F449302

General Info

Members Datasets Scaffolds Average Seq Length
464 253 463 147

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10400724|Ga0207710_104007241
Length 173
Sequence MAGFWFAEEQGGRIIDSRNSSGFSFPKDAMKKFTIAIGSDHAGFAYKEKIKAMLLAEGHTVRDFGTYSSESCDYPDFIRPTAEAVARGEYERGIVLGGSGNGEAIVANKVKGVRCGLCWTEQVAIWNRSHNDGNVLSLGERTVTEAEALKIVKVWLATEFEGGRHIARIKKIE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
144 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
186 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.43
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.72
Nodule 0
Rhizoplane 1.08
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1762107 2162886007 Bacteria 1307
2 JGI24033J26618_1006702 3300002155 Unclassified 1298
3 JGI24033J26618_1053951 3300002155 Unclassified 581
4 rootH2_10029067 3300003320 Bacteria 17237
5 rootH2_10040240 3300003320 Bacteria 3169
6 rootH2_10185574 3300003320 Bacteria 1421
7 rootH1_10019491 3300003323 Bacteria 4590
8 Ga0065707_10007018 3300005295 Bacteria 7519
9 Ga0065707_10485469 3300005295 Bacteria 770
10 Ga0070658_10072037 3300005327 Unclassified 2831
11 Ga0070676_10100802 3300005328 Bacteria 1783
12 Ga0070683_100002305 3300005329 Bacteria 15135
13 Ga0070690_100433218 3300005330 Bacteria 972
14 Ga0070670_100165785 3300005331 Bacteria 1915
15 Ga0070670_100409155 3300005331 Bacteria 1198
16 Ga0070670_100635323 3300005331 Bacteria 957
17 Ga0070670_100802346 3300005331 Bacteria 850
18 Ga0070677_10070207 3300005333 Bacteria 1471
19 Ga0068869_100000990 3300005334 Bacteria 16480
20 Ga0068869_100588313 3300005334 Unclassified 939
21 Ga0070680_100610175 3300005336 Bacteria 937
22 Ga0068868_100047554 3300005338 Bacteria 3363
23 Ga0068868_100282098 3300005338 Bacteria 1406
24 Ga0068868_100883431 3300005338 Bacteria 811
25 Ga0070689_100038225 3300005340 Bacteria 3671
26 Ga0070689_100193595 3300005340 Bacteria 1656
27 Ga0070687_100223505 3300005343 Bacteria 1155
28 Ga0070661_100546344 3300005344 Bacteria 932
29 Ga0070668_100068999 3300005347 Bacteria 2749
30 Ga0070668_100154817 3300005347 Bacteria 1856
31 Ga0070668_100187717 3300005347 Bacteria 1691
32 Ga0070668_100270662 3300005347 Bacteria 1416
33 Ga0070668_101799920 3300005347 Bacteria 563
34 Ga0070669_100004519 3300005353 Bacteria 10038
35 Ga0070669_100313868 3300005353 Bacteria 1264
36 Ga0070669_101041450 3300005353 Bacteria 703
37 Ga0070675_100000181 3300005354 Bacteria 39301
38 Ga0070671_100029429 3300005355 Bacteria 4528
39 Ga0070673_100081882 3300005364 Bacteria 2618
40 Ga0070688_100316924 3300005365 Bacteria 1132
41 Ga0070688_100360482 3300005365 Bacteria 1067
42 Ga0070659_100726441 3300005366 Bacteria 860
43 Ga0070667_100009378 3300005367 Bacteria 8116
44 Ga0070667_100589130 3300005367 Bacteria 1024
45 Ga0070703_10059897 3300005406 Bacteria 1243
46 Ga0070703_10242806 3300005406 Bacteria 727
47 Ga0070701_10001595 3300005438 Bacteria 8444
48 Ga0070701_10117140 3300005438 Unclassified 1496
49 Ga0070705_100000678 3300005440 Bacteria 19512
50 Ga0070705_100043383 3300005440 Bacteria 2577
51 Ga0070705_100105341 3300005440 Bacteria 1790
52 Ga0070705_100187384 3300005440 Bacteria 1407
53 Ga0070700_100161735 3300005441 Bacteria 1542
54 Ga0070694_100005674 3300005444 Bacteria 7565
55 Ga0070694_100008878 3300005444 Bacteria 6158
56 Ga0070694_100146611 3300005444 Bacteria 1720
57 Ga0070708_100019628 3300005445 Bacteria 5684
58 Ga0070708_100455521 3300005445 Bacteria 1207
59 Ga0070663_100248414 3300005455 Unclassified 1407
60 Ga0070678_100812593 3300005456 Bacteria 850
61 Ga0070678_100821400 3300005456 Bacteria 845
62 Ga0070662_100103013 3300005457 Bacteria 2163
63 Ga0068867_100002896 3300005459 Bacteria 12078
64 Ga0068867_100003331 3300005459 Bacteria 11312
65 Ga0068867_100579693 3300005459 Bacteria 975
66 Ga0068867_101020705 3300005459 Bacteria 751
67 Ga0070685_10088731 3300005466 Bacteria 1868
68 Ga0070706_100304568 3300005467 Unclassified 1486
69 Ga0070707_100075275 3300005468 Bacteria 3256
70 Ga0070707_100912712 3300005468 Bacteria 843
71 Ga0070707_100953097 3300005468 Bacteria 823
72 Ga0070698_100000806 3300005471 Bacteria 34225
73 Ga0070698_100031912 3300005471 Bacteria 5459
74 Ga0070698_100140744 3300005471 Bacteria 2364
75 Ga0070699_100000386 3300005518 Bacteria 42744
76 Ga0070699_100003664 3300005518 Bacteria 13610
77 Ga0070699_100003990 3300005518 Bacteria 13037
78 Ga0070699_100011888 3300005518 Bacteria 7514
79 Ga0070699_100022465 3300005518 Bacteria 5437
80 Ga0070699_100849200 3300005518 Bacteria 836
81 Ga0070684_100500149 3300005535 Bacteria 1126
82 Ga0070684_101856599 3300005535 Unclassified 569
83 Ga0070697_100322328 3300005536 Bacteria 1331
84 Ga0070686_100070379 3300005544 Bacteria 2287
85 Ga0070695_100000909 3300005545 Bacteria 15966
86 Ga0070696_100016590 3300005546 Bacteria 4964
87 Ga0070696_100022637 3300005546 Bacteria 4271
88 Ga0070696_100034686 3300005546 Bacteria 3472
89 Ga0070696_100411871 3300005546 Bacteria 1060
90 Ga0070696_100938698 3300005546 Unclassified 720
91 Ga0070704_100004914 3300005549 Bacteria 7759
92 Ga0070704_100076049 3300005549 Bacteria 2455
93 Ga0070704_100139024 3300005549 Bacteria 1894
94 Ga0068855_101234656 3300005563 Unclassified 776
95 Ga0068855_101247654 3300005563 Bacteria 771
96 Ga0070664_100023446 3300005564 Bacteria 5098
97 Ga0070664_100042642 3300005564 Bacteria 3830
98 Ga0068857_100078270 3300005577 Bacteria 2951
99 Ga0068857_100413582 3300005577 Bacteria 1256
100 Ga0068857_100909846 3300005577 Bacteria 844
101 Ga0068854_100371664 3300005578 Bacteria 1176
102 Ga0068856_100168233 3300005614 Bacteria 2203
103 Ga0068856_100315152 3300005614 Bacteria 1582
104 Ga0070702_100008937 3300005615 Bacteria 4877
105 Ga0070702_100046250 3300005615 Bacteria 2466
106 Ga0068859_100074718 3300005617 Bacteria 3428
107 Ga0068859_100297721 3300005617 Bacteria 1706
108 Ga0068864_100064368 3300005618 Bacteria 3180
109 Ga0068864_100178019 3300005618 Bacteria 1942
110 Ga0068864_100501709 3300005618 Bacteria 1167
111 Ga0068861_100144465 3300005719 Bacteria 1945
112 Ga0068870_10002602 3300005840 Bacteria 7545
113 Ga0068863_100076215 3300005841 Bacteria 3173
114 Ga0068863_100442626 3300005841 Bacteria 1274
115 Ga0068863_102441498 3300005841 Unclassified 532
116 Ga0068858_100085361 3300005842 Bacteria 2937
117 Ga0068858_100799402 3300005842 Bacteria 920
118 Ga0068858_100966786 3300005842 Bacteria 834
119 Ga0068860_100001005 3300005843 Bacteria 31230
120 Ga0068860_100097245 3300005843 Bacteria 2806
121 Ga0068862_100001000 3300005844 Bacteria 27052
122 Ga0068862_100030528 3300005844 Bacteria 4542
123 Ga0068862_100182050 3300005844 Bacteria 1886
124 Ga0068862_101170796 3300005844 Bacteria 766
125 Ga0081455_10354859 3300005937 Bacteria 1033
126 Ga0081540_1166155 3300005983 Unclassified 848
127 Ga0070717_10000018 3300006028 Bacteria 195516
128 Ga0070712_101144050 3300006175 Bacteria 676
129 Ga0068871_100006523 3300006358 Bacteria 8264
130 Ga0068871_100687258 3300006358 Bacteria 937
131 Ga0068871_101906774 3300006358 Bacteria 565
132 Ga0075428_100263206 3300006844 Bacteria 1856
133 Ga0075428_100530199 3300006844 Bacteria 1259
134 Ga0075433_10020413 3300006852 Bacteria 5538
135 Ga0075433_10037085 3300006852 Bacteria 4203
136 Ga0075434_101808000 3300006871 Bacteria 618
137 Ga0075429_100286270 3300006880 Bacteria 1443
138 Ga0075429_100310622 3300006880 Bacteria 1380
139 Ga0068865_100001254 3300006881 Bacteria 14757
140 Ga0068865_100700689 3300006881 Bacteria 865
141 Ga0097620_100074716 3300006931 Bacteria 3428
142 Ga0097620_100297731 3300006931 Bacteria 1706
143 Ga0075435_100008477 3300007076 Bacteria 7377
144 Ga0075435_100106639 3300007076 Bacteria 2327
145 Ga0075435_100144609 3300007076 Bacteria 1997
146 Ga0075435_100250097 3300007076 Bacteria 1509
147 Ga0105240_11220071 3300009093 Bacteria 796
148 Ga0111539_10089342 3300009094 Bacteria 3620
149 Ga0111539_11969797 3300009094 Bacteria 677
150 Ga0105245_10686716 3300009098 Bacteria 1056
151 Ga0105247_10269164 3300009101 Bacteria 1171
152 Ga0105247_10484544 3300009101 Bacteria 898
153 Ga0114129_10003827 3300009147 Bacteria 21202
154 Ga0114129_10013194 3300009147 Bacteria 11772
155 Ga0114129_10150733 3300009147 Bacteria 3182
156 Ga0114129_10945514 3300009147 Bacteria 1089
157 Ga0105243_10068457 3300009148 Bacteria 2861
158 Ga0105243_10773780 3300009148 Bacteria 943
159 Ga0105242_10153569 3300009176 Bacteria 2009
160 Ga0105238_10429360 3300009551 Bacteria 1317
161 Ga0105249_10004359 3300009553 Bacteria 12241
162 Ga0105249_10268999 3300009553 Bacteria 1697
163 Ga0105246_10078489 3300011119 Bacteria 2345
164 Ga0105246_10239977 3300011119 Bacteria 1432
165 Ga0157369_10300523 3300013105 Unclassified 1670
166 Ga0157374_10202920 3300013296 Bacteria 1942
167 Ga0157378_10265523 3300013297 Bacteria 1648
168 Ga0157378_11137592 3300013297 Bacteria 819
169 Ga0163162_10069181 3300013306 Unclassified 3582
170 Ga0163162_10129106 3300013306 Bacteria 2636
171 Ga0157372_10826413 3300013307 Unclassified 1076
172 Ga0157372_12036560 3300013307 Bacteria 660
173 Ga0157375_10370047 3300013308 Bacteria 1599
174 Ga0157375_10465390 3300013308 Bacteria 1430
175 Ga0163163_10284886 3300014325 Bacteria 1704
176 Ga0163163_11679082 3300014325 Bacteria 696
177 Ga0157380_10159942 3300014326 Bacteria 1956
178 Ga0157380_10301019 3300014326 Bacteria 1477
179 Ga0157377_10019868 3300014745 Unclassified 3513
180 Ga0157377_10150634 3300014745 Bacteria 1438
181 Ga0157377_10201771 3300014745 Bacteria 1263
182 Ga0157376_10283038 3300014969 Bacteria 1562
183 Ga0207697_10174231 3300025315 Bacteria 941
184 Ga0207682_10039118 3300025893 Bacteria 1927
185 Ga0207710_10400724 3300025900 Bacteria 704
186 Ga0207645_10075164 3300025907 Bacteria 2163
187 Ga0207643_10005891 3300025908 Bacteria 6547
188 Ga0207684_10253112 3300025910 Bacteria 1519
189 Ga0207662_10018970 3300025918 Bacteria 3908
190 Ga0207649_11133921 3300025920 Bacteria 617
191 Ga0207646_10178988 3300025922 Bacteria 1915
192 Ga0207646_10920305 3300025922 Bacteria 775
193 Ga0207646_11225919 3300025922 Bacteria 657
194 Ga0207681_10026186 3300025923 Bacteria 3759
195 Ga0207681_11352120 3300025923 Bacteria 598
196 Ga0207694_10531849 3300025924 Bacteria 986
197 Ga0207650_10171570 3300025925 Bacteria 1724
198 Ga0207650_10182202 3300025925 Bacteria 1674
199 Ga0207650_10559013 3300025925 Bacteria 960
200 Ga0207659_10000547 3300025926 Bacteria 22456
201 Ga0207659_10043663 3300025926 Bacteria 3150
202 Ga0207700_10068240 3300025928 Bacteria 2725
203 Ga0207644_10034016 3300025931 Bacteria 3566
204 Ga0207690_10377543 3300025932 Bacteria 1126
205 Ga0207706_10096058 3300025933 Bacteria 2606
206 Ga0207686_10164422 3300025934 Bacteria 1559
207 Ga0207709_10043209 3300025935 Bacteria 2715
208 Ga0207709_10115700 3300025935 Bacteria 1802
209 Ga0207670_10016750 3300025936 Bacteria 4414
210 Ga0207704_10004201 3300025938 Bacteria 6580
211 Ga0207691_10468830 3300025940 Bacteria 1071
212 Ga0207689_10001509 3300025942 Bacteria 22149
213 Ga0207661_10023392 3300025944 Bacteria 4668
214 Ga0207661_10576545 3300025944 Bacteria 1032
215 Ga0207679_10187722 3300025945 Bacteria 1715
216 Ga0207679_10229665 3300025945 Bacteria 1566
217 Ga0207679_11879952 3300025945 Unclassified 546
218 Ga0207667_10994341 3300025949 Unclassified 826
219 Ga0207651_10053564 3300025960 Bacteria 2759
220 Ga0207712_10007793 3300025961 Bacteria 6771
221 Ga0207712_10097089 3300025961 Bacteria 2182
222 Ga0207668_10105700 3300025972 Bacteria 2102
223 Ga0207668_10136966 3300025972 Bacteria 1877
224 Ga0207668_10295090 3300025972 Bacteria 1335
225 Ga0207640_10102545 3300025981 Bacteria 2010
226 Ga0207658_10044973 3300025986 Bacteria 3216
227 Ga0207677_10217509 3300026023 Bacteria 1530
228 Ga0207677_10870712 3300026023 Bacteria 811
229 Ga0207703_10005183 3300026035 Bacteria 10532
230 Ga0207703_10349735 3300026035 Bacteria 1360
231 Ga0207703_11236875 3300026035 Bacteria 718
232 Ga0207639_11255499 3300026041 Bacteria 695
233 Ga0207678_10348990 3300026067 Bacteria 1276
234 Ga0207708_10023096 3300026075 Bacteria 4698
235 Ga0207708_10165660 3300026075 Bacteria 1747
236 Ga0207702_10000570 3300026078 Bacteria 40941
237 Ga0207702_10746273 3300026078 Bacteria 966
238 Ga0207641_10055208 3300026088 Bacteria 3373
239 Ga0207641_10138303 3300026088 Bacteria 2194
240 Ga0207641_10554353 3300026088 Bacteria 1121
241 Ga0207641_10887787 3300026088 Unclassified 885
242 Ga0207648_10001255 3300026089 Bacteria 28363
243 Ga0207648_10010294 3300026089 Bacteria 8881
244 Ga0207648_11535799 3300026089 Bacteria 626
245 Ga0207676_10006765 3300026095 Bacteria 8116
246 Ga0207674_10035135 3300026116 Bacteria 5232
247 Ga0207674_10150335 3300026116 Bacteria 2286
248 Ga0207674_10923862 3300026116 Bacteria 841
249 Ga0207675_100176062 3300026118 Bacteria 2047
250 Ga0207675_100180249 3300026118 Bacteria 2022
251 Ga0207683_10903898 3300026121 Bacteria 820
252 Ga0207428_10000442 3300027907 Bacteria 50837
253 Ga0268265_10000237 3300028380 Bacteria 62935
254 Ga0268265_10006020 3300028380 Bacteria 8253
255 Ga0268265_10009694 3300028380 Bacteria 6500
256 Ga0268264_10000014 3300028381 Bacteria 509962
257 Ga0268264_10014068 3300028381 Bacteria 6577
258 Ga0265319_1000236 3300028563 Bacteria 41417
259 Ga0265319_1001872 3300028563 Bacteria 11969
260 Ga0265334_10015684 3300028573 Bacteria 3144
261 Ga0265318_10000002 3300028577 Bacteria 428208
262 Ga0265318_10006684 3300028577 Bacteria 5282
263 Ga0265323_10000009 3300028653 Bacteria 115038
264 Ga0265323_10004141 3300028653 Bacteria 6285
265 Ga0265323_10053482 3300028653 Bacteria 1425
266 Ga0265322_10000126 3300028654 Bacteria 35415
267 Ga0265336_10027140 3300028666 Bacteria 1795
268 Ga0307515_10489978 3300028794 Bacteria 841
269 Ga0265338_10003982 3300028800 Bacteria 20330
270 Ga0265338_10038713 3300028800 Bacteria 4512
271 Ga0265324_10340166 3300029957 Bacteria 511
272 Ga0265330_10232538 3300031235 Bacteria 777
273 Ga0265332_10058932 3300031238 Bacteria 1644
274 Ga0265320_10002516 3300031240 Bacteria 12754
275 Ga0265320_10004698 3300031240 Bacteria 8899
276 Ga0265320_10008445 3300031240 Bacteria 6304
277 Ga0265320_10012108 3300031240 Bacteria 5038
278 Ga0265320_10017288 3300031240 Bacteria 4010
279 Ga0265320_10197699 3300031240 Bacteria 898
280 Ga0265325_10290057 3300031241 Bacteria 732
281 Ga0265340_10150868 3300031247 Bacteria 1059
282 Ga0265339_10113698 3300031249 Bacteria 1398
283 Ga0265339_10170060 3300031249 Bacteria 1091
284 Ga0265331_10006896 3300031250 Bacteria 6635
285 Ga0265331_10015743 3300031250 Bacteria 3986
286 Ga0265327_10001774 3300031251 Bacteria 25451
287 Ga0265327_10003306 3300031251 Bacteria 15611
288 Ga0265327_10009265 3300031251 Bacteria 7136
289 Ga0265316_10007367 3300031344 Bacteria 10368
290 Ga0265316_10357279 3300031344 Bacteria 1057
291 Ga0307513_10624225 3300031456 Bacteria 786
292 Ga0307509_10625616 3300031507 Bacteria 747
293 Ga0307408_100000007 3300031548 Bacteria 463086
294 Ga0307408_100000202 3300031548 Bacteria 64139
295 Ga0307408_100691430 3300031548 Bacteria 916
296 Ga0265313_10011239 3300031595 Bacteria 5579
297 Ga0265313_10011643 3300031595 Bacteria 5451
298 Ga0307508_10000024 3300031616 Bacteria 176806
299 Ga0265314_10000347 3300031711 Bacteria 64333
300 Ga0265314_10001196 3300031711 Bacteria 29804
301 Ga0265314_10015437 3300031711 Bacteria 6060
302 Ga0265314_10064431 3300031711 Bacteria 2481
303 Ga0265342_10008764 3300031712 Bacteria 7215
304 Ga0265342_10113785 3300031712 Bacteria 1529
305 Ga0265342_10283493 3300031712 Bacteria 876
306 Ga0307410_10000001 3300031852 Bacteria 162839
307 Ga0307406_10060831 3300031901 Bacteria 2437
308 Ga0307407_10000126 3300031903 Bacteria 23894
309 Ga0307407_10008237 3300031903 Bacteria 4773
310 Ga0307412_10256362 3300031911 Unclassified 1361
311 Ga0307409_100000047 3300031995 Bacteria 42868
312 Ga0307409_101536704 3300031995 Bacteria 693
313 Ga0307409_101840069 3300031995 Bacteria 635
314 Ga0307416_100000491 3300032002 Bacteria 20148
315 Ga0307416_102086826 3300032002 Bacteria 669
316 Ga0307416_103000850 3300032002 Bacteria 565
317 Ga0307414_10000015 3300032004 Bacteria 268602
318 Ga0307414_10436021 3300032004 Bacteria 1146
319 Ga0307414_10584489 3300032004 Bacteria 1000
320 Ga0373961_0024999 3300035241 Unclassified 1620
321 Ga0373931_0237082 3300035691 Bacteria 1104
322 Ga0373937_0003104 3300036401 Bacteria 13890
323 Ga0316582_0755292 3300036647 Unclassified 667
324 Ga0373925_0143239 3300037068 Bacteria 1872
325 Ga0395900_0386813 3300037418 Bacteria 1366
326 Ga0395898_0839957 3300037466 Bacteria 858
327 Ga0395905_0000250 3300037471 Bacteria 80488
328 Ga0395905_0122906 3300037471 Bacteria 2441
329 Ga0451798_0619948 3300041458 Bacteria 742
330 Ga0451798_0820324 3300041458 Bacteria 582
331 Ga0451802_1359371 3300041460 Bacteria 775
332 Ga0439441_024066 3300042001 Bacteria 1141
333 Ga0439443_012037 3300042003 Bacteria 1276
334 Ga0450889_001778 3300042144 Bacteria 2181
335 Ga0439444_0021786 3300042437 Bacteria 1137
336 Ga0450893_0068201 3300042532 Bacteria 688
337 Ga0451577_0001734 3300042876 Bacteria 28104
338 Ga0451577_0003927 3300042876 Bacteria 16059
339 Ga0451577_0052689 3300042876 Bacteria 3633
340 Ga0451577_0083198 3300042876 Bacteria 2855
341 Ga0451577_0128151 3300042876 Bacteria 2275
342 Ga0451577_0132753 3300042876 Bacteria 2234
343 Ga0451577_0133949 3300042876 Bacteria 2224
344 Ga0451577_0217764 3300042876 Bacteria 1726
345 Ga0451577_0429967 3300042876 Bacteria 1199
346 Ga0451577_0546455 3300042876 Bacteria 1052
347 Ga0451577_0639721 3300042876 Bacteria 965
348 Ga0451577_1014336 3300042876 Bacteria 745
349 Ga0453683_0227070 3300044673 Bacteria 1188
350 Ga0453684_0000001 3300044712 Bacteria 2623166
351 Ga0453684_0003627 3300044712 Bacteria 34381
352 Ga0453684_0023793 3300044712 Bacteria 8994
353 Ga0453684_0127630 3300044712 Bacteria 3058
354 Ga0453684_0131634 3300044712 Bacteria 3000
355 Ga0453684_0213852 3300044712 Bacteria 2239
356 Ga0453684_0284260 3300044712 Bacteria 1885
357 Ga0453684_0463823 3300044712 Bacteria 1408
358 Ga0466971_0059574 3300044719 Bacteria 1725
359 Ga0466968_0124338 3300044735 Bacteria 1169
360 Ga0466959_0190548 3300045049 Bacteria 1431
361 Ga0451576_0004400 3300045051 Bacteria 18338
362 Ga0451576_0007351 3300045051 Bacteria 13202
363 Ga0451576_0011115 3300045051 Bacteria 10269
364 Ga0451576_0013420 3300045051 Bacteria 9166
365 Ga0451576_0073060 3300045051 Bacteria 3569
366 Ga0451576_0157191 3300045051 Bacteria 2372
367 Ga0451576_0868603 3300045051 Bacteria 947
368 Ga0495603_0011367 3300046455 Bacteria 5391
369 Ga0495629_0001579 3300046459 Bacteria 17918
370 Ga0495641_0363582 3300046461 Bacteria 655
371 Ga0495580_0079114 3300046472 Bacteria 2293
372 Ga0495584_0470221 3300046491 Bacteria 640
373 Ga0495594_0171652 3300046499 Bacteria 1234
374 Ga0495594_0435383 3300046499 Bacteria 746
375 Ga0495594_0891942 3300046499 Bacteria 500
376 Ga0495665_0129672 3300046531 Bacteria 1320
377 Ga0495665_0187527 3300046531 Bacteria 1074
378 Ga0495586_0459667 3300046535 Bacteria 734
379 Ga0495598_0270567 3300046537 Unclassified 635
380 Ga0495621_0049056 3300046539 Bacteria 1505
381 Ga0495645_0096630 3300046543 Bacteria 2105
382 Ga0495633_0039253 3300046558 Bacteria 2260
383 Ga0495659_0011871 3300046664 Bacteria 2810
384 Ga0495659_0028086 3300046664 Bacteria 1945
385 Ga0495659_0110114 3300046664 Bacteria 1075
386 Ga0495659_0166900 3300046664 Bacteria 891
387 Ga0495659_0207431 3300046664 Bacteria 805
388 Ga0495588_0008825 3300046674 Bacteria 4635
389 Ga0495658_0197660 3300046683 Bacteria 1252
390 Ga0495669_0009773 3300046684 Bacteria 4050
391 Ga0495613_0805116 3300046689 Bacteria 613
392 Ga0495670_0051573 3300046691 Bacteria 2059
393 Ga0495674_0200258 3300047319 Bacteria 1657
394 Ga0495672_0161235 3300047320 Bacteria 1153
395 Ga0496104_0869199 3300048907 Bacteria 807
396 Ga0496106_0184806 3300048909 Bacteria 1656
397 Ga0496121_0062301 3300048924 Bacteria 3056
398 Ga0496121_0351775 3300048924 Bacteria 981
399 Ga0501305_086862 3300049161 Bacteria 568
400 Ga0501307_028623 3300049162 Bacteria 763
401 Ga0501031_0009285 3300049568 Bacteria 6391
402 Ga0501032_0000212 3300049569 Bacteria 48284
403 Ga0501032_0000818 3300049569 Bacteria 25273
404 Ga0501032_0027511 3300049569 Bacteria 3907
405 Ga0501033_0002912 3300049570 Bacteria 14318
406 Ga0501033_0048573 3300049570 Bacteria 3151
407 Ga0501034_0083726 3300049571 Bacteria 3191
408 Ga0501034_0084052 3300049571 Bacteria 3185
409 Ga0501036_0000088 3300049572 Bacteria 57888
410 Ga0501036_0394764 3300049572 Unclassified 1154
411 Ga0501037_0023715 3300049573 Bacteria 4535
412 Ga0501037_0070245 3300049573 Bacteria 2548
413 Ga0501038_0004370 3300049574 Bacteria 13146
414 Ga0501039_0060685 3300049575 Bacteria 2928
415 Ga0501039_0565739 3300049575 Bacteria 892
416 Ga0501042_0051240 3300049578 Bacteria 2944
417 Ga0501043_0010519 3300049579 Bacteria 7244
418 Ga0501043_0953844 3300049579 Unclassified 613
419 Ga0501046_0001353 3300049580 Bacteria 23723
420 Ga0501046_0071179 3300049580 Unclassified 2702
421 Ga0501046_0090623 3300049580 Bacteria 2352
422 Ga0501046_0124044 3300049580 Bacteria 1963
423 Ga0501047_0046911 3300049581 Bacteria 4174
424 Ga0501047_0176365 3300049581 Unclassified 2004
425 Ga0501047_1289135 3300049581 Unclassified 544
426 Ga0501048_0066240 3300049582 Bacteria 2553
427 Ga0501048_0082688 3300049582 Bacteria 2265
428 Ga0501067_0208776 3300049583 Bacteria 1088
429 Ga0501068_0011578 3300049584 Bacteria 4983
430 Ga0501070_0307843 3300049586 Bacteria 1290
431 Ga0501071_1060995 3300049587 Bacteria 626
432 Ga0501243_002857 3300049675 Bacteria 2545
433 Ga0501083_0085844 3300049744 Bacteria 2082
434 Ga0501035_0000168 3300049822 Bacteria 80065
435 Ga0501035_0000269 3300049822 Bacteria 61583
436 Ga0501035_0237040 3300049822 Bacteria 1553
437 Ga0501044_0000025 3300049823 Bacteria 187867
438 Ga0501044_0019614 3300049823 Bacteria 7228
439 Ga0501044_0082557 3300049823 Bacteria 3251
440 Ga0501045_0084176 3300049824 Bacteria 2346
441 nmdc:mga05p37_1320346_c1 3300050507 Bacteria 734
442 nmdc:mga05p37_136606_c1 3300050507 Bacteria 3006
443 nmdc:mga05p37_2349_c1 3300050507 Bacteria 22009
444 nmdc:mga05p37_81478_c1 3300050507 Bacteria 3986
445 nmdc:mga09592_325233_c1 3300050508 Bacteria 1332
446 nmdc:mga08y16_106599_c1 3300050511 Bacteria 2917
447 nmdc:mga08y16_522_c1 3300050511 Bacteria 35470
448 nmdc:mga0n895_1955332_c1 3300050512 Bacteria 545
449 nmdc:mga0n895_271686_c1 3300050512 Bacteria 1720
450 nmdc:mga0rr50_12905_c1 3300050513 Bacteria 5418
451 nmdc:mga0rr50_200478_c1 3300050513 Bacteria 1640
452 nmdc:mga0rr50_227497_c1 3300050513 Bacteria 1542
453 nmdc:mga0a205_41288_c1 3300050515 Bacteria 4442
454 nmdc:mga0a205_81174_c1 3300050515 Bacteria 3133
455 nmdc:mga0a205_9085_c1 3300050515 Bacteria 9068
456 Ga0500562_000469 3300053108 Bacteria 9779
457 Ga0500595_112103 3300053119 Bacteria 775
458 Ga0500628_093647 3300053129 Bacteria 786
459 Ga0500568_0001546 3300053139 Bacteria 14621
460 Ga0500568_0043166 3300053139 Bacteria 1803
461 Ga0500588_0085313 3300053146 Bacteria 1064
462 Ga0500616_0005407 3300053153 Bacteria 8668
463 Ga0500622_0019299 3300053156 Bacteria 3621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100799402 Ga0068858_1007994022 139
2 3300013297 Ga0157378_10265523 Ga0157378_102655233 140
3 3300005331 Ga0070670_100409155 Ga0070670_1004091552 141
4 3300005331 Ga0070670_100635323 Ga0070670_1006353232 141
5 3300005347 Ga0070668_100068999 Ga0070668_1000689992 141
6 3300005347 Ga0070668_100187717 Ga0070668_1001877173 141
7 3300005365 Ga0070688_100316924 Ga0070688_1003169242 141
8 3300005367 Ga0070667_100009378 Ga0070667_1000093787 141
9 3300005617 Ga0068859_100074718 Ga0068859_1000747186 141
10 3300005843 Ga0068860_100001005 Ga0068860_10000100516 141
11 3300005844 Ga0068862_100030528 Ga0068862_1000305281 141
12 3300005844 Ga0068862_100182050 Ga0068862_1001820502 141
13 3300005844 Ga0068862_101170796 Ga0068862_1011707961 141
14 3300006931 Ga0097620_100074716 Ga0097620_1000747166 141
15 3300009101 Ga0105247_10269164 Ga0105247_102691642 141
16 3300009553 Ga0105249_10268999 Ga0105249_102689993 141
17 3300014325 Ga0163163_10284886 Ga0163163_102848862 141
18 3300025900 Ga0207710_10400724 Ga0207710_104007241 141
19 3300025925 Ga0207650_10182202 Ga0207650_101822022 141
20 3300025925 Ga0207650_10559013 Ga0207650_105590132 141
21 3300025961 Ga0207712_10097089 Ga0207712_100970893 141
22 3300025972 Ga0207668_10295090 Ga0207668_102950903 141
23 3300025986 Ga0207658_10044973 Ga0207658_100449731 141
24 3300026035 Ga0207703_10349735 Ga0207703_103497352 141
25 3300026118 Ga0207675_100176062 Ga0207675_1001760622 141
26 3300028380 Ga0268265_10006020 Ga0268265_100060205 141
27 3300028380 Ga0268265_10009694 Ga0268265_100096946 141
28 3300028381 Ga0268264_10000014 Ga0268264_10000014316 141
29 3300031548 Ga0307408_100691430 Ga0307408_1006914302 141
30 3300037418 Ga0395900_0386813 Ga0395900_0386813_197_631 141
31 3300037466 Ga0395898_0839957 Ga0395898_0839957_183_617 141
32 3300042876 Ga0451577_0639721 Ga0451577_0639721_91_525 141
33 3300044712 Ga0453684_0003627 Ga0453684_0003627_8985_9419 141
34 3300047320 Ga0495672_0161235 Ga0495672_0161235_431_865 141
35 3300048924 Ga0496121_0351775 Ga0496121_0351775_529_963 141
36 3300049161 Ga0501305_086862 Ga0501305_086862_35_475 141
37 3300053119 Ga0500595_112103 Ga0500595_112103_261_695 141
38 3300002155 JGI24033J26618_1006702 JGI24033J26618_10067022 142
39 3300002155 JGI24033J26618_1053951 JGI24033J26618_10539511 142
40 3300003320 rootH2_10029067 rootH2_1002906715 142
41 3300003320 rootH2_10040240 rootH2_100402403 142
42 3300003320 rootH2_10185574 rootH2_101855741 142
43 3300005329 Ga0070683_100002305 Ga0070683_10000230515 142
44 3300005334 Ga0068869_100000990 Ga0068869_10000099015 142
45 3300005338 Ga0068868_100047554 Ga0068868_1000475544 142
46 3300005338 Ga0068868_100282098 Ga0068868_1002820983 142
47 3300005338 Ga0068868_100883431 Ga0068868_1008834311 142
48 3300005365 Ga0070688_100360482 Ga0070688_1003604822 142
49 3300005455 Ga0070663_100248414 Ga0070663_1002484142 142
50 3300005456 Ga0070678_100821400 Ga0070678_1008214001 142
51 3300005459 Ga0068867_100002896 Ga0068867_1000028964 142
52 3300005535 Ga0070684_101856599 Ga0070684_1018565991 142
53 3300005563 Ga0068855_101234656 Ga0068855_1012346562 142
54 3300005564 Ga0070664_100042642 Ga0070664_1000426425 142
55 3300005614 Ga0068856_100168233 Ga0068856_1001682331 142
56 3300005614 Ga0068856_100315152 Ga0068856_1003151522 142
57 3300006175 Ga0070712_101144050 Ga0070712_1011440501 142
58 3300006358 Ga0068871_100006523 Ga0068871_1000065238 142
59 3300006881 Ga0068865_100001254 Ga0068865_1000012548 142
60 3300009551 Ga0105238_10429360 Ga0105238_104293602 142
61 3300013105 Ga0157369_10300523 Ga0157369_103005232 142
62 3300013307 Ga0157372_10826413 Ga0157372_108264132 142
63 3300014969 Ga0157376_10283038 Ga0157376_102830382 142
64 3300025924 Ga0207694_10531849 Ga0207694_105318491 142
65 3300025938 Ga0207704_10004201 Ga0207704_100042013 142
66 3300025942 Ga0207689_10001509 Ga0207689_100015099 142
67 3300025944 Ga0207661_10023392 Ga0207661_100233922 142
68 3300025945 Ga0207679_10229665 Ga0207679_102296652 142
69 3300025949 Ga0207667_10994341 Ga0207667_109943412 142
70 3300026023 Ga0207677_10217509 Ga0207677_102175092 142
71 3300026023 Ga0207677_10870712 Ga0207677_108707121 142
72 3300026078 Ga0207702_10000570 Ga0207702_1000057037 142
73 3300026078 Ga0207702_10746273 Ga0207702_107462731 142
74 3300026089 Ga0207648_10010294 Ga0207648_100102946 142
75 3300026116 Ga0207674_10150335 Ga0207674_101503352 142
76 3300026121 Ga0207683_10903898 Ga0207683_109038981 142
77 3300028573 Ga0265334_10015684 Ga0265334_100156842 142
78 3300028577 Ga0265318_10000002 Ga0265318_10000002148 142
79 3300031240 Ga0265320_10012108 Ga0265320_100121084 142
80 3300031247 Ga0265340_10150868 Ga0265340_101508682 142
81 3300031249 Ga0265339_10170060 Ga0265339_101700601 142
82 3300031250 Ga0265331_10006896 Ga0265331_100068967 142
83 3300031250 Ga0265331_10015743 Ga0265331_100157434 142
84 3300031251 Ga0265327_10001774 Ga0265327_100017742 142
85 3300031507 Ga0307509_10625616 Ga0307509_106256162 142
86 3300031548 Ga0307408_100000007 Ga0307408_100000007198 142
87 3300031548 Ga0307408_100000202 Ga0307408_10000020252 142
88 3300031595 Ga0265313_10011239 Ga0265313_100112397 142
89 3300031595 Ga0265313_10011643 Ga0265313_100116433 142
90 3300031711 Ga0265314_10001196 Ga0265314_1000119610 142
91 3300031711 Ga0265314_10015437 Ga0265314_100154376 142
92 3300031712 Ga0265342_10113785 Ga0265342_101137852 142
93 3300031852 Ga0307410_10000001 Ga0307410_100000012 142
94 3300031901 Ga0307406_10060831 Ga0307406_100608313 142
95 3300031903 Ga0307407_10008237 Ga0307407_100082372 142
96 3300031995 Ga0307409_100000047 Ga0307409_10000004734 142
97 3300032002 Ga0307416_100000491 Ga0307416_1000004917 142
98 3300032002 Ga0307416_102086826 Ga0307416_1020868261 142
99 3300032004 Ga0307414_10000015 Ga0307414_10000015226 142
100 3300037471 Ga0395905_0000250 Ga0395905_0000250_10707_11156 142
101 3300037471 Ga0395905_0122906 Ga0395905_0122906_1493_1933 142
102 3300042001 Ga0439441_024066 Ga0439441_024066_232_669 142
103 3300042003 Ga0439443_012037 Ga0439443_012037_164_604 142
104 3300042144 Ga0450889_001778 Ga0450889_001778_756_1184 142
105 3300042437 Ga0439444_0021786 Ga0439444_0021786_410_850 142
106 3300042532 Ga0450893_0068201 Ga0450893_0068201_35_463 142
107 3300042876 Ga0451577_0001734 Ga0451577_0001734_11896_12333 142
108 3300042876 Ga0451577_0128151 Ga0451577_0128151_477_917 142
109 3300042876 Ga0451577_0132753 Ga0451577_0132753_1411_1848 142
110 3300042876 Ga0451577_0217764 Ga0451577_0217764_918_1355 142
111 3300042876 Ga0451577_1014336 Ga0451577_1014336_278_715 142
112 3300044673 Ga0453683_0227070 Ga0453683_0227070_119_559 142
113 3300044712 Ga0453684_0000001 Ga0453684_0000001_2286248_2286688 142
114 3300044712 Ga0453684_0131634 Ga0453684_0131634_1867_2304 142
115 3300044712 Ga0453684_0284260 Ga0453684_0284260_935_1447 142
116 3300044712 Ga0453684_0463823 Ga0453684_0463823_685_1122 142
117 3300045051 Ga0451576_0013420 Ga0451576_0013420_4986_5423 142
118 3300048924 Ga0496121_0062301 Ga0496121_0062301_1776_2204 142
119 3300049162 Ga0501307_028623 Ga0501307_028623_165_611 142
120 3300049575 Ga0501039_0565739 Ga0501039_0565739_405_833 142
121 3300049675 Ga0501243_002857 Ga0501243_002857_1849_2286 142
122 3300053139 Ga0500568_0001546 Ga0500568_0001546_1739_2176 142
123 3300053139 Ga0500568_0043166 Ga0500568_0043166_726_1154 142
124 3300053146 Ga0500588_0085313 Ga0500588_0085313_273_710 142
125 3300053153 Ga0500616_0005407 Ga0500616_0005407_1851_2279 142
126 3300053156 Ga0500622_0019299 Ga0500622_0019299_1655_2092 142
127 iso_pu_bacteria 2786546940 2788437223 142
128 3300003323 rootH1_10019491 rootH1_100194913 143
129 3300005327 Ga0070658_10072037 Ga0070658_100720373 143
130 3300005468 Ga0070707_100075275 Ga0070707_1000752752 143
131 3300005518 Ga0070699_100003990 Ga0070699_1000039907 143
132 3300005563 Ga0068855_101247654 Ga0068855_1012476542 143
133 3300005841 Ga0068863_102441498 Ga0068863_1024414981 143
134 3300006028 Ga0070717_10000018 Ga0070717_1000001831 143
135 3300014325 Ga0163163_11679082 Ga0163163_116790821 143
136 3300025922 Ga0207646_10178988 Ga0207646_101789883 143
137 3300025944 Ga0207661_10576545 Ga0207661_105765452 143
138 3300026088 Ga0207641_10887787 Ga0207641_108877871 143
139 3300026116 Ga0207674_10923862 Ga0207674_109238622 143
140 3300028563 Ga0265319_1000236 Ga0265319_100023615 143
141 3300028563 Ga0265319_1001872 Ga0265319_10018727 143
142 3300028577 Ga0265318_10006684 Ga0265318_100066842 143
143 3300028653 Ga0265323_10000009 Ga0265323_1000000910 143
144 3300028653 Ga0265323_10004141 Ga0265323_100041416 143
145 3300028653 Ga0265323_10053482 Ga0265323_100534822 143
146 3300028654 Ga0265322_10000126 Ga0265322_1000012610 143
147 3300028666 Ga0265336_10027140 Ga0265336_100271402 143
148 3300028794 Ga0307515_10489978 Ga0307515_104899782 143
149 3300028800 Ga0265338_10038713 Ga0265338_100387132 143
150 3300031235 Ga0265330_10232538 Ga0265330_102325382 143
151 3300031240 Ga0265320_10004698 Ga0265320_100046984 143
152 3300031240 Ga0265320_10008445 Ga0265320_100084453 143
153 3300031240 Ga0265320_10017288 Ga0265320_100172884 143
154 3300031241 Ga0265325_10290057 Ga0265325_102900572 143
155 3300031249 Ga0265339_10113698 Ga0265339_101136982 143
156 3300031251 Ga0265327_10003306 Ga0265327_1000330618 143
157 3300031344 Ga0265316_10007367 Ga0265316_100073674 143
158 3300031344 Ga0265316_10357279 Ga0265316_103572792 143
159 3300031711 Ga0265314_10000347 Ga0265314_1000034752 143
160 3300031711 Ga0265314_10064431 Ga0265314_100644313 143
161 3300031712 Ga0265342_10008764 Ga0265342_100087643 143
162 3300031712 Ga0265342_10283493 Ga0265342_102834931 143
163 3300031995 Ga0307409_101536704 Ga0307409_1015367042 143
164 3300031995 Ga0307409_101840069 Ga0307409_1018400691 143
165 3300032002 Ga0307416_103000850 Ga0307416_1030008502 143
166 3300032004 Ga0307414_10436021 Ga0307414_104360212 143
167 3300032004 Ga0307414_10584489 Ga0307414_105844892 143
168 3300041458 Ga0451798_0619948 Ga0451798_0619948_121_561 143
169 3300041458 Ga0451798_0820324 Ga0451798_0820324_126_557 143
170 3300041460 Ga0451802_1359371 Ga0451802_1359371_196_636 143
171 3300042876 Ga0451577_0052689 Ga0451577_0052689_151_591 143
172 3300042876 Ga0451577_0083198 Ga0451577_0083198_312_752 143
173 3300042876 Ga0451577_0429967 Ga0451577_0429967_333_773 143
174 3300044712 Ga0453684_0023793 Ga0453684_0023793_5591_6034 143
175 3300044712 Ga0453684_0127630 Ga0453684_0127630_2590_3030 143
176 3300044719 Ga0466971_0059574 Ga0466971_0059574_893_1333 143
177 3300044735 Ga0466968_0124338 Ga0466968_0124338_606_1052 143
178 3300045049 Ga0466959_0190548 Ga0466959_0190548_844_1287 143
179 3300045051 Ga0451576_0004400 Ga0451576_0004400_4154_4594 143
180 3300049569 Ga0501032_0000818 Ga0501032_0000818_584_1102 143
181 3300049569 Ga0501032_0027511 Ga0501032_0027511_1281_1766 143
182 3300049570 Ga0501033_0048573 Ga0501033_0048573_1238_1723 143
183 3300049571 Ga0501034_0084052 Ga0501034_0084052_2683_3123 143
184 3300049572 Ga0501036_0394764 Ga0501036_0394764_73_591 143
185 3300049573 Ga0501037_0070245 Ga0501037_0070245_659_1144 143
186 3300049579 Ga0501043_0953844 Ga0501043_0953844_64_504 143
187 3300049580 Ga0501046_0001353 Ga0501046_0001353_21700_22185 143
188 3300049580 Ga0501046_0071179 Ga0501046_0071179_1398_1916 143
189 3300049580 Ga0501046_0090623 Ga0501046_0090623_17_457 143
190 3300049581 Ga0501047_0046911 Ga0501047_0046911_3640_4125 143
191 3300049581 Ga0501047_0176365 Ga0501047_0176365_1520_1960 143
192 3300049581 Ga0501047_1289135 Ga0501047_1289135_45_485 143
193 3300049582 Ga0501048_0082688 Ga0501048_0082688_814_1299 143
194 3300049586 Ga0501070_0307843 Ga0501070_0307843_583_1026 143
195 3300049744 Ga0501083_0085844 Ga0501083_0085844_1473_1913 143
196 3300049822 Ga0501035_0000168 Ga0501035_0000168_16264_16782 143
197 3300049822 Ga0501035_0237040 Ga0501035_0237040_534_977 143
198 3300049823 Ga0501044_0000025 Ga0501044_0000025_118642_119160 143
199 3300049823 Ga0501044_0019614 Ga0501044_0019614_3921_4406 143
200 3300053129 Ga0500628_093647 Ga0500628_093647_108_548 143
201 3300005331 Ga0070670_100802346 Ga0070670_1008023461 144
202 3300005577 Ga0068857_100909846 Ga0068857_1009098462 144
203 3300006881 Ga0068865_100700689 Ga0068865_1007006892 144
204 3300028800 Ga0265338_10003982 Ga0265338_100039823 144
205 3300029957 Ga0265324_10340166 Ga0265324_103401661 144
206 3300031238 Ga0265332_10058932 Ga0265332_100589322 144
207 3300031240 Ga0265320_10002516 Ga0265320_1000251612 144
208 3300031240 Ga0265320_10197699 Ga0265320_101976992 144
209 3300031251 Ga0265327_10009265 Ga0265327_100092659 144
210 3300031456 Ga0307513_10624225 Ga0307513_106242252 144
211 3300031616 Ga0307508_10000024 Ga0307508_10000024112 144
212 3300031903 Ga0307407_10000126 Ga0307407_1000012611 144
213 3300031911 Ga0307412_10256362 Ga0307412_102563623 144
214 3300036647 Ga0316582_0755292 Ga0316582_0755292_15_449 144
215 3300042876 Ga0451577_0546455 Ga0451577_0546455_555_1001 144
216 3300045051 Ga0451576_0007351 Ga0451576_0007351_5922_6368 144
217 3300045051 Ga0451576_0011115 Ga0451576_0011115_3021_3467 144
218 3300046499 Ga0495594_0891942 Ga0495594_0891942_20_472 144
219 3300047319 Ga0495674_0200258 Ga0495674_0200258_485_928 144
220 3300049568 Ga0501031_0009285 Ga0501031_0009285_1066_1509 144
221 3300049569 Ga0501032_0000212 Ga0501032_0000212_313_756 144
222 3300049570 Ga0501033_0002912 Ga0501033_0002912_3323_3766 144
223 3300049571 Ga0501034_0083726 Ga0501034_0083726_1994_2437 144
224 3300049572 Ga0501036_0000088 Ga0501036_0000088_956_1399 144
225 3300049573 Ga0501037_0023715 Ga0501037_0023715_2936_3379 144
226 3300049574 Ga0501038_0004370 Ga0501038_0004370_288_731 144
227 3300049575 Ga0501039_0060685 Ga0501039_0060685_1984_2427 144
228 3300049578 Ga0501042_0051240 Ga0501042_0051240_504_947 144
229 3300049579 Ga0501043_0010519 Ga0501043_0010519_4178_4621 144
230 3300049580 Ga0501046_0124044 Ga0501046_0124044_1158_1601 144
231 3300049582 Ga0501048_0066240 Ga0501048_0066240_130_573 144
232 3300049584 Ga0501068_0011578 Ga0501068_0011578_1254_1697 144
233 3300049822 Ga0501035_0000269 Ga0501035_0000269_4495_4938 144
234 3300049823 Ga0501044_0082557 Ga0501044_0082557_2448_2891 144
235 3300049824 Ga0501045_0084176 Ga0501045_0084176_23_466 144
236 3300053108 Ga0500562_000469 Ga0500562_000469_3553_3993 144
237 2162886007 SwRhRL2b_contig_1762107 SwRhRL2b_0216.00002630 145
238 3300005295 Ga0065707_10007018 Ga0065707_100070189 145
239 3300005295 Ga0065707_10485469 Ga0065707_104854692 145
240 3300005328 Ga0070676_10100802 Ga0070676_101008022 145
241 3300005330 Ga0070690_100433218 Ga0070690_1004332181 145
242 3300005331 Ga0070670_100165785 Ga0070670_1001657852 145
243 3300005333 Ga0070677_10070207 Ga0070677_100702072 145
244 3300005334 Ga0068869_100588313 Ga0068869_1005883132 145
245 3300005336 Ga0070680_100610175 Ga0070680_1006101752 145
246 3300005340 Ga0070689_100038225 Ga0070689_1000382254 145
247 3300005340 Ga0070689_100193595 Ga0070689_1001935952 145
248 3300005343 Ga0070687_100223505 Ga0070687_1002235052 145
249 3300005344 Ga0070661_100546344 Ga0070661_1005463442 145
250 3300005347 Ga0070668_100154817 Ga0070668_1001548172 145
251 3300005347 Ga0070668_100270662 Ga0070668_1002706622 145
252 3300005347 Ga0070668_101799920 Ga0070668_1017999201 145
253 3300005353 Ga0070669_100004519 Ga0070669_1000045192 145
254 3300005353 Ga0070669_100313868 Ga0070669_1003138682 145
255 3300005353 Ga0070669_101041450 Ga0070669_1010414501 145
256 3300005354 Ga0070675_100000181 Ga0070675_10000018125 145
257 3300005355 Ga0070671_100029429 Ga0070671_1000294294 145
258 3300005364 Ga0070673_100081882 Ga0070673_1000818822 145
259 3300005366 Ga0070659_100726441 Ga0070659_1007264412 145
260 3300005367 Ga0070667_100589130 Ga0070667_1005891302 145
261 3300005406 Ga0070703_10059897 Ga0070703_100598972 145
262 3300005406 Ga0070703_10242806 Ga0070703_102428062 145
263 3300005438 Ga0070701_10001595 Ga0070701_1000159510 145
264 3300005438 Ga0070701_10117140 Ga0070701_101171402 145
265 3300005440 Ga0070705_100000678 Ga0070705_1000006782 145
266 3300005440 Ga0070705_100043383 Ga0070705_1000433833 145
267 3300005440 Ga0070705_100105341 Ga0070705_1001053412 145
268 3300005440 Ga0070705_100187384 Ga0070705_1001873842 145
269 3300005441 Ga0070700_100161735 Ga0070700_1001617352 145
270 3300005444 Ga0070694_100005674 Ga0070694_1000056742 145
271 3300005444 Ga0070694_100008878 Ga0070694_1000088787 145
272 3300005444 Ga0070694_100146611 Ga0070694_1001466112 145
273 3300005445 Ga0070708_100019628 Ga0070708_1000196282 145
274 3300005445 Ga0070708_100455521 Ga0070708_1004555212 145
275 3300005456 Ga0070678_100812593 Ga0070678_1008125932 145
276 3300005457 Ga0070662_100103013 Ga0070662_1001030132 145
277 3300005459 Ga0068867_100003331 Ga0068867_1000033314 145
278 3300005459 Ga0068867_100579693 Ga0068867_1005796932 145
279 3300005459 Ga0068867_101020705 Ga0068867_1010207052 145
280 3300005466 Ga0070685_10088731 Ga0070685_100887312 145
281 3300005467 Ga0070706_100304568 Ga0070706_1003045682 145
282 3300005468 Ga0070707_100912712 Ga0070707_1009127121 145
283 3300005468 Ga0070707_100953097 Ga0070707_1009530971 145
284 3300005471 Ga0070698_100000806 Ga0070698_10000080622 145
285 3300005471 Ga0070698_100031912 Ga0070698_1000319123 145
286 3300005471 Ga0070698_100140744 Ga0070698_1001407442 145
287 3300005518 Ga0070699_100000386 Ga0070699_1000003863 145
288 3300005518 Ga0070699_100003664 Ga0070699_10000366411 145
289 3300005518 Ga0070699_100011888 Ga0070699_1000118887 145
290 3300005518 Ga0070699_100022465 Ga0070699_1000224653 145
291 3300005518 Ga0070699_100849200 Ga0070699_1008492002 145
292 3300005535 Ga0070684_100500149 Ga0070684_1005001492 145
293 3300005536 Ga0070697_100322328 Ga0070697_1003223282 145
294 3300005544 Ga0070686_100070379 Ga0070686_1000703792 145
295 3300005545 Ga0070695_100000909 Ga0070695_10000090916 145
296 3300005546 Ga0070696_100016590 Ga0070696_1000165903 145
297 3300005546 Ga0070696_100022637 Ga0070696_1000226375 145
298 3300005546 Ga0070696_100034686 Ga0070696_1000346863 145
299 3300005546 Ga0070696_100411871 Ga0070696_1004118712 145
300 3300005546 Ga0070696_100938698 Ga0070696_1009386981 145
301 3300005549 Ga0070704_100004914 Ga0070704_1000049148 145
302 3300005549 Ga0070704_100076049 Ga0070704_1000760492 145
303 3300005549 Ga0070704_100139024 Ga0070704_1001390242 145
304 3300005564 Ga0070664_100023446 Ga0070664_1000234466 145
305 3300005577 Ga0068857_100078270 Ga0068857_1000782703 145
306 3300005577 Ga0068857_100413582 Ga0068857_1004135822 145
307 3300005578 Ga0068854_100371664 Ga0068854_1003716642 145
308 3300005615 Ga0070702_100008937 Ga0070702_1000089373 145
309 3300005615 Ga0070702_100046250 Ga0070702_1000462502 145
310 3300005617 Ga0068859_100297721 Ga0068859_1002977212 145
311 3300005618 Ga0068864_100064368 Ga0068864_1000643683 145
312 3300005618 Ga0068864_100178019 Ga0068864_1001780193 145
313 3300005618 Ga0068864_100501709 Ga0068864_1005017092 145
314 3300005719 Ga0068861_100144465 Ga0068861_1001444652 145
315 3300005840 Ga0068870_10002602 Ga0068870_100026028 145
316 3300005841 Ga0068863_100076215 Ga0068863_1000762154 145
317 3300005841 Ga0068863_100442626 Ga0068863_1004426262 145
318 3300005842 Ga0068858_100085361 Ga0068858_1000853613 145
319 3300005842 Ga0068858_100966786 Ga0068858_1009667861 145
320 3300005843 Ga0068860_100097245 Ga0068860_1000972453 145
321 3300005844 Ga0068862_100001000 Ga0068862_1000010002 145
322 3300005937 Ga0081455_10354859 Ga0081455_103548592 145
323 3300005983 Ga0081540_1166155 Ga0081540_11661552 145
324 3300006358 Ga0068871_100687258 Ga0068871_1006872581 145
325 3300006358 Ga0068871_101906774 Ga0068871_1019067742 145
326 3300006844 Ga0075428_100263206 Ga0075428_1002632062 145
327 3300006844 Ga0075428_100530199 Ga0075428_1005301992 145
328 3300006852 Ga0075433_10020413 Ga0075433_100204137 145
329 3300006852 Ga0075433_10037085 Ga0075433_100370853 145
330 3300006871 Ga0075434_101808000 Ga0075434_1018080002 145
331 3300006880 Ga0075429_100286270 Ga0075429_1002862702 145
332 3300006880 Ga0075429_100310622 Ga0075429_1003106221 145
333 3300006931 Ga0097620_100297731 Ga0097620_1002977312 145
334 3300007076 Ga0075435_100008477 Ga0075435_1000084775 145
335 3300007076 Ga0075435_100106639 Ga0075435_1001066393 145
336 3300007076 Ga0075435_100144609 Ga0075435_1001446092 145
337 3300007076 Ga0075435_100250097 Ga0075435_1002500972 145
338 3300009093 Ga0105240_11220071 Ga0105240_112200712 145
339 3300009094 Ga0111539_10089342 Ga0111539_100893424 145
340 3300009094 Ga0111539_11969797 Ga0111539_119697972 145
341 3300009098 Ga0105245_10686716 Ga0105245_106867162 145
342 3300009101 Ga0105247_10484544 Ga0105247_104845442 145
343 3300009147 Ga0114129_10003827 Ga0114129_1000382715 145
344 3300009147 Ga0114129_10013194 Ga0114129_100131948 145
345 3300009147 Ga0114129_10150733 Ga0114129_101507334 145
346 3300009147 Ga0114129_10945514 Ga0114129_109455141 145
347 3300009148 Ga0105243_10068457 Ga0105243_100684572 145
348 3300009148 Ga0105243_10773780 Ga0105243_107737802 145
349 3300009176 Ga0105242_10153569 Ga0105242_101535692 145
350 3300009553 Ga0105249_10004359 Ga0105249_100043595 145
351 3300011119 Ga0105246_10078489 Ga0105246_100784892 145
352 3300011119 Ga0105246_10239977 Ga0105246_102399772 145
353 3300013296 Ga0157374_10202920 Ga0157374_102029202 145
354 3300013297 Ga0157378_11137592 Ga0157378_111375922 145
355 3300013306 Ga0163162_10069181 Ga0163162_100691811 145
356 3300013306 Ga0163162_10129106 Ga0163162_101291062 145
357 3300013307 Ga0157372_12036560 Ga0157372_120365602 145
358 3300013308 Ga0157375_10370047 Ga0157375_103700472 145
359 3300013308 Ga0157375_10465390 Ga0157375_104653902 145
360 3300014326 Ga0157380_10159942 Ga0157380_101599422 145
361 3300014326 Ga0157380_10301019 Ga0157380_103010192 145
362 3300014745 Ga0157377_10019868 Ga0157377_100198684 145
363 3300014745 Ga0157377_10150634 Ga0157377_101506342 145
364 3300014745 Ga0157377_10201771 Ga0157377_102017711 145
365 3300025315 Ga0207697_10174231 Ga0207697_101742312 145
366 3300025893 Ga0207682_10039118 Ga0207682_100391182 145
367 3300025907 Ga0207645_10075164 Ga0207645_100751642 145
368 3300025908 Ga0207643_10005891 Ga0207643_100058912 145
369 3300025910 Ga0207684_10253112 Ga0207684_102531122 145
370 3300025918 Ga0207662_10018970 Ga0207662_100189702 145
371 3300025920 Ga0207649_11133921 Ga0207649_111339212 145
372 3300025922 Ga0207646_10920305 Ga0207646_109203052 145
373 3300025922 Ga0207646_11225919 Ga0207646_112259191 145
374 3300025923 Ga0207681_10026186 Ga0207681_100261863 145
375 3300025923 Ga0207681_11352120 Ga0207681_113521201 145
376 3300025925 Ga0207650_10171570 Ga0207650_101715703 145
377 3300025926 Ga0207659_10000547 Ga0207659_1000054716 145
378 3300025926 Ga0207659_10043663 Ga0207659_100436632 145
379 3300025928 Ga0207700_10068240 Ga0207700_100682403 145
380 3300025931 Ga0207644_10034016 Ga0207644_100340162 145
381 3300025932 Ga0207690_10377543 Ga0207690_103775432 145
382 3300025933 Ga0207706_10096058 Ga0207706_100960583 145
383 3300025934 Ga0207686_10164422 Ga0207686_101644222 145
384 3300025935 Ga0207709_10043209 Ga0207709_100432094 145
385 3300025935 Ga0207709_10115700 Ga0207709_101157002 145
386 3300025936 Ga0207670_10016750 Ga0207670_100167504 145
387 3300025940 Ga0207691_10468830 Ga0207691_104688302 145
388 3300025945 Ga0207679_10187722 Ga0207679_101877222 145
389 3300025945 Ga0207679_11879952 Ga0207679_118799521 145
390 3300025960 Ga0207651_10053564 Ga0207651_100535643 145
391 3300025961 Ga0207712_10007793 Ga0207712_100077935 145
392 3300025972 Ga0207668_10105700 Ga0207668_101057002 145
393 3300025972 Ga0207668_10136966 Ga0207668_101369662 145
394 3300025981 Ga0207640_10102545 Ga0207640_101025452 145
395 3300026035 Ga0207703_10005183 Ga0207703_1000518312 145
396 3300026035 Ga0207703_11236875 Ga0207703_112368751 145
397 3300026041 Ga0207639_11255499 Ga0207639_112554992 145
398 3300026067 Ga0207678_10348990 Ga0207678_103489902 145
399 3300026075 Ga0207708_10023096 Ga0207708_100230965 145
400 3300026075 Ga0207708_10165660 Ga0207708_101656602 145
401 3300026088 Ga0207641_10055208 Ga0207641_100552082 145
402 3300026088 Ga0207641_10138303 Ga0207641_101383033 145
403 3300026088 Ga0207641_10554353 Ga0207641_105543532 145
404 3300026089 Ga0207648_10001255 Ga0207648_1000125521 145
405 3300026089 Ga0207648_11535799 Ga0207648_115357992 145
406 3300026095 Ga0207676_10006765 Ga0207676_100067653 145
407 3300026116 Ga0207674_10035135 Ga0207674_100351351 145
408 3300026118 Ga0207675_100180249 Ga0207675_1001802492 145
409 3300027907 Ga0207428_10000442 Ga0207428_1000044219 145
410 3300028380 Ga0268265_10000237 Ga0268265_1000023728 145
411 3300028381 Ga0268264_10014068 Ga0268264_100140683 145
412 3300035241 Ga0373961_0024999 Ga0373961_0024999_850_1287 145
413 3300035691 Ga0373931_0237082 Ga0373931_0237082_366_803 145
414 3300036401 Ga0373937_0003104 Ga0373937_0003104_5047_5484 145
415 3300037068 Ga0373925_0143239 Ga0373925_0143239_599_1036 145
416 3300042876 Ga0451577_0003927 Ga0451577_0003927_2309_2776 145
417 3300042876 Ga0451577_0133949 Ga0451577_0133949_1332_1937 145
418 3300044712 Ga0453684_0213852 Ga0453684_0213852_1539_2006 145
419 3300045051 Ga0451576_0073060 Ga0451576_0073060_261_698 145
420 3300045051 Ga0451576_0157191 Ga0451576_0157191_370_807 145
421 3300045051 Ga0451576_0868603 Ga0451576_0868603_129_566 145
422 3300046455 Ga0495603_0011367 Ga0495603_0011367_2327_2764 145
423 3300046459 Ga0495629_0001579 Ga0495629_0001579_12440_12910 145
424 3300046461 Ga0495641_0363582 Ga0495641_0363582_102_572 145
425 3300046472 Ga0495580_0079114 Ga0495580_0079114_799_1236 145
426 3300046491 Ga0495584_0470221 Ga0495584_0470221_127_564 145
427 3300046499 Ga0495594_0171652 Ga0495594_0171652_100_537 145
428 3300046499 Ga0495594_0435383 Ga0495594_0435383_11_481 145
429 3300046531 Ga0495665_0129672 Ga0495665_0129672_807_1244 145
430 3300046531 Ga0495665_0187527 Ga0495665_0187527_338_775 145
431 3300046535 Ga0495586_0459667 Ga0495586_0459667_269_706 145
432 3300046537 Ga0495598_0270567 Ga0495598_0270567_53_490 145
433 3300046539 Ga0495621_0049056 Ga0495621_0049056_76_546 145
434 3300046543 Ga0495645_0096630 Ga0495645_0096630_1534_1971 145
435 3300046558 Ga0495633_0039253 Ga0495633_0039253_481_918 145
436 3300046664 Ga0495659_0011871 Ga0495659_0011871_880_1317 145
437 3300046664 Ga0495659_0028086 Ga0495659_0028086_369_806 145
438 3300046664 Ga0495659_0110114 Ga0495659_0110114_78_515 145
439 3300046664 Ga0495659_0166900 Ga0495659_0166900_113_550 145
440 3300046664 Ga0495659_0207431 Ga0495659_0207431_232_669 145
441 3300046674 Ga0495588_0008825 Ga0495588_0008825_1369_1806 145
442 3300046683 Ga0495658_0197660 Ga0495658_0197660_552_1022 145
443 3300046684 Ga0495669_0009773 Ga0495669_0009773_1560_1997 145
444 3300046689 Ga0495613_0805116 Ga0495613_0805116_59_496 145
445 3300046691 Ga0495670_0051573 Ga0495670_0051573_629_1066 145
446 3300048907 Ga0496104_0869199 Ga0496104_0869199_144_581 145
447 3300048909 Ga0496106_0184806 Ga0496106_0184806_411_848 145
448 3300049583 Ga0501067_0208776 Ga0501067_0208776_473_910 145
449 3300049587 Ga0501071_1060995 Ga0501071_1060995_66_503 145
450 3300050507 nmdc:mga05p37_1320346_c1 nmdc:mga05p37_1320346_c1_28_465 145
451 3300050507 nmdc:mga05p37_136606_c1 nmdc:mga05p37_136606_c1_1695_2132 145
452 3300050507 nmdc:mga05p37_2349_c1 nmdc:mga05p37_2349_c1_18713_19150 145
453 3300050507 nmdc:mga05p37_81478_c1 nmdc:mga05p37_81478_c1_1626_2108 145
454 3300050508 nmdc:mga09592_325233_c1 nmdc:mga09592_325233_c1_602_1039 145
455 3300050511 nmdc:mga08y16_106599_c1 nmdc:mga08y16_106599_c1_1120_1557 145
456 3300050511 nmdc:mga08y16_522_c1 nmdc:mga08y16_522_c1_13769_14206 145
457 3300050512 nmdc:mga0n895_1955332_c1 nmdc:mga0n895_1955332_c1_11_448 145
458 3300050512 nmdc:mga0n895_271686_c1 nmdc:mga0n895_271686_c1_1069_1551 145
459 3300050513 nmdc:mga0rr50_12905_c1 nmdc:mga0rr50_12905_c1_3533_3970 145
460 3300050513 nmdc:mga0rr50_200478_c1 nmdc:mga0rr50_200478_c1_1067_1504 145
461 3300050513 nmdc:mga0rr50_227497_c1 nmdc:mga0rr50_227497_c1_1037_1474 145
462 3300050515 nmdc:mga0a205_41288_c1 nmdc:mga0a205_41288_c1_3053_3490 145
463 3300050515 nmdc:mga0a205_81174_c1 nmdc:mga0a205_81174_c1_1188_1625 145
464 3300050515 nmdc:mga0a205_9085_c1 nmdc:mga0a205_9085_c1_999_1481 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

35

172

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.984 1 143
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9764 2 143
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9737 2 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.971 2 145
6mu0-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b from mycoplasma genitalium with bound ribulose-5-phosphate 0.9664 2 143
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.977 2 143 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9703 2 142 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9625 1 142 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9616 1 129 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9594 2 143 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2V6B4V8-F1-model_v4 Ribose-5-phosphate isomerase 1.003 1 117 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6JTY0-F1-model_v4 Ribose-5-phosphate isomerase 1.001 1 124 GO:0004751
GO:0009052
GO:0019316
AF-A0A7X2TVL1-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9993 1 108 GO:0004751
GO:0009052
GO:0019316
AF-A0A524GQ88-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9992 2 124 GO:0004751
GO:0009052
GO:0019316
AF-A0A425VV76-F1-model_v4 deleted 0.9989 1 107

Feature Viewer

pLDDT pTM Quality
97.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map