F449292

General Info

Members Datasets Scaffolds Average Seq Length
464 240 389 181

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10265687|Ga0157372_102656872
Length 195
Sequence MFIDYYKINFIAMTDNNVKKWYVVRAVSGQENKVKNYIETEINRLGMSDYISQVLVPTEKVVQVREGKKISKDRVYFPGYVMIEANLTGEIPHIIKSITGVIGFLGETKGGDAVPLRMSEVNRMLGKVDELSVKTDNVSIPFTTGETVKVIDGPFNGFNGTVEKVNEDKRKLEVMVKIFGRKTPLELSFMQVEKV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
13 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
14 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
15 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
16 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
17 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
18 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
19 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
20 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
21 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
22 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
23 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
24 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
25 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
26 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
27 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
28 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
29 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
30 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
31 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
32 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
33 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
34 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
35 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
36 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
37 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
38 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
39 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
40 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
41 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
42 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
43 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
44 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
45 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
46 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
47 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
48 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
49 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
50 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
51 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
52 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
53 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
54 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
55 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
56 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
57 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
58 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
59 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
60 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
61 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
62 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
63 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
64 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
65 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
66 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
67 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
68 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
69 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
70 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
71 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
72 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
76 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
77 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
162 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
205 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
222 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
223 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
224 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
225 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
226 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
236 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
237 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
238 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
239 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
240 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.34
Metatranscriptomes 12.5
Isolates 16.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.43
Bulb 0
Endosphere 2.59
Nodule 1.29
Rhizoplane 1.94
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 13.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2240772 2162886007 Bacteria 1434
2 JGI24741J21665_1000115 3300001915 Bacteria 21692
3 rootL2_10051773 3300003322 Bacteria 3799
4 rootL2_10177180 3300003322 Bacteria 2051
5 rootH1_10018046 3300003323 Bacteria 4593
6 Ga0006562J51391_1002124 3300003578 Bacteria 4457
7 Ga0006562J51391_1004392 3300003578 Bacteria 790
8 Ga0058860_10018004 3300004801 Bacteria 5911
9 Ga0065714_10011283 3300005288 Bacteria 2115
10 Ga0065714_10086622 3300005288 Bacteria 2093
11 Ga0065714_10221881 3300005288 Bacteria 833
12 Ga0065704_10072003 3300005289 Bacteria 9408
13 Ga0065704_10093408 3300005289 Bacteria 2596
14 Ga0065704_10118528 3300005289 Bacteria 1815
15 Ga0065704_10384199 3300005289 Bacteria 763
16 Ga0065715_10053929 3300005293 Bacteria 951
17 Ga0065715_10142356 3300005293 Bacteria 1834
18 Ga0065715_10212128 3300005293 Bacteria 1293
19 Ga0065715_10311084 3300005293 Bacteria 1020
20 Ga0065715_10384925 3300005293 Bacteria 893
21 Ga0065715_10406811 3300005293 Bacteria 874
22 Ga0065715_10416754 3300005293 Bacteria 863
23 Ga0070682_100000087 3300005337 Bacteria 83686
24 Ga0070660_100180506 3300005339 Bacteria 1708
25 Ga0070668_100052528 3300005347 Bacteria 3141
26 Ga0070673_100902740 3300005364 Bacteria 819
27 Ga0070659_100267604 3300005366 Bacteria 1419
28 Ga0070713_101680864 3300005436 Bacteria 616
29 Ga0070684_100538225 3300005535 Bacteria 1083
30 Ga0068855_100132220 3300005563 Bacteria 2849
31 Ga0068856_100095192 3300005614 Bacteria 2966
32 Ga0068856_100123168 3300005614 Bacteria 2595
33 Ga0068852_100868773 3300005616 Bacteria 918
34 Ga0075368_10292577 3300006042 Bacteria 701
35 Ga0075362_10236889 3300006177 Bacteria 895
36 Ga0099824_1000172 3300006942 Bacteria 59875
37 Ga0079104_1000154 3300006946 Bacteria 97194
38 Ga0079104_1066177 3300006946 Bacteria 768
39 Ga0099826_10018839 3300006948 Bacteria 5198
40 Ga0105251_10012672 3300009011 Bacteria 4758
41 Ga0105244_10000001 3300009036 Bacteria 1034899
42 Ga0105244_10013287 3300009036 Bacteria 4822
43 Ga0105247_10401027 3300009101 Bacteria 977
44 Ga0105243_10002350 3300009148 Bacteria 15832
45 Ga0105249_10006060 3300009553 Bacteria 10478
46 Ga0157373_10000054 3300013100 Bacteria 103861
47 Ga0157373_10018002 3300013100 Bacteria 5145
48 Ga0157371_10000052 3300013102 Bacteria 179522
49 Ga0157371_10008328 3300013102 Bacteria 8277
50 Ga0157371_10140756 3300013102 Bacteria 1718
51 Ga0157371_10170685 3300013102 Bacteria 1554
52 Ga0157370_10011343 3300013104 Bacteria 9334
53 Ga0157370_10014970 3300013104 Bacteria 7909
54 Ga0157370_10043162 3300013104 Bacteria 4341
55 Ga0157370_10226311 3300013104 Bacteria 1731
56 Ga0157370_10349444 3300013104 Bacteria 1363
57 Ga0157370_10386392 3300013104 Bacteria 1289
58 Ga0157370_10550600 3300013104 Bacteria 1057
59 Ga0157370_10584938 3300013104 Bacteria 1023
60 Ga0157370_10621497 3300013104 Bacteria 988
61 Ga0157370_10679295 3300013104 Bacteria 940
62 Ga0157370_10710097 3300013104 Bacteria 917
63 Ga0157369_10000355 3300013105 Bacteria 60997
64 Ga0157369_10000933 3300013105 Bacteria 37123
65 Ga0163162_10004579 3300013306 Bacteria 13316
66 Ga0157372_10001280 3300013307 Bacteria 27216
67 Ga0157372_10265687 3300013307 Bacteria 1993
68 Ga0157375_10406584 3300013308 Bacteria 1528
69 Ga0157380_10420353 3300014326 Bacteria 1275
70 Ga0182008_10000062 3300014497 Bacteria 90671
71 Ga0182006_1000003 3300015261 Bacteria 826681
72 Ga0182006_1039099 3300015261 Bacteria 1873
73 Ga0182006_1070138 3300015261 Bacteria 1302
74 Ga0182006_1085132 3300015261 Bacteria 1147
75 Ga0182007_10088882 3300015262 Bacteria 1017
76 Ga0163161_10000009 3300017792 Bacteria 287918
77 Ga0163161_10000862 3300017792 Bacteria 23670
78 Ga0163161_10025292 3300017792 Bacteria 4201
79 Ga0163161_10035920 3300017792 Bacteria 3548
80 Ga0163161_10075458 3300017792 Bacteria 2474
81 Ga0163161_10652266 3300017792 Bacteria 872
82 Ga0209675_1000059 3300025291 Bacteria 184781
83 Ga0207655_1000018 3300025728 Bacteria 537129
84 Ga0207655_1000093 3300025728 Bacteria 196813
85 Ga0207713_1055674 3300025735 Bacteria 1542
86 Ga0207700_11353609 3300025928 Bacteria 634
87 Ga0207709_10000628 3300025935 Bacteria 28907
88 Ga0207665_10116996 3300025939 Bacteria 1879
89 Ga0207668_10069988 3300025972 Bacteria 2500
90 Ga0207702_10089289 3300026078 Bacteria 2695
91 Ga0207702_10216724 3300026078 Bacteria 1782
92 Ga0207702_10747862 3300026078 Bacteria 965
93 Ga0207674_10151576 3300026116 Bacteria 2275
94 Ga0209281_1000158 3300027111 Bacteria 162280
95 Ga0210002_1007454 3300027617 Bacteria 1659
96 Ga0209974_10022486 3300027876 Bacteria 2089
97 Ga0265337_1046727 3300028556 Bacteria 1229
98 Ga0316183_1050239 3300030742 Bacteria 841
99 Ga0265327_10017918 3300031251 Bacteria 4417
100 Ga0265327_10054874 3300031251 Bacteria 2061
101 Ga0265327_10069583 3300031251 Bacteria 1766
102 Ga0265316_10000481 3300031344 Bacteria 45334
103 Ga0265316_10042258 3300031344 Bacteria 3644
104 Ga0265316_10070936 3300031344 Bacteria 2686
105 Ga0307513_10649219 3300031456 Bacteria 762
106 Ga0307408_100003021 3300031548 Bacteria 11616
107 Ga0316576_10012681 3300031727 Bacteria 5575
108 Ga0316576_10012743 3300031727 Bacteria 5562
109 Ga0316576_10018301 3300031727 Bacteria 4780
110 Ga0316576_10050475 3300031727 Bacteria 3026
111 Ga0316576_10128153 3300031727 Bacteria 1908
112 Ga0316576_10130231 3300031727 Bacteria 1893
113 Ga0316576_10300060 3300031727 Bacteria 1201
114 Ga0316578_10009386 3300031728 Bacteria 5032
115 Ga0316578_10244774 3300031728 Bacteria 1076
116 Ga0316578_10645338 3300031728 Bacteria 618
117 Ga0307405_10000001 3300031731 Bacteria 1731270
118 Ga0316577_10108556 3300031733 Bacteria 1557
119 Ga0316577_10178904 3300031733 Bacteria 1198
120 Ga0307413_10000568 3300031824 Bacteria 12415
121 Ga0307410_10000035 3300031852 Bacteria 48358
122 Ga0307406_10000074 3300031901 Bacteria 54985
123 Ga0307406_10083679 3300031901 Bacteria 2128
124 Ga0307407_10000823 3300031903 Bacteria 10298
125 Ga0307412_10000072 3300031911 Bacteria 105576
126 Ga0307412_10000385 3300031911 Bacteria 27410
127 Ga0307412_10002592 3300031911 Bacteria 10043
128 Ga0307412_10165924 3300031911 Bacteria 1646
129 Ga0307416_100000013 3300032002 Bacteria 283585
130 Ga0307416_100007927 3300032002 Bacteria 6802
131 Ga0307414_10000005 3300032004 Bacteria 452161
132 Ga0307414_10000140 3300032004 Bacteria 49611
133 Ga0307414_10000998 3300032004 Bacteria 14464
134 Ga0307414_10057443 3300032004 Bacteria 2735
135 Ga0307414_10079883 3300032004 Bacteria 2389
136 Ga0307414_10120028 3300032004 Bacteria 2019
137 Ga0307414_10131990 3300032004 Bacteria 1940
138 Ga0307414_10212444 3300032004 Bacteria 1582
139 Ga0307414_10526241 3300032004 Bacteria 1050
140 Ga0307414_11292051 3300032004 Bacteria 677
141 Ga0307411_10000010 3300032005 Bacteria 238134
142 Ga0307411_10310609 3300032005 Bacteria 1268
143 Ga0316585_10044695 3300032137 Bacteria 1416
144 Ga0316593_10000093 3300032168 Bacteria 11368
145 Ga0316593_10005401 3300032168 Bacteria 3366
146 Ga0316593_10007296 3300032168 Bacteria 3029
147 Ga0316593_10010204 3300032168 Bacteria 2685
148 Ga0316593_10010871 3300032168 Bacteria 2627
149 Ga0316593_10013658 3300032168 Bacteria 2409
150 Ga0316593_10017950 3300032168 Bacteria 2166
151 Ga0316593_10019476 3300032168 Bacteria 2098
152 Ga0316593_10030255 3300032168 Bacteria 1757
153 Ga0316593_10079296 3300032168 Bacteria 1144
154 Ga0316593_10120237 3300032168 Bacteria 943
155 Ga0316593_10150024 3300032168 Bacteria 848
156 Ga0316593_10188264 3300032168 Bacteria 760
157 Ga0316593_10210721 3300032168 Bacteria 720
158 Ga0307510_10022058 3300033180 Bacteria 7402
159 Ga0316592_1000944 3300033524 Bacteria 4451
160 Ga0316592_1001667 3300033524 Bacteria 3663
161 Ga0316592_1003224 3300033524 Bacteria 2915
162 Ga0316592_1005194 3300033524 Bacteria 2460
163 Ga0316592_1007321 3300033524 Bacteria 2154
164 Ga0316592_1008670 3300033524 Bacteria 2017
165 Ga0316592_1017679 3300033524 Bacteria 1498
166 Ga0316592_1018179 3300033524 Bacteria 1479
167 Ga0316592_1022883 3300033524 Bacteria 1338
168 Ga0316592_1035082 3300033524 Bacteria 1100
169 Ga0316592_1035500 3300033524 Bacteria 1094
170 Ga0316592_1087801 3300033524 Bacteria 710
171 Ga0316586_1009241 3300033527 Bacteria 1474
172 Ga0316586_1029333 3300033527 Bacteria 937
173 Ga0316586_1036402 3300033527 Bacteria 855
174 Ga0316588_1006632 3300033528 Bacteria 2322
175 Ga0316588_1010834 3300033528 Bacteria 1932
176 Ga0316588_1030613 3300033528 Bacteria 1262
177 Ga0316588_1038251 3300033528 Bacteria 1143
178 Ga0316587_1009733 3300033529 Bacteria 1530
179 Ga0316596_1000366 3300033541 Bacteria 7418
180 Ga0316596_1000863 3300033541 Bacteria 5687
181 Ga0316596_1001316 3300033541 Bacteria 4945
182 Ga0316596_1002234 3300033541 Bacteria 4104
183 Ga0316596_1005709 3300033541 Bacteria 2857
184 Ga0316596_1009273 3300033541 Bacteria 2359
185 Ga0316596_1013267 3300033541 Bacteria 2033
186 Ga0316596_1039730 3300033541 Bacteria 1234
187 Ga0316596_1087092 3300033541 Bacteria 841
188 Ga0316574_0014181 3300035398 Bacteria 4597
189 Ga0316574_0079726 3300035398 Bacteria 2077
190 Ga0316574_0178738 3300035398 Bacteria 1365
191 Ga0316574_0210185 3300035398 Bacteria 1249
192 Ga0316582_0005208 3300036647 Bacteria 6663
193 Ga0316582_0012374 3300036647 Bacteria 4759
194 Ga0316582_0091362 3300036647 Bacteria 2004
195 Ga0316584_0001736 3300036712 Bacteria 13379
196 Ga0316584_0004533 3300036712 Bacteria 9200
197 Ga0316584_0018160 3300036712 Bacteria 5071
198 Ga0316584_0126509 3300036712 Bacteria 1908
199 Ga0316584_0252468 3300036712 Bacteria 1288
200 Ga0316584_0293854 3300036712 Bacteria 1178
201 Ga0395905_0000011 3300037471 Bacteria 424563
202 Ga0395905_0003630 3300037471 Bacteria 16393
203 Ga0395901_0000976 3300038443 Bacteria 31051
204 Ga0400484_41446 3300038725 Bacteria 1662
205 Ga0400483_124011 3300039062 Bacteria 2626
206 Ga0400483_284216 3300039062 Bacteria 1396
207 Ga0400489_69386 3300039093 Bacteria 2575
208 Ga0439447_000448 3300041407 Bacteria 15364
209 Ga0439466_0010146 3300041411 Bacteria 3502
210 Ga0439465_0000059 3300041413 Bacteria 23849
211 Ga0451790_01534 3300041444 Bacteria 659
212 Ga0451792_14905 3300041445 Bacteria 1301
213 Ga0451793_0667393 3300041452 Bacteria 1159
214 Ga0451793_1454560 3300041452 Bacteria 633
215 Ga0451805_096298 3300041461 Bacteria 641
216 Ga0451837_0040229 3300041494 Bacteria 2161
217 Ga0451855_1868662 3300041511 Bacteria 1193
218 Ga0439445_0000513 3300042004 Bacteria 7833
219 Ga0450918_035777 3300042531 Bacteria 884
220 Ga0451577_0000854 3300042876 Bacteria 45411
221 Ga0451577_0001493 3300042876 Bacteria 30989
222 Ga0451577_0012082 3300042876 Bacteria 8123
223 Ga0451577_0018384 3300042876 Bacteria 6440
224 Ga0451577_0022661 3300042876 Bacteria 5734
225 Ga0451577_0057422 3300042876 Bacteria 3470
226 Ga0451577_0143677 3300042876 Bacteria 2145
227 Ga0451577_0285518 3300042876 Bacteria 1495
228 Ga0451577_0361600 3300042876 Bacteria 1316
229 Ga0451577_0505106 3300042876 Bacteria 1098
230 Ga0451577_0569524 3300042876 Bacteria 1028
231 Ga0453683_0000241 3300044673 Bacteria 72899
232 Ga0453683_0002921 3300044673 Bacteria 12891
233 Ga0453683_0003448 3300044673 Bacteria 11652
234 Ga0453683_0005001 3300044673 Bacteria 9312
235 Ga0453683_0014479 3300044673 Bacteria 5118
236 Ga0453683_0038384 3300044673 Bacteria 3010
237 Ga0453683_0053136 3300044673 Bacteria 2535
238 Ga0453683_0056977 3300044673 Bacteria 2445
239 Ga0453683_0062449 3300044673 Bacteria 2329
240 Ga0453683_0089489 3300044673 Bacteria 1929
241 Ga0453683_0125887 3300044673 Bacteria 1613
242 Ga0453683_0206789 3300044673 Bacteria 1246
243 Ga0453683_0482944 3300044673 Bacteria 803
244 Ga0453683_0576795 3300044673 Bacteria 733
245 Ga0453683_0748314 3300044673 Unclassified 642
246 Ga0453683_0765644 3300044673 Bacteria 634
247 Ga0453684_0000334 3300044712 Bacteria 196444
248 Ga0453684_0000553 3300044712 Bacteria 141396
249 Ga0453684_0001022 3300044712 Bacteria 89958
250 Ga0453684_0001284 3300044712 Bacteria 74993
251 Ga0453684_0001358 3300044712 Bacteria 71434
252 Ga0453684_0001653 3300044712 Bacteria 60468
253 Ga0453684_0001698 3300044712 Bacteria 59396
254 Ga0453684_0002943 3300044712 Bacteria 39941
255 Ga0453684_0004196 3300044712 Bacteria 30989
256 Ga0453684_0006165 3300044712 Bacteria 23060
257 Ga0453684_0009255 3300044712 Bacteria 17298
258 Ga0453684_0013926 3300044712 Bacteria 12969
259 Ga0453684_0024439 3300044712 Bacteria 8830
260 Ga0453684_0031787 3300044712 Bacteria 7404
261 Ga0453684_0034885 3300044712 Bacteria 6969
262 Ga0453684_0041466 3300044712 Bacteria 6225
263 Ga0453684_0049105 3300044712 Bacteria 5569
264 Ga0453684_0057481 3300044712 Bacteria 5034
265 Ga0453684_0127128 3300044712 Bacteria 3065
266 Ga0453684_0180136 3300044712 Bacteria 2481
267 Ga0453684_0198224 3300044712 Bacteria 2342
268 Ga0453684_0216908 3300044712 Bacteria 2219
269 Ga0453684_0308865 3300044712 Bacteria 1795
270 Ga0453684_0340354 3300044712 Bacteria 1694
271 Ga0453684_0352243 3300044712 Bacteria 1660
272 Ga0453684_0603652 3300044712 Bacteria 1202
273 Ga0453684_1004146 3300044712 Bacteria 887
274 Ga0453684_1441856 3300044712 Bacteria 712
275 Ga0451576_0001055 3300045051 Bacteria 50745
276 Ga0451576_0002107 3300045051 Bacteria 30989
277 Ga0451576_0004347 3300045051 Bacteria 18488
278 Ga0451576_0008039 3300045051 Bacteria 12449
279 Ga0451576_0010553 3300045051 Bacteria 10581
280 Ga0451576_0013829 3300045051 Bacteria 9016
281 Ga0451576_0017971 3300045051 Bacteria 7759
282 Ga0451576_0022593 3300045051 Bacteria 6819
283 Ga0451576_0033662 3300045051 Bacteria 5446
284 Ga0451576_0062300 3300045051 Bacteria 3888
285 Ga0451576_0062721 3300045051 Bacteria 3874
286 Ga0451576_0100168 3300045051 Bacteria 3013
287 Ga0451576_0102552 3300045051 Bacteria 2976
288 Ga0451576_0160168 3300045051 Bacteria 2348
289 Ga0451576_0197859 3300045051 Bacteria 2099
290 Ga0451576_0304565 3300045051 Bacteria 1667
291 Ga0451576_0493809 3300045051 Bacteria 1286
292 Ga0451576_0921908 3300045051 Bacteria 916
293 Ga0451576_1142578 3300045051 Bacteria 814
294 Ga0495627_000067 3300046453 Bacteria 130165
295 Ga0495627_002663 3300046453 Bacteria 8378
296 Ga0495627_019124 3300046453 Bacteria 2302
297 Ga0495590_0018573 3300046457 Bacteria 2488
298 Ga0495596_0001404 3300046500 Bacteria 13820
299 Ga0495607_0034827 3300046501 Bacteria 3052
300 Ga0495606_0047256 3300046507 Bacteria 2838
301 Ga0495606_0060387 3300046507 Bacteria 2428
302 Ga0495606_0101329 3300046507 Bacteria 1753
303 Ga0495610_0000006 3300046512 Bacteria 856822
304 Ga0495616_0010134 3300046513 Bacteria 5469
305 Ga0495632_0009820 3300046519 Bacteria 5727
306 Ga0495643_0000948 3300046522 Bacteria 30016
307 Ga0495643_0007748 3300046522 Bacteria 6876
308 Ga0495643_0029807 3300046522 Bacteria 3051
309 Ga0495663_0000117 3300046525 Bacteria 33214
310 Ga0495654_0000017 3300046530 Bacteria 295999
311 Ga0495609_0000780 3300046538 Bacteria 23818
312 Ga0495633_0000680 3300046558 Bacteria 31336
313 Ga0495633_0002487 3300046558 Bacteria 12995
314 Ga0495633_0108168 3300046558 Bacteria 1289
315 Ga0495625_0004265 3300046660 Bacteria 13612
316 Ga0495625_0201614 3300046660 Bacteria 1313
317 Ga0495671_0072492 3300046692 Bacteria 1691
318 Ga0495686_0000403 3300047472 Bacteria 68373
319 Ga0495686_0098326 3300047472 Bacteria 1768
320 Ga0496102_0028553 3300048905 Bacteria 4984
321 Ga0496104_0342080 3300048907 Bacteria 1409
322 Ga0496113_0020235 3300048916 Bacteria 4675
323 Ga0496115_0002997 3300048918 Bacteria 12131
324 Ga0496116_0000156 3300048919 Bacteria 140734
325 Ga0496116_0000199 3300048919 Bacteria 116470
326 Ga0496117_0000076 3300048920 Bacteria 232366
327 Ga0496118_0001659 3300048921 Bacteria 32694
328 Ga0496119_0000021 3300048922 Bacteria 277056
329 Ga0496121_0027459 3300048924 Bacteria 5327
330 Ga0496121_0075674 3300048924 Bacteria 2688
331 Ga0496121_0288867 3300048924 Bacteria 1118
332 Ga0496121_0659086 3300048924 Bacteria 636
333 Ga0496122_0011897 3300048925 Bacteria 8742
334 Ga0496122_0013994 3300048925 Bacteria 7794
335 Ga0496122_0347879 3300048925 Bacteria 775
336 Ga0496123_0003734 3300048926 Bacteria 16722
337 Ga0496123_0162583 3300048926 Bacteria 1188
338 Ga0496124_0002475 3300048927 Bacteria 24121
339 Ga0496124_0040283 3300048927 Bacteria 4043
340 Ga0496124_0473711 3300048927 Bacteria 847
341 Ga0496125_0000062 3300048928 Bacteria 259277
342 Ga0496125_0000452 3300048928 Bacteria 74236
343 Ga0496125_0030278 3300048928 Bacteria 4844
344 Ga0496125_0057674 3300048928 Bacteria 3143
345 Ga0496126_0026501 3300048929 Bacteria 5557
346 Ga0496126_0078531 3300048929 Bacteria 2924
347 Ga0501310_000037 3300049130 Bacteria 13386
348 Ga0501303_009219 3300049526 Bacteria 907
349 Ga0501314_000012 3300049530 Bacteria 8997
350 Ga0501319_000006 3300049535 Bacteria 8644
351 Ga0501320_000057 3300049536 Bacteria 4943
352 Ga0501323_000034 3300049539 Bacteria 6307
353 Ga0501323_002460 3300049539 Bacteria 1796
354 Ga0501324_000007 3300049540 Bacteria 7853
355 Ga0501326_00015 3300049542 Bacteria 6989
356 Ga0501334_00025 3300049550 Bacteria 4715
357 Ga0501032_0007396 3300049569 Bacteria 8020
358 Ga0501032_0723090 3300049569 Bacteria 630
359 Ga0501033_0000065 3300049570 Bacteria 100338
360 Ga0501034_0001909 3300049571 Bacteria 26368
361 Ga0501034_0018590 3300049571 Bacteria 7125
362 Ga0501036_0001190 3300049572 Bacteria 19831
363 Ga0501037_0000701 3300049573 Bacteria 25473
364 Ga0501038_0008841 3300049574 Bacteria 9240
365 Ga0501038_0149188 3300049574 Bacteria 1907
366 Ga0501039_0005495 3300049575 Bacteria 9590
367 Ga0501040_0050893 3300049576 Bacteria 2834
368 Ga0501043_0000983 3300049579 Bacteria 25126
369 Ga0501238_000005 3300049671 Bacteria 44524
370 Ga0501243_002320 3300049675 Bacteria 2778
371 Ga0501249_000797 3300049679 Bacteria 7031
372 Ga0501241_000085 3300049758 Bacteria 20472
373 Ga0501241_007664 3300049758 Bacteria 1978
374 Ga0501266_000009 3300049763 Bacteria 233584
375 Ga0501269_000378 3300049766 Bacteria 10736
376 Ga0501269_000765 3300049766 Bacteria 5143
377 Ga0501035_0114203 3300049822 Bacteria 2365
378 Ga0501044_0001697 3300049823 Bacteria 25838
379 Ga0501044_0969583 3300049823 Bacteria 723
380 Ga0501045_0000463 3300049824 Bacteria 25195
381 nmdc:mga03683_200421_c1 3300050489 Bacteria 916
382 Ga0500646_0003988 3300053090 Bacteria 3755
383 Ga0500646_0066607 3300053090 Bacteria 1072
384 Ga0500641_0000029 3300053096 Bacteria 103994
385 Ga0500641_0003322 3300053096 Bacteria 5693
386 Ga0500641_0049673 3300053096 Bacteria 1721
387 Ga0500594_0020923 3300053118 Bacteria 1636
388 Ga0500658_0000006 3300053134 Bacteria 290380
389 Ga0500584_010431 3300053726 Bacteria 4160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041461 Ga0451805_096298 Ga0451805_096298_66_527 153
2 3300044712 Ga0453684_1441856 Ga0453684_1441856_235_699 153
3 3300048925 Ga0496122_0013994 Ga0496122_0013994_7287_7775 162
4 3300031251 Ga0265327_10054874 Ga0265327_100548741 167
5 3300037471 Ga0395905_0000011 Ga0395905_0000011_321221_321787 170
6 3300044673 Ga0453683_0206789 Ga0453683_0206789_708_1229 172
7 iso_pu_bacteria 2511231000 2511234227 176
8 iso_pu_bacteria 2523533629 2524005423 176
9 iso_pu_bacteria 2582581278 2585142329 176
10 iso_pu_bacteria 2582581281 2585159830 176
11 iso_pu_bacteria 2582581282 2585164026 176
12 iso_pu_bacteria 2582581873 2585426901 176
13 iso_pu_bacteria 2585428045 2587680912 176
14 iso_pu_bacteria 2585428060 2587747645 176
15 iso_pu_bacteria 2585428061 2587751531 176
16 iso_pu_bacteria 2585428095 2587867305 176
17 iso_pu_bacteria 2585428115 2587945029 176
18 iso_pu_bacteria 2585428182 2588210634 176
19 iso_pu_bacteria 2585428183 2588214122 176
20 iso_pu_bacteria 2585428184 2588221611 176
21 iso_pu_bacteria 2585428185 2588223434 176
22 iso_pu_bacteria 2585428187 2588232641 176
23 iso_pu_bacteria 2588253712 2588443659 176
24 iso_pu_bacteria 2588254255 2590601905 176
25 iso_pu_bacteria 2588254257 2590613358 176
26 iso_pu_bacteria 2728369107 2729200424 176
27 iso_pu_bacteria 2738541273 2738699644 176
28 iso_pu_bacteria 2738543014 2739253393 176
29 iso_pu_bacteria 2739367866 2740031518 176
30 iso_pu_bacteria 2739367874 2740059405 176
31 iso_pu_bacteria 2751185877 2753673467 176
32 iso_pu_bacteria 2765235839 2765574572 176
33 iso_pu_bacteria 2772190705 2772604703 176
34 iso_pu_bacteria 2775506739 2775671673 176
35 iso_pu_bacteria 2816332188 2816874790 176
36 iso_pu_bacteria 2842083920 2842085315 176
37 iso_pu_bacteria 2871720351 2871722315 176
38 iso_pu_bacteria 2889290771 2889294868 176
39 iso_pu_bacteria 2905999023 2906001490 176
40 iso_pu_bacteria 2919097161 2919099498 176
41 iso_pu_bacteria 2919399522 2919402448 176
42 iso_pu_bacteria 2945924605 2945925748 176
43 iso_pu_bacteria 2946019816 2946023018 176
44 iso_pu_bacteria 2977243572 2977244649 176
45 iso_pu_bacteria 2984572630 2984573522 176
46 iso_pu_bacteria 2984606641 2984606961 176
47 iso_pu_bacteria 2993372514 2993376058 176
48 iso_pu_bacteria 2993480792 2993482903 176
49 3300049675 Ga0501243_002320 Ga0501243_002320_1882_2415 177
50 3300041452 Ga0451793_1454560 Ga0451793_1454560_48_584 178
51 3300042876 Ga0451577_0143677 Ga0451577_0143677_1333_1869 178
52 3300044712 Ga0453684_0000334 Ga0453684_0000334_135985_136521 178
53 iso_pu_bacteria 2833640130 2833642869 178
54 3300032168 Ga0316593_10007296 Ga0316593_100072962 179
55 3300032168 Ga0316593_10010204 Ga0316593_100102044 179
56 3300042876 Ga0451577_0022661 Ga0451577_0022661_1226_1765 179
57 3300045051 Ga0451576_0022593 Ga0451576_0022593_2450_2989 179
58 iso_pu_bacteria 2513020052 2513234199 179
59 iso_pu_bacteria 2519899754 2520881102 179
60 iso_pu_bacteria 2643221600 2644011030 179
61 iso_pu_bacteria 2643221667 2644373885 179
62 iso_pu_bacteria 2643221716 2644643520 179
63 iso_pu_bacteria 2643221725 2644683943 179
64 iso_pu_bacteria 2738541279 2738736998 179
65 iso_pu_bacteria 2738541285 2738769538 179
66 iso_pu_bacteria 2738543007 2739218580 179
67 iso_pu_bacteria 2739367857 2739999428 179
68 iso_pu_bacteria 2739367858 2740004245 179
69 iso_pu_bacteria 2802428842 2802652168 179
70 iso_pu_bacteria 2816332280 2817415026 179
71 iso_pu_bacteria 2857613821 2857617508 179
72 iso_pu_bacteria 2857618242 2857621261 179
73 iso_pu_bacteria 2881247448 2881250018 179
74 iso_pu_bacteria 2903895155 2903896137 179
75 iso_pu_bacteria 2904419702 2904421812 179
76 iso_pu_bacteria 2904555929 2904559877 179
77 iso_pu_bacteria 2919191525 2919195748 179
78 iso_pu_bacteria 2919509842 2919510863 179
79 iso_pu_bacteria 2919683626 2919687965 179
80 iso_pu_bacteria 2929150217 2929152200 179
81 iso_pu_bacteria 2958512119 2958514758 179
82 iso_pu_bacteria 8036736890 8036739391 179
83 iso_pu_bacteria 8054307821 8054309582 179
84 iso_pu_bacteria 8055419101 8055419151 179
85 iso_pu_bacteria 8055592153 8055592430 179
86 iso_pu_bacteria 8056440228 8056442549 179
87 3300001915 JGI24741J21665_1000115 JGI24741J21665_100011515 180
88 3300003322 rootL2_10177180 rootL2_101771801 180
89 3300003323 rootH1_10018046 rootH1_100180464 180
90 3300003578 Ga0006562J51391_1004392 Ga0006562J51391_10043922 180
91 3300005288 Ga0065714_10086622 Ga0065714_100866221 180
92 3300005289 Ga0065704_10072003 Ga0065704_100720031 180
93 3300005289 Ga0065704_10118528 Ga0065704_101185281 180
94 3300005337 Ga0070682_100000087 Ga0070682_10000008762 180
95 3300005339 Ga0070660_100180506 Ga0070660_1001805061 180
96 3300005347 Ga0070668_100052528 Ga0070668_1000525284 180
97 3300005366 Ga0070659_100267604 Ga0070659_1002676041 180
98 3300005535 Ga0070684_100538225 Ga0070684_1005382252 180
99 3300006042 Ga0075368_10292577 Ga0075368_102925772 180
100 3300009036 Ga0105244_10000001 Ga0105244_10000001759 180
101 3300009101 Ga0105247_10401027 Ga0105247_104010271 180
102 3300009148 Ga0105243_10002350 Ga0105243_1000235015 180
103 3300009553 Ga0105249_10006060 Ga0105249_1000606013 180
104 3300013100 Ga0157373_10018002 Ga0157373_100180024 180
105 3300013102 Ga0157371_10000052 Ga0157371_10000052109 180
106 3300013102 Ga0157371_10140756 Ga0157371_101407562 180
107 3300013102 Ga0157371_10170685 Ga0157371_101706854 180
108 3300013104 Ga0157370_10011343 Ga0157370_100113434 180
109 3300013104 Ga0157370_10043162 Ga0157370_100431626 180
110 3300013104 Ga0157370_10226311 Ga0157370_102263114 180
111 3300013104 Ga0157370_10386392 Ga0157370_103863923 180
112 3300013104 Ga0157370_10621497 Ga0157370_106214972 180
113 3300013105 Ga0157369_10000355 Ga0157369_100003558 180
114 3300014497 Ga0182008_10000062 Ga0182008_1000006276 180
115 3300015261 Ga0182006_1000003 Ga0182006_1000003650 180
116 3300015262 Ga0182007_10088882 Ga0182007_100888822 180
117 3300017792 Ga0163161_10000862 Ga0163161_1000086220 180
118 3300017792 Ga0163161_10025292 Ga0163161_100252922 180
119 3300025291 Ga0209675_1000059 Ga0209675_1000059102 180
120 3300025728 Ga0207655_1000018 Ga0207655_1000018288 180
121 3300025935 Ga0207709_10000628 Ga0207709_1000062813 180
122 3300025972 Ga0207668_10069988 Ga0207668_100699883 180
123 3300031911 Ga0307412_10000072 Ga0307412_1000007245 180
124 3300031911 Ga0307412_10000385 Ga0307412_1000038534 180
125 3300031911 Ga0307412_10002592 Ga0307412_100025928 180
126 3300032002 Ga0307416_100000013 Ga0307416_10000001326 180
127 3300032004 Ga0307414_10000140 Ga0307414_1000014033 180
128 3300032004 Ga0307414_10057443 Ga0307414_100574432 180
129 3300041413 Ga0439465_0000059 Ga0439465_0000059_12798_13340 180
130 3300042004 Ga0439445_0000513 Ga0439445_0000513_6957_7499 180
131 3300044712 Ga0453684_0013926 Ga0453684_0013926_4882_5427 180
132 3300046453 Ga0495627_000067 Ga0495627_000067_97562_98104 180
133 3300046453 Ga0495627_019124 Ga0495627_019124_1371_1913 180
134 3300046457 Ga0495590_0018573 Ga0495590_0018573_473_1015 180
135 3300046500 Ga0495596_0001404 Ga0495596_0001404_1623_2165 180
136 3300046507 Ga0495606_0047256 Ga0495606_0047256_2220_2762 180
137 3300046512 Ga0495610_0000006 Ga0495610_0000006_152882_153424 180
138 3300046519 Ga0495632_0009820 Ga0495632_0009820_1752_2294 180
139 3300046522 Ga0495643_0007748 Ga0495643_0007748_4016_4558 180
140 3300046522 Ga0495643_0029807 Ga0495643_0029807_17_559 180
141 3300046525 Ga0495663_0000117 Ga0495663_0000117_32590_33132 180
142 3300046530 Ga0495654_0000017 Ga0495654_0000017_263779_264321 180
143 3300046538 Ga0495609_0000780 Ga0495609_0000780_12713_13255 180
144 3300046558 Ga0495633_0000680 Ga0495633_0000680_20414_20956 180
145 3300046558 Ga0495633_0002487 Ga0495633_0002487_12067_12609 180
146 3300046660 Ga0495625_0004265 Ga0495625_0004265_1549_2091 180
147 3300047472 Ga0495686_0000403 Ga0495686_0000403_1417_1959 180
148 3300047472 Ga0495686_0098326 Ga0495686_0098326_510_1052 180
149 3300048905 Ga0496102_0028553 Ga0496102_0028553_1983_2525 180
150 3300048907 Ga0496104_0342080 Ga0496104_0342080_398_940 180
151 3300048916 Ga0496113_0020235 Ga0496113_0020235_911_1453 180
152 3300048919 Ga0496116_0000199 Ga0496116_0000199_70646_71188 180
153 3300048920 Ga0496117_0000076 Ga0496117_0000076_31459_32001 180
154 3300048921 Ga0496118_0001659 Ga0496118_0001659_31353_31895 180
155 3300048922 Ga0496119_0000021 Ga0496119_0000021_200391_200933 180
156 3300048924 Ga0496121_0027459 Ga0496121_0027459_2011_2553 180
157 3300048925 Ga0496122_0011897 Ga0496122_0011897_7594_8136 180
158 3300048925 Ga0496122_0347879 Ga0496122_0347879_38_580 180
159 3300048926 Ga0496123_0003734 Ga0496123_0003734_16052_16594 180
160 3300048926 Ga0496123_0162583 Ga0496123_0162583_51_593 180
161 3300048927 Ga0496124_0002475 Ga0496124_0002475_20100_20642 180
162 3300048928 Ga0496125_0030278 Ga0496125_0030278_2693_3235 180
163 3300048928 Ga0496125_0057674 Ga0496125_0057674_2246_2788 180
164 3300048929 Ga0496126_0078531 Ga0496126_0078531_307_849 180
165 3300049526 Ga0501303_009219 Ga0501303_009219_285_827 180
166 3300049571 Ga0501034_0018590 Ga0501034_0018590_6244_6789 180
167 3300049758 Ga0501241_000085 Ga0501241_000085_19662_20204 180
168 3300049766 Ga0501269_000378 Ga0501269_000378_10079_10621 180
169 iso_pu_bacteria 2881359912 2881359953 180
170 iso_pu_bacteria 2958458903 2958460102 180
171 iso_pu_bacteria 2977268062 2977268897 180
172 3300028556 Ga0265337_1046727 Ga0265337_10467271 181
173 3300031344 Ga0265316_10000481 Ga0265316_1000048132 181
174 3300031344 Ga0265316_10042258 Ga0265316_100422583 181
175 3300031344 Ga0265316_10070936 Ga0265316_100709364 181
176 3300031727 Ga0316576_10130231 Ga0316576_101302313 181
177 3300031727 Ga0316576_10300060 Ga0316576_103000602 181
178 3300031728 Ga0316578_10009386 Ga0316578_1000938612 181
179 3300032168 Ga0316593_10010871 Ga0316593_100108713 181
180 3300033524 Ga0316592_1001667 Ga0316592_10016674 181
181 3300033524 Ga0316592_1017679 Ga0316592_10176793 181
182 3300033528 Ga0316588_1006632 Ga0316588_10066324 181
183 3300033528 Ga0316588_1010834 Ga0316588_10108344 181
184 3300033541 Ga0316596_1000863 Ga0316596_10008638 181
185 3300036647 Ga0316582_0012374 Ga0316582_0012374_1253_1801 181
186 3300036712 Ga0316584_0004533 Ga0316584_0004533_3841_4389 181
187 3300042876 Ga0451577_0012082 Ga0451577_0012082_7262_7810 181
188 3300044673 Ga0453683_0014479 Ga0453683_0014479_1595_2143 181
189 3300044673 Ga0453683_0038384 Ga0453683_0038384_929_1477 181
190 3300044673 Ga0453683_0056977 Ga0453683_0056977_1647_2195 181
191 3300044673 Ga0453683_0125887 Ga0453683_0125887_644_1192 181
192 3300044673 Ga0453683_0765644 Ga0453683_0765644_49_597 181
193 3300044712 Ga0453684_0000553 Ga0453684_0000553_87671_88219 181
194 3300044712 Ga0453684_0002943 Ga0453684_0002943_21020_21565 181
195 3300044712 Ga0453684_0006165 Ga0453684_0006165_17175_17720 181
196 3300044712 Ga0453684_0024439 Ga0453684_0024439_3680_4228 181
197 3300044712 Ga0453684_0057481 Ga0453684_0057481_2390_2938 181
198 3300044712 Ga0453684_0127128 Ga0453684_0127128_2210_2758 181
199 3300044712 Ga0453684_0180136 Ga0453684_0180136_564_1112 181
200 3300044712 Ga0453684_0198224 Ga0453684_0198224_23_568 181
201 3300044712 Ga0453684_0308865 Ga0453684_0308865_346_894 181
202 3300044712 Ga0453684_0340354 Ga0453684_0340354_834_1382 181
203 3300044712 Ga0453684_0352243 Ga0453684_0352243_959_1507 181
204 3300044712 Ga0453684_1004146 Ga0453684_1004146_41_586 181
205 3300045051 Ga0451576_0062300 Ga0451576_0062300_1537_2085 181
206 3300045051 Ga0451576_0062721 Ga0451576_0062721_1721_2269 181
207 3300045051 Ga0451576_0100168 Ga0451576_0100168_1536_2084 181
208 3300003322 rootL2_10051773 rootL2_100517733 182
209 3300005614 Ga0068856_100095192 Ga0068856_1000951922 182
210 3300013307 Ga0157372_10001280 Ga0157372_1000128015 182
211 3300026078 Ga0207702_10747862 Ga0207702_107478621 182
212 3300031251 Ga0265327_10017918 Ga0265327_100179186 182
213 3300031727 Ga0316576_10012681 Ga0316576_100126817 182
214 3300031727 Ga0316576_10012743 Ga0316576_100127435 182
215 3300031727 Ga0316576_10018301 Ga0316576_100183016 182
216 3300031727 Ga0316576_10128153 Ga0316576_101281532 182
217 3300031728 Ga0316578_10244774 Ga0316578_102447741 182
218 3300031733 Ga0316577_10108556 Ga0316577_101085562 182
219 3300031733 Ga0316577_10178904 Ga0316577_101789042 182
220 3300032137 Ga0316585_10044695 Ga0316585_100446952 182
221 3300032168 Ga0316593_10000093 Ga0316593_100000937 182
222 3300032168 Ga0316593_10005401 Ga0316593_100054012 182
223 3300032168 Ga0316593_10013658 Ga0316593_100136585 182
224 3300032168 Ga0316593_10017950 Ga0316593_100179502 182
225 3300032168 Ga0316593_10019476 Ga0316593_100194763 182
226 3300032168 Ga0316593_10030255 Ga0316593_100302553 182
227 3300032168 Ga0316593_10120237 Ga0316593_101202372 182
228 3300032168 Ga0316593_10150024 Ga0316593_101500242 182
229 3300032168 Ga0316593_10188264 Ga0316593_101882641 182
230 3300032168 Ga0316593_10210721 Ga0316593_102107211 182
231 3300033524 Ga0316592_1000944 Ga0316592_10009445 182
232 3300033524 Ga0316592_1003224 Ga0316592_10032244 182
233 3300033524 Ga0316592_1005194 Ga0316592_10051942 182
234 3300033524 Ga0316592_1007321 Ga0316592_10073211 182
235 3300033524 Ga0316592_1008670 Ga0316592_10086702 182
236 3300033524 Ga0316592_1018179 Ga0316592_10181792 182
237 3300033524 Ga0316592_1022883 Ga0316592_10228832 182
238 3300033524 Ga0316592_1035082 Ga0316592_10350822 182
239 3300033524 Ga0316592_1035500 Ga0316592_10355002 182
240 3300033524 Ga0316592_1087801 Ga0316592_10878011 182
241 3300033527 Ga0316586_1009241 Ga0316586_10092413 182
242 3300033527 Ga0316586_1029333 Ga0316586_10293331 182
243 3300033527 Ga0316586_1036402 Ga0316586_10364022 182
244 3300033528 Ga0316588_1030613 Ga0316588_10306132 182
245 3300033528 Ga0316588_1038251 Ga0316588_10382512 182
246 3300033529 Ga0316587_1009733 Ga0316587_10097332 182
247 3300033541 Ga0316596_1000366 Ga0316596_10003666 182
248 3300033541 Ga0316596_1002234 Ga0316596_10022346 182
249 3300033541 Ga0316596_1005709 Ga0316596_10057095 182
250 3300033541 Ga0316596_1009273 Ga0316596_10092734 182
251 3300033541 Ga0316596_1013267 Ga0316596_10132674 182
252 3300033541 Ga0316596_1039730 Ga0316596_10397302 182
253 3300033541 Ga0316596_1087092 Ga0316596_10870922 182
254 3300035398 Ga0316574_0014181 Ga0316574_0014181_951_1499 182
255 3300036647 Ga0316582_0005208 Ga0316582_0005208_3995_4546 182
256 3300036647 Ga0316582_0091362 Ga0316582_0091362_911_1462 182
257 3300036712 Ga0316584_0001736 Ga0316584_0001736_5608_6159 182
258 3300036712 Ga0316584_0018160 Ga0316584_0018160_2951_3502 182
259 3300036712 Ga0316584_0252468 Ga0316584_0252468_344_895 182
260 3300036712 Ga0316584_0293854 Ga0316584_0293854_564_1112 182
261 3300038443 Ga0395901_0000976 Ga0395901_0000976_467_1033 182
262 3300038725 Ga0400484_41446 Ga0400484_41446_194_742 182
263 3300039062 Ga0400483_124011 Ga0400483_124011_141_689 182
264 3300039062 Ga0400483_284216 Ga0400483_284216_570_1118 182
265 3300039093 Ga0400489_69386 Ga0400489_69386_101_652 182
266 3300041511 Ga0451855_1868662 Ga0451855_1868662_223_774 182
267 3300042876 Ga0451577_0000854 Ga0451577_0000854_43850_44398 182
268 3300042876 Ga0451577_0001493 Ga0451577_0001493_19444_19992 182
269 3300042876 Ga0451577_0018384 Ga0451577_0018384_2058_2606 182
270 3300042876 Ga0451577_0057422 Ga0451577_0057422_1804_2352 182
271 3300042876 Ga0451577_0285518 Ga0451577_0285518_928_1476 182
272 3300042876 Ga0451577_0361600 Ga0451577_0361600_85_633 182
273 3300042876 Ga0451577_0569524 Ga0451577_0569524_330_884 182
274 3300044673 Ga0453683_0000241 Ga0453683_0000241_69577_70125 182
275 3300044673 Ga0453683_0002921 Ga0453683_0002921_11686_12234 182
276 3300044673 Ga0453683_0003448 Ga0453683_0003448_10998_11546 182
277 3300044673 Ga0453683_0005001 Ga0453683_0005001_5163_5717 182
278 3300044673 Ga0453683_0053136 Ga0453683_0053136_1780_2328 182
279 3300044673 Ga0453683_0062449 Ga0453683_0062449_432_980 182
280 3300044673 Ga0453683_0089489 Ga0453683_0089489_311_859 182
281 3300044673 Ga0453683_0482944 Ga0453683_0482944_70_618 182
282 3300044673 Ga0453683_0748314 Ga0453683_0748314_79_627 182
283 3300044712 Ga0453684_0001022 Ga0453684_0001022_78091_78639 182
284 3300044712 Ga0453684_0001284 Ga0453684_0001284_15205_15753 182
285 3300044712 Ga0453684_0001358 Ga0453684_0001358_41649_42197 182
286 3300044712 Ga0453684_0001653 Ga0453684_0001653_58197_58745 182
287 3300044712 Ga0453684_0001698 Ga0453684_0001698_23507_24055 182
288 3300044712 Ga0453684_0004196 Ga0453684_0004196_19444_19992 182
289 3300044712 Ga0453684_0009255 Ga0453684_0009255_16324_16872 182
290 3300044712 Ga0453684_0031787 Ga0453684_0031787_4181_4729 182
291 3300044712 Ga0453684_0034885 Ga0453684_0034885_3315_3863 182
292 3300044712 Ga0453684_0041466 Ga0453684_0041466_1093_1641 182
293 3300044712 Ga0453684_0049105 Ga0453684_0049105_4997_5545 182
294 3300044712 Ga0453684_0216908 Ga0453684_0216908_1062_1610 182
295 3300044712 Ga0453684_0603652 Ga0453684_0603652_626_1174 182
296 3300045051 Ga0451576_0001055 Ga0451576_0001055_114_662 182
297 3300045051 Ga0451576_0002107 Ga0451576_0002107_19444_19992 182
298 3300045051 Ga0451576_0004347 Ga0451576_0004347_4451_5005 182
299 3300045051 Ga0451576_0008039 Ga0451576_0008039_464_1012 182
300 3300045051 Ga0451576_0010553 Ga0451576_0010553_9445_9993 182
301 3300045051 Ga0451576_0013829 Ga0451576_0013829_7719_8267 182
302 3300045051 Ga0451576_0017971 Ga0451576_0017971_3409_3957 182
303 3300045051 Ga0451576_0033662 Ga0451576_0033662_1107_1655 182
304 3300045051 Ga0451576_0102552 Ga0451576_0102552_428_976 182
305 3300045051 Ga0451576_0160168 Ga0451576_0160168_1770_2318 182
306 3300045051 Ga0451576_0197859 Ga0451576_0197859_1105_1653 182
307 3300045051 Ga0451576_0304565 Ga0451576_0304565_1088_1636 182
308 3300045051 Ga0451576_0493809 Ga0451576_0493809_407_955 182
309 3300045051 Ga0451576_0921908 Ga0451576_0921908_61_609 182
310 3300045051 Ga0451576_1142578 Ga0451576_1142578_115_663 182
311 3300053090 Ga0500646_0066607 Ga0500646_0066607_330_896 182
312 2162886007 SwRhRL2b_contig_2240772 SwRhRL2b_0431.00000560 183
313 3300003578 Ga0006562J51391_1002124 Ga0006562J51391_10021245 183
314 3300004801 Ga0058860_10018004 Ga0058860_100180042 183
315 3300005288 Ga0065714_10011283 Ga0065714_100112833 183
316 3300005288 Ga0065714_10221881 Ga0065714_102218812 183
317 3300005289 Ga0065704_10093408 Ga0065704_100934084 183
318 3300005289 Ga0065704_10384199 Ga0065704_103841991 183
319 3300005293 Ga0065715_10053929 Ga0065715_100539292 183
320 3300005293 Ga0065715_10142356 Ga0065715_101423562 183
321 3300005293 Ga0065715_10212128 Ga0065715_102121284 183
322 3300005293 Ga0065715_10311084 Ga0065715_103110841 183
323 3300005293 Ga0065715_10384925 Ga0065715_103849251 183
324 3300005293 Ga0065715_10406811 Ga0065715_104068111 183
325 3300005293 Ga0065715_10416754 Ga0065715_104167542 183
326 3300005364 Ga0070673_100902740 Ga0070673_1009027401 183
327 3300005436 Ga0070713_101680864 Ga0070713_1016808641 183
328 3300005563 Ga0068855_100132220 Ga0068855_1001322203 183
329 3300005614 Ga0068856_100123168 Ga0068856_1001231683 183
330 3300005616 Ga0068852_100868773 Ga0068852_1008687732 183
331 3300006177 Ga0075362_10236889 Ga0075362_102368891 183
332 3300006942 Ga0099824_1000172 Ga0099824_100017245 183
333 3300006946 Ga0079104_1000154 Ga0079104_100015445 183
334 3300006946 Ga0079104_1066177 Ga0079104_10661772 183
335 3300006948 Ga0099826_10018839 Ga0099826_100188394 183
336 3300009011 Ga0105251_10012672 Ga0105251_100126725 183
337 3300009036 Ga0105244_10013287 Ga0105244_1001328710 183
338 3300013100 Ga0157373_10000054 Ga0157373_100000545 183
339 3300013102 Ga0157371_10008328 Ga0157371_100083289 183
340 3300013104 Ga0157370_10014970 Ga0157370_100149704 183
341 3300013104 Ga0157370_10349444 Ga0157370_103494442 183
342 3300013104 Ga0157370_10550600 Ga0157370_105506001 183
343 3300013104 Ga0157370_10584938 Ga0157370_105849383 183
344 3300013104 Ga0157370_10679295 Ga0157370_106792952 183
345 3300013104 Ga0157370_10710097 Ga0157370_107100972 183
346 3300013105 Ga0157369_10000933 Ga0157369_1000093332 183
347 3300013306 Ga0163162_10004579 Ga0163162_1000457915 183
348 3300013307 Ga0157372_10265687 Ga0157372_102656872 183
349 3300013308 Ga0157375_10406584 Ga0157375_104065841 183
350 3300014326 Ga0157380_10420353 Ga0157380_104203534 183
351 3300015261 Ga0182006_1039099 Ga0182006_10390994 183
352 3300015261 Ga0182006_1070138 Ga0182006_10701382 183
353 3300015261 Ga0182006_1085132 Ga0182006_10851323 183
354 3300017792 Ga0163161_10000009 Ga0163161_1000000946 183
355 3300017792 Ga0163161_10035920 Ga0163161_100359204 183
356 3300017792 Ga0163161_10075458 Ga0163161_100754584 183
357 3300017792 Ga0163161_10652266 Ga0163161_106522661 183
358 3300025728 Ga0207655_1000093 Ga0207655_100009349 183
359 3300025735 Ga0207713_1055674 Ga0207713_10556743 183
360 3300025928 Ga0207700_11353609 Ga0207700_113536091 183
361 3300025939 Ga0207665_10116996 Ga0207665_101169963 183
362 3300026078 Ga0207702_10089289 Ga0207702_100892894 183
363 3300026078 Ga0207702_10216724 Ga0207702_102167244 183
364 3300026116 Ga0207674_10151576 Ga0207674_101515763 183
365 3300027111 Ga0209281_1000158 Ga0209281_100015835 183
366 3300027617 Ga0210002_1007454 Ga0210002_10074544 183
367 3300027876 Ga0209974_10022486 Ga0209974_100224863 183
368 3300030742 Ga0316183_1050239 Ga0316183_10502392 183
369 3300031251 Ga0265327_10069583 Ga0265327_100695833 183
370 3300031456 Ga0307513_10649219 Ga0307513_106492191 183
371 3300031548 Ga0307408_100003021 Ga0307408_1000030217 183
372 3300031727 Ga0316576_10050475 Ga0316576_100504752 183
373 3300031728 Ga0316578_10645338 Ga0316578_106453381 183
374 3300031731 Ga0307405_10000001 Ga0307405_10000001880 183
375 3300031824 Ga0307413_10000568 Ga0307413_1000056817 183
376 3300031852 Ga0307410_10000035 Ga0307410_1000003532 183
377 3300031901 Ga0307406_10000074 Ga0307406_1000007432 183
378 3300031901 Ga0307406_10083679 Ga0307406_100836793 183
379 3300031903 Ga0307407_10000823 Ga0307407_100008237 183
380 3300031911 Ga0307412_10165924 Ga0307412_101659244 183
381 3300032002 Ga0307416_100007927 Ga0307416_1000079277 183
382 3300032004 Ga0307414_10000005 Ga0307414_1000000531 183
383 3300032004 Ga0307414_10000998 Ga0307414_1000099820 183
384 3300032004 Ga0307414_10079883 Ga0307414_100798833 183
385 3300032004 Ga0307414_10120028 Ga0307414_101200283 183
386 3300032004 Ga0307414_10131990 Ga0307414_101319903 183
387 3300032004 Ga0307414_10212444 Ga0307414_102124444 183
388 3300032004 Ga0307414_10526241 Ga0307414_105262412 183
389 3300032004 Ga0307414_11292051 Ga0307414_112920511 183
390 3300032005 Ga0307411_10000010 Ga0307411_1000001045 183
391 3300032005 Ga0307411_10310609 Ga0307411_103106092 183
392 3300032168 Ga0316593_10079296 Ga0316593_100792962 183
393 3300033180 Ga0307510_10022058 Ga0307510_1002205812 183
394 3300033541 Ga0316596_1001316 Ga0316596_10013166 183
395 3300035398 Ga0316574_0079726 Ga0316574_0079726_961_1515 183
396 3300035398 Ga0316574_0178738 Ga0316574_0178738_352_939 183
397 3300035398 Ga0316574_0210185 Ga0316574_0210185_304_855 183
398 3300036712 Ga0316584_0126509 Ga0316584_0126509_1193_1747 183
399 3300037471 Ga0395905_0003630 Ga0395905_0003630_2772_3353 183
400 3300041407 Ga0439447_000448 Ga0439447_000448_12632_13183 183
401 3300041411 Ga0439466_0010146 Ga0439466_0010146_2550_3101 183
402 3300041444 Ga0451790_01534 Ga0451790_01534_86_637 183
403 3300041445 Ga0451792_14905 Ga0451792_14905_205_756 183
404 3300041452 Ga0451793_0667393 Ga0451793_0667393_350_901 183
405 3300041494 Ga0451837_0040229 Ga0451837_0040229_866_1420 183
406 3300042531 Ga0450918_035777 Ga0450918_035777_224_775 183
407 3300042876 Ga0451577_0505106 Ga0451577_0505106_280_852 183
408 3300044673 Ga0453683_0576795 Ga0453683_0576795_146_697 183
409 3300046453 Ga0495627_002663 Ga0495627_002663_2967_3518 183
410 3300046501 Ga0495607_0034827 Ga0495607_0034827_1842_2393 183
411 3300046507 Ga0495606_0060387 Ga0495606_0060387_322_873 183
412 3300046507 Ga0495606_0101329 Ga0495606_0101329_1054_1605 183
413 3300046513 Ga0495616_0010134 Ga0495616_0010134_4097_4648 183
414 3300046522 Ga0495643_0000948 Ga0495643_0000948_13319_13870 183
415 3300046558 Ga0495633_0108168 Ga0495633_0108168_538_1089 183
416 3300046660 Ga0495625_0201614 Ga0495625_0201614_698_1249 183
417 3300046692 Ga0495671_0072492 Ga0495671_0072492_844_1395 183
418 3300048918 Ga0496115_0002997 Ga0496115_0002997_10965_11516 183
419 3300048919 Ga0496116_0000156 Ga0496116_0000156_62762_63313 183
420 3300048924 Ga0496121_0075674 Ga0496121_0075674_1963_2514 183
421 3300048924 Ga0496121_0288867 Ga0496121_0288867_317_868 183
422 3300048924 Ga0496121_0659086 Ga0496121_0659086_22_573 183
423 3300048927 Ga0496124_0040283 Ga0496124_0040283_1880_2431 183
424 3300048927 Ga0496124_0473711 Ga0496124_0473711_57_608 183
425 3300048928 Ga0496125_0000062 Ga0496125_0000062_62713_63264 183
426 3300048928 Ga0496125_0000452 Ga0496125_0000452_33014_33565 183
427 3300048929 Ga0496126_0026501 Ga0496126_0026501_4414_4965 183
428 3300049130 Ga0501310_000037 Ga0501310_000037_1646_2197 183
429 3300049530 Ga0501314_000012 Ga0501314_000012_5487_6038 183
430 3300049535 Ga0501319_000006 Ga0501319_000006_2098_2649 183
431 3300049536 Ga0501320_000057 Ga0501320_000057_2175_2726 183
432 3300049539 Ga0501323_000034 Ga0501323_000034_2248_2799 183
433 3300049539 Ga0501323_002460 Ga0501323_002460_1005_1556 183
434 3300049540 Ga0501324_000007 Ga0501324_000007_1818_2369 183
435 3300049542 Ga0501326_00015 Ga0501326_00015_4238_4789 183
436 3300049550 Ga0501334_00025 Ga0501334_00025_2026_2577 183
437 3300049569 Ga0501032_0007396 Ga0501032_0007396_6060_6614 183
438 3300049569 Ga0501032_0723090 Ga0501032_0723090_62_616 183
439 3300049570 Ga0501033_0000065 Ga0501033_0000065_31904_32458 183
440 3300049571 Ga0501034_0001909 Ga0501034_0001909_19862_20416 183
441 3300049572 Ga0501036_0001190 Ga0501036_0001190_6620_7174 183
442 3300049573 Ga0501037_0000701 Ga0501037_0000701_19886_20440 183
443 3300049574 Ga0501038_0008841 Ga0501038_0008841_2907_3461 183
444 3300049574 Ga0501038_0149188 Ga0501038_0149188_1333_1887 183
445 3300049575 Ga0501039_0005495 Ga0501039_0005495_7069_7623 183
446 3300049576 Ga0501040_0050893 Ga0501040_0050893_1606_2166 183
447 3300049579 Ga0501043_0000983 Ga0501043_0000983_6067_6621 183
448 3300049671 Ga0501238_000005 Ga0501238_000005_17231_17782 183
449 3300049679 Ga0501249_000797 Ga0501249_000797_4901_5452 183
450 3300049758 Ga0501241_007664 Ga0501241_007664_997_1548 183
451 3300049763 Ga0501266_000009 Ga0501266_000009_62001_62552 183
452 3300049766 Ga0501269_000765 Ga0501269_000765_1678_2229 183
453 3300049822 Ga0501035_0114203 Ga0501035_0114203_584_1135 183
454 3300049823 Ga0501044_0001697 Ga0501044_0001697_19771_20325 183
455 3300049823 Ga0501044_0969583 Ga0501044_0969583_161_712 183
456 3300049824 Ga0501045_0000463 Ga0501045_0000463_6293_6847 183
457 3300050489 nmdc:mga03683_200421_c1 nmdc:mga03683_200421_c1_71_622 183
458 3300053090 Ga0500646_0003988 Ga0500646_0003988_1229_1780 183
459 3300053096 Ga0500641_0000029 Ga0500641_0000029_101753_102304 183
460 3300053096 Ga0500641_0003322 Ga0500641_0003322_4181_4732 183
461 3300053096 Ga0500641_0049673 Ga0500641_0049673_725_1276 183
462 3300053118 Ga0500594_0020923 Ga0500594_0020923_844_1395 183
463 3300053134 Ga0500658_0000006 Ga0500658_0000006_64406_64957 183
464 3300053726 Ga0500584_010431 Ga0500584_010431_2437_2988 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

19

125

0.95

PF00467

KOW

KOW motif

144

179

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvq-assembly1.cif.gz_G solution structure of nuse:nusg-ctd complex 0.9582 130 183
4ytl-assembly2.cif.gz_B structure of the kow2-kow3 domain of transcription elongation factor spt5. 0.9153 130 183
2e70-assembly1.cif.gz_A solution structure of the fifth kow motif of human transcription elongation factor spt5 0.9088 132 183
6c6u-assembly1.cif.gz_N cryoem structure of e.coli rna polymerase elongation complex bound with nusg 0.9087 7 114
7lky-assembly4.cif.gz_D crystal structure of phf1 tudor domain in complex with a peptidomimetic ligand unc6641 0.9007 129 183
ID Description Score Start End Superfamily
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9763 129 183 2.30.30.30
2kvqG00 Mainly Beta;Roll;SH3 type barrels.; 0.9582 130 183 2.30.30.30
1m1gC03 Mainly Beta;Roll;SH3 type barrels.; 0.9517 128 182 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9504 128 183 2.30.30.30
af_Q94AA3_277_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9457 130 180 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3R7WK22-F1-model_v4 deleted 1.005 130 183
AF-A0A496U1S5-F1-model_v4 Transcription termination/antitermination factor NusG 0.9998 129 183 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A3R7WK22-F1-model_v4 deleted 0.9863 130 183
AF-A0A7C3L2S9-F1-model_v4 Transcription termination/antitermination protein NusG 0.9856 129 183 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A7V5R2C2-F1-model_v4 KOW domain-containing protein 0.9824 127 183 GO:0032784

Feature Viewer

pLDDT pTM Quality
85.79 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map