424 nmdc:mga0a205_567090_c1 3300050515 Bacteria 990
425 Ga0495601_0005352 3300053077 Bacteria 7476
426 Ga0495601_0080551 3300053077 Bacteria 2089
427 Ga0495601_0180268 3300053077 Bacteria 1381
428 Ga0495595_0001372 3300053084 Bacteria 9454
429 Ga0495595_0024335 3300053084 Bacteria 2674
430 Ga0495619_0005930 3300053085 Bacteria 7740
431 Ga0495619_0090875 3300053085 Bacteria 2067
432 Ga0495619_0157287 3300053085 Bacteria 1569
433 Ga0500583_0202879 3300053092 Bacteria 985
434 Ga0500641_0149408 3300053096 Bacteria 1009
435 Ga0500568_0014440 3300053139 Bacteria 3566
436 Ga0500568_0028292 3300053139 Bacteria 2337
437 Ga0500568_0043000 3300053139 Bacteria 1807
438 Ga0500573_0013689 3300053140 Bacteria 4576
439 Ga0500627_0085685 3300053158 Bacteria 1407
440 Ga0590071_051639 3300059421 Bacteria 997
441 Ga0590074_002898 3300059423 Bacteria 2827
442 Ga0590075_001597 3300059424 Bacteria 5601
443 Ga0590077_013957 3300059426 Bacteria 1671
444 Ga0587093_013249 3300059478 Bacteria 1012
445 Ga0587070_012594 3300059491 Bacteria 1289
446 Ga0587077_007424 3300059493 Bacteria 1596
447 Ga0587077_062247 3300059493 Bacteria 812
448 Ga0587083_0014617 3300059505 Bacteria 1355
449 Ga0587076_055699 3300059645 Bacteria 784
450 Ga0501082_0784681 3300060353 Bacteria 833
451 Ga0530510_0329770 3300061734 Bacteria 1145
452 2644009204 2643221600 Bacteria 5530138
453 2644643926 2643221716 Bacteria 4986332
454 2644681821 2643221725 Bacteria 5087956
455 2802655269 2802428842 Bacteria 4926114
456 2883356692 2883354860 Bacteria 5865246
457 2919194231 2919191525 Bacteria 5765973
458 2919511836 2919509842 Bacteria 4104664
459 2919684604 2919683626 Bacteria 5534354
460 2965321933 2965320100 Bacteria 3975600
461 2977272065 2977268062 Bacteria 5243061
462 8007379637 8007375930 Bacteria 4080554
463 8054311439 8054307821 Bacteria 5212224
464 8055423572 8055419101 Bacteria 5289643
465 8055595074 8055592153 Bacteria 5961247
466 Ga0501083_0000127
467 JGI24736J21556_1000535
468 JGI24736J21556_1007818
469 JGI24743J22301_10010320
470 JGI24735J21928_10012565
471 JGI25406J46586_10000001
472 Ga0058859_10022019
473 Ga0058863_11792460
474 Ga0058861_12054136
475 Ga0058862_12698388
476 Ga0065714_10252458
477 Ga0065712_10267158
478 Ga0065712_10301275
479 Ga0065715_10212898
480 Ga0065707_10133191
481 Ga0070658_10012380
482 Ga0070658_10322598
483 Ga0070658_10562326
484 Ga0070676_10032758
485 Ga0070683_100003081
486 Ga0070683_100140844
487 Ga0070690_100167796
488 Ga0070690_100175638
489 Ga0070677_10077247
490 Ga0068869_100268537
491 Ga0070666_10002665
492 Ga0070666_10254245
493 Ga0070680_101133331
494 Ga0070682_100115504
495 Ga0070689_100292113
496 Ga0070687_100035423
497 Ga0070668_100316003
498 Ga0070675_100195349
499 Ga0070674_100061977
500 Ga0070674_100477710
501 Ga0070673_100025448
502 Ga0070673_100179188
503 Ga0070667_100541668
504 Ga0070714_100287287
505 Ga0070701_10013814
506 Ga0070705_100217179
507 Ga0070705_101234394
508 Ga0070700_100037218
509 Ga0070694_100080432
510 Ga0070708_100091045
511 Ga0070708_100594236
512 Ga0070685_10015156
513 Ga0070706_100357086
514 Ga0070707_100000292
515 Ga0070707_100528407
516 Ga0070698_100007384
517 Ga0070698_100326511
518 Ga0070699_100202470
519 Ga0070679_100234077
520 Ga0070679_100243390
521 Ga0070679_100881841
522 Ga0070684_100056547
523 Ga0070684_100095201
524 Ga0070684_100202332
525 Ga0070684_100950737
526 Ga0068853_100083191
527 Ga0070672_100223373
528 Ga0070672_100522321
529 Ga0070672_101018380
530 Ga0070686_100088453
531 Ga0070695_100008633
532 Ga0070696_100148598
533 Ga0070665_100474722
534 Ga0070704_100089057
535 Ga0070704_100464119
536 Ga0068855_100293461
537 Ga0068855_100305522
538 Ga0068855_100384175
539 Ga0068855_100808242
540 Ga0068857_100192841
541 Ga0068852_100604169
542 Ga0068859_100342824
543 Ga0068851_10019197
544 Ga0068863_100038569
545 Ga0068863_100342260
546 Ga0068858_100020832
547 Ga0068858_100594385
548 Ga0068860_100111708
549 Ga0081455_10344702
550 Ga0081539_10059040
551 Ga0081539_10077680
552 Ga0070717_11166309
553 Ga0075368_10002415
554 Ga0075363_100009208
555 Ga0075363_100063933
556 Ga0075364_10024908
557 Ga0075364_10114644
558 Ga0070716_100099735
559 Ga0075362_10025610
560 Ga0075367_10035085
561 Ga0097621_100907756
562 Ga0075428_100010507
563 Ga0075430_100148259
564 Ga0075431_100373156
565 Ga0075433_10045975
566 Ga0075433_10108788
567 Ga0075433_10129756
568 Ga0075434_100072156
569 Ga0075434_100156699
570 Ga0075429_100087811
571 Ga0068865_100170664
572 Ga0075436_100032597
573 Ga0075436_100184363
574 Ga0075436_100691897
575 Ga0097620_100342811
576 Ga0079104_1000280
577 Ga0079104_1010677
578 Ga0079104_1028321
579 Ga0079104_1040574
580 Ga0075435_100011633
581 Ga0105251_10017161
582 Ga0105240_10068403
583 Ga0105240_11713787
584 Ga0105245_10004821
585 Ga0105245_10093563
586 Ga0114129_10065627
587 Ga0105241_10051425
588 Ga0105248_10113808
589 Ga0105237_10056200
590 Ga0105238_10011584
591 Ga0105249_10664651
592 Ga0105239_10032725
593 Ga0105239_10102431
594 Ga0157373_10001369
595 Ga0157370_10198056
596 Ga0157370_10257422
597 Ga0157378_10005509
598 Ga0157378_10044546
599 Ga0157378_10174062
600 Ga0163162_10907605
601 Ga0157375_12109976
602 Ga0163163_10053826
603 Ga0157380_10140157
604 Ga0157377_10135165
605 Ga0182006_1062258
606 Ga0182006_1079482
607 Ga0206355_1444440
608 Ga0206351_10771532
609 Ga0206352_11184891
610 Ga0206350_10810608
611 Ga0213876_10156320
612 Ga0224712_10000184
613 Ga0207656_10021980
614 Ga0207713_1028456
615 Ga0207682_10028076
616 Ga0207680_10001681
617 Ga0207680_10023603
618 Ga0207647_10000001
619 Ga0207647_10054869
620 Ga0207647_10056801
621 Ga0207705_10011835
622 Ga0207684_10216735
623 Ga0207654_10027464
624 Ga0207707_10625759
625 Ga0207695_10010441
626 Ga0207671_10098988
627 Ga0207693_10350498
628 Ga0207662_10005790
629 Ga0207657_10032769
630 Ga0207652_10198175
631 Ga0207652_10541848
632 Ga0207652_10588609
633 Ga0207652_10719467
634 Ga0207646_10001393
635 Ga0207646_10196281
636 Ga0207694_10058395
637 Ga0207687_10015188
638 Ga0207664_10051819
639 Ga0207709_11018855
640 Ga0207669_10043775
641 Ga0207665_10056664
642 Ga0207691_10271540
643 Ga0207691_10312457
644 Ga0207691_10452485
645 Ga0207661_10002899
646 Ga0207661_10103266
647 Ga0207667_10276788
648 Ga0207667_10379187
649 Ga0207651_10025687
650 Ga0207658_10134659
651 Ga0207677_10125596
652 Ga0207703_10043924
653 Ga0207639_10132032
654 Ga0207708_10061239
655 Ga0207702_10407713
656 Ga0207641_10185679
657 Ga0207648_10332848
658 Ga0207674_10217783
659 Ga0209281_1000059
660 Ga0209281_1000337
661 Ga0209281_1000435
662 Ga0209813_10000406
663 Ga0268266_11386116
664 Ga0268265_10363120
665 Ga0268264_10121832
666 Ga0265334_10018557
667 Ga0265322_10027648
668 Ga0265338_10030478
669 Ga0265338_10099324
670 Ga0265324_10019999
671 Ga0265328_10010665
672 Ga0265328_10034301
673 Ga0265320_10003506
674 Ga0265329_10002134
675 Ga0265339_10013165
676 Ga0265331_10022569
677 Ga0265331_10248136
678 Ga0265313_10025503
679 Ga0316575_10038599
680 Ga0265314_10020637
681 Ga0316576_10020212
682 Ga0316576_10028618
683 Ga0316576_10036550
684 Ga0316576_10052895
685 Ga0316576_10082478
686 Ga0316578_10354771
687 Ga0307413_10001014
688 Ga0307416_100037641
689 Ga0307414_10000673
690 Ga0316580_10030960
691 Ga0316593_10200638
692 Ga0307510_10128269
693 Ga0316592_1005208
694 Ga0316592_1008100
695 Ga0316588_1012952
696 Ga0316588_1024940
697 Ga0316588_1034897
698 Ga0316596_1001043
699 Ga0316596_1016449
700 Ga0373926_0025205
701 Ga0373923_0013935
702 Ga0373936_0025847
703 Ga0373939_0290036
704 Ga0373953_0001433
705 Ga0373953_0078441
706 Ga0373954_0002529
707 Ga0373956_0058659
708 Ga0373957_0037711
709 Ga0373943_0057911
710 Ga0373946_0465893
711 Ga0373955_0008379
712 Ga0373955_0012189
713 Ga0373955_0323870
714 Ga0373962_0019963
715 Ga0316574_0034560
716 Ga0373924_0385641
717 Ga0373935_0119014
718 Ga0373933_0052084
719 Ga0373933_0100571
720 Ga0373933_0228217
721 Ga0373933_0434530
722 Ga0373937_0039877
723 Ga0373937_0050665
724 Ga0373925_0022049
725 Ga0395899_0021136
726 Ga0395900_0130829
727 Ga0395900_0169317
728 Ga0395898_0259888
729 Ga0395898_0519672
730 Ga0395901_0342676
731 Ga0395901_0554807
732 Ga0400486_30747
733 Ga0436365_0047289
734 Ga0436365_0252966
735 Ga0436365_0454085
736 Ga0436365_1611975
737 Ga0436362_0255382
738 Ga0451845_0735073
739 Ga0451853_2946566
740 Ga0451853_3612113
741 Ga0450910_020842
742 Ga0451577_0003056
743 Ga0451577_0006236
744 Ga0451577_0030192
745 Ga0451577_0142636
746 Ga0466969_0419684
747 Ga0466963_0395345
748 Ga0466964_0079439
749 Ga0453684_0000041
750 Ga0453684_0001066
751 Ga0453684_0014647
752 Ga0453684_0555181
753 Ga0453684_0996925
754 Ga0466968_0482376
755 Ga0451576_0062715
756 Ga0451576_0063362
757 Ga0451576_0306814
758 Ga0451576_0455285
759 Ga0451576_1141606
760 Ga0495592_0005667
761 Ga0495592_0039694
762 Ga0495592_0102898
763 Ga0495591_016124
764 Ga0495641_0054267
765 Ga0495651_0002307
766 Ga0495651_0192132
767 Ga0495653_0015203
768 Ga0495653_0019992
769 Ga0495653_0037864
770 Ga0495653_0453133
771 Ga0495582_0159873
772 Ga0495608_0000670
773 Ga0495618_0026915
774 Ga0495620_0017318
775 Ga0495628_0019333
776 Ga0495628_0040395
777 Ga0495628_0042913
778 Ga0495630_0017678
779 Ga0495630_0293270
780 Ga0495652_0018013
781 Ga0495652_0133957
782 Ga0495652_0146626
783 Ga0495652_0240591
784 Ga0495654_0110712
785 Ga0495640_0122566
786 Ga0495640_0156271
787 Ga0495640_0360479
788 Ga0495587_0014842
789 Ga0495587_0249964
790 Ga0495587_0311471
791 Ga0495645_0059278
792 Ga0495645_0063981
793 Ga0495667_0050299
794 Ga0495667_0397826
795 Ga0495634_0048412
796 Ga0495634_0057228
797 Ga0495635_0069461
798 Ga0495635_0095252
799 Ga0495635_0533199
800 Ga0495657_0038178
801 Ga0495657_0129594
802 Ga0495599_0002847
803 Ga0495599_0049077
804 Ga0495646_0137961
805 Ga0495646_0192316
806 Ga0495658_0348637
807 Ga0495658_0538338
808 Ga0495613_0220347
809 Ga0495600_0004535
810 Ga0495600_0151608
811 Ga0495600_0437035
812 Ga0495604_0044614
813 Ga0495604_0167202
814 Ga0495674_0066935
815 Ga0495672_0006039
816 Ga0495680_0078703
817 Ga0495680_0139261
818 Ga0495675_0000975
819 Ga0495675_0002584
820 Ga0495675_0398209
821 Ga0495684_0057456
822 Ga0495684_0095749
823 Ga0495684_0164535
824 Ga0495684_0226312
825 Ga0496100_0217454
826 Ga0496101_0347080
827 Ga0496102_0067414
828 Ga0496106_0112458
829 Ga0496108_1577170
830 Ga0496110_0105501
831 Ga0496111_0554903
832 Ga0496112_0273283
833 Ga0496112_0852106
834 Ga0496114_1062747
835 Ga0496122_0239688
836 Ga0496124_0289073
837 Ga0496126_0000190
838 Ga0496126_0179750
839 Ga0501311_004736
840 Ga0501034_0002020
841 Ga0501034_0256368
842 Ga0501040_0383220
843 Ga0501042_0414186
844 Ga0501042_0728848
845 Ga0501043_0508829
846 Ga0501046_0391829
847 Ga0501047_0037417
848 Ga0501048_0487124
849 Ga0501068_0041718
850 Ga0501070_0097827
851 Ga0501070_0133667
852 Ga0501071_0160335
853 Ga0501071_0514368
854 Ga0501072_0704799
855 Ga0501073_0073037
856 Ga0501074_0212749
857 Ga0501075_0062590
858 Ga0501075_0712354
859 Ga0501076_0079520
860 Ga0501076_0259125
861 Ga0501076_1227162
862 Ga0501079_0434321
863 Ga0501080_0286093
864 Ga0501081_0404243
865 Ga0501081_0443239
866 Ga0501035_0018430
867 nmdc:mga03683_58535_c1
868 nmdc:mga03683_862_c1
869 nmdc:mga03n38_129178_c1
870 nmdc:mga03n38_14808_c1
871 nmdc:mga03n38_243517_c1
872 nmdc:mga00v17_21650_c1
873 nmdc:mga00v17_98762_c1
874 nmdc:mga06z11_18440_c1
875 nmdc:mga04h51_11198_c1
876 nmdc:mga05p37_78937_c1
877 nmdc:mga09592_160521_c1
878 nmdc:mga09592_51122_c1
879 nmdc:mga0qj67_7823_c1
880 nmdc:mga06r32_1143515_c1
881 nmdc:mga06r32_674179_c1
882 nmdc:mga0n895_204846_c1
883 nmdc:mga0n895_56240_c1
884 nmdc:mga0rr50_354464_c1
885 nmdc:mga08x19_572176_c1
886 nmdc:mga08x19_80561_c1
887 nmdc:mga08x19_81630_c1
888 nmdc:mga0a205_436525_c1
889 nmdc:mga0a205_567090_c1
890 Ga0495601_0005352
891 Ga0495601_0080551
892 Ga0495601_0180268
893 Ga0495595_0001372
894 Ga0495595_0024335
895 Ga0495619_0005930
896 Ga0495619_0090875
897 Ga0495619_0157287
898 Ga0500583_0202879
899 Ga0500641_0149408
900 Ga0500568_0014440
901 Ga0500568_0028292
902 Ga0500568_0043000
903 Ga0500573_0013689
904 Ga0500627_0085685
905 Ga0590071_051639
906 Ga0590074_002898
907 Ga0590075_001597
908 Ga0590077_013957
909 Ga0587093_013249
910 Ga0587070_012594
911 Ga0587077_007424
912 Ga0587077_062247
913 Ga0587083_0014617
914 Ga0587076_055699
915 Ga0501082_0784681
916 Ga0530510_0329770
917 2644009204
918 2644643926
919 2644681821
920 2802655269
921 2883356692
922 2919194231
923 2919511836
924 2919684604
925 2965321933
926 2977272065
927 8007379637
928 8054311439
929 8055423572
930 8055595074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

113

187

0.98

PF00347

Ribosomal_L6

Ribosomal protein L6

23

105

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgk-assembly1.cif.gz_g lincomycin and avilamycin bound to the 50s subunit 0.9271 2 154
8ceu-assembly1.cif.gz_g retapamulin and capreomycin bound to the 50s subunit 0.9255 2 154
6xyw-assembly1.cif.gz_Af structure of the plant mitochondrial ribosome 0.9231 64 159
6v3b-assembly1.cif.gz_G cryo-em structure of the acinetobacter baumannii ribosome: 70s in empty state 0.9175 2 154
8cvm-assembly1.cif.gz_g cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9156 2 157
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9737 66 157 3.90.930.12
af_Q25814_82_167_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9631 66 147 3.90.930.12
af_Q09865_118_210_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9622 66 155 3.90.930.12
2awbG02 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.96 66 157 3.90.930.12
af_Q6AU10_7_103_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9545 68 161 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A1Q3BQV3-F1-model_v4 Ribosomal_L6 domain-containing protein 0.985 66 159 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G1Y946-F1-model_v4 50S ribosomal protein L6 0.9846 64 159 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A382BX83-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9836 51 159 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2J1D431-F1-model_v4 deleted 0.981 57 150
AF-A0A438WPT2-F1-model_v4 50S ribosomal protein L6 0.9805 68 161 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Map