F448950

General Info

Members Datasets Scaffolds Average Seq Length
462 262 924 180

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0137003|Ga0373927_0137003_398_997
Length 199
Sequence LGFERGRRFDKFLGYGSNQMALLKIRKFPDNVLKEPAQPVETIDGSLNGFIDSMAQTMYAAPGVGLAAPQVGDSRRIVVLDTDHENPGKHLLKLINPQVVEAEGSIVWEEGCLSVIDFTADVQRAKRVLVRAWTIEQKEIEIEAEELLAVALQHEIDHLDGKLFIDRISRIKRELYRRKLAKMIKEGKADGKPPSAVRI

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
93 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
94 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
95 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.68
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 18.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0137003 3300035695 Bacteria 1600
2 MBSR1b_contig_3605660 2162886012 Bacteria 1048
3 ARcpr5yngRDRAFT_c007533 3300000043 Unclassified 956
4 ARCol0yngRDRAFT_1001796 3300000652 Unclassified 1686
5 JGI25405J52794_10002797 3300003911 Bacteria 3025
6 Ga0065712_10068974 3300005290 Bacteria 8421
7 Ga0065712_10083479 3300005290 Bacteria 2827
8 Ga0065715_10002567 3300005293 Bacteria 6236
9 Ga0065715_10007213 3300005293 Bacteria 3349
10 Ga0065715_10495370 3300005293 Bacteria 784
11 Ga0065707_10192778 3300005295 Unclassified 1352
12 Ga0070658_10301059 3300005327 Bacteria 1367
13 Ga0070676_10006868 3300005328 Bacteria 6094
14 Ga0070690_100065501 3300005330 Unclassified 2349
15 Ga0070670_100010044 3300005331 Bacteria 8079
16 Ga0070677_10040551 3300005333 Bacteria 1833
17 Ga0070666_10008204 3300005335 Bacteria 6473
18 Ga0070680_100006453 3300005336 Bacteria 8916
19 Ga0070680_100037960 3300005336 Bacteria 3894
20 Ga0070660_100049849 3300005339 Unclassified 3220
21 Ga0070689_100194415 3300005340 Bacteria 1653
22 Ga0070689_100272298 3300005340 Bacteria 1402
23 Ga0070691_10022483 3300005341 Unclassified 2926
24 Ga0070691_10116954 3300005341 Bacteria 1339
25 Ga0070661_100010912 3300005344 Bacteria 6328
26 Ga0070668_100075264 3300005347 Unclassified 2636
27 Ga0070668_100095583 3300005347 Bacteria 2348
28 Ga0070668_100136736 3300005347 Bacteria 1972
29 Ga0070668_100325730 3300005347 Bacteria 1294
30 Ga0070675_100652841 3300005354 Bacteria 956
31 Ga0070674_100026167 3300005356 Unclassified 3807
32 Ga0070673_100015568 3300005364 Bacteria 5348
33 Ga0070659_100575325 3300005366 Bacteria 966
34 Ga0070667_100126507 3300005367 Unclassified 2227
35 Ga0070667_100604517 3300005367 Bacteria 1011
36 Ga0070701_10264834 3300005438 Unclassified 1043
37 Ga0070711_100505362 3300005439 Bacteria 997
38 Ga0070705_100010222 3300005440 Bacteria 4691
39 Ga0070705_100239088 3300005440 Bacteria 1268
40 Ga0070700_100086192 3300005441 Unclassified 2039
41 Ga0070700_100834025 3300005441 Bacteria 745
42 Ga0070694_100072846 3300005444 Bacteria 2371
43 Ga0070708_100188320 3300005445 Unclassified 1930
44 Ga0070708_100534632 3300005445 Unclassified 1106
45 Ga0070708_101051280 3300005445 Bacteria 763
46 Ga0070663_100062353 3300005455 Unclassified 2687
47 Ga0070678_100076814 3300005456 Unclassified 2517
48 Ga0070662_100752229 3300005457 Unclassified 827
49 Ga0070681_10002698 3300005458 Bacteria 16327
50 Ga0070681_10063052 3300005458 Bacteria 3679
51 Ga0068867_100088816 3300005459 Bacteria 2343
52 Ga0070706_100033912 3300005467 Unclassified 4713
53 Ga0070706_100129597 3300005467 Bacteria 2354
54 Ga0070706_100504334 3300005467 Bacteria 1126
55 Ga0070706_100599274 3300005467 Unclassified 1024
56 Ga0070706_100921600 3300005467 Bacteria 807
57 Ga0070707_100038529 3300005468 Unclassified 4566
58 Ga0070707_100723880 3300005468 Bacteria 958
59 Ga0070698_100096619 3300005471 Bacteria 2931
60 Ga0070698_100104469 3300005471 Bacteria 2803
61 Ga0070698_100788234 3300005471 Unclassified 894
62 Ga0070699_100389593 3300005518 Unclassified 1259
63 Ga0070679_100007323 3300005530 Bacteria 10310
64 Ga0070679_100311301 3300005530 Bacteria 1524
65 Ga0070684_100633161 3300005535 Bacteria 995
66 Ga0070684_100971153 3300005535 Bacteria 797
67 Ga0070697_100041964 3300005536 Bacteria 3703
68 Ga0070697_100129153 3300005536 Eukaryota 2118
69 Ga0070697_100285694 3300005536 Bacteria 1416
70 Ga0070697_100581255 3300005536 Bacteria 984
71 Ga0070697_100780486 3300005536 Bacteria 845
72 Ga0068853_100062188 3300005539 Bacteria 3230
73 Ga0070672_101133858 3300005543 Unclassified 696
74 Ga0070686_100234972 3300005544 Bacteria 1332
75 Ga0070695_100035313 3300005545 Bacteria 3140
76 Ga0070695_100106192 3300005545 Unclassified 1899
77 Ga0070696_100171183 3300005546 Bacteria 1605
78 Ga0070696_100688300 3300005546 Unclassified 832
79 Ga0070665_100438810 3300005548 Bacteria 1315
80 Ga0070665_100449391 3300005548 Bacteria 1298
81 Ga0070704_100023780 3300005549 Bacteria 4008
82 Ga0070704_100036975 3300005549 Bacteria 3331
83 Ga0070704_100126205 3300005549 Bacteria 1975
84 Ga0070704_100491417 3300005549 Unclassified 1063
85 Ga0068855_101107302 3300005563 Bacteria 828
86 Ga0070664_100002221 3300005564 Bacteria 15607
87 Ga0070664_100219899 3300005564 Bacteria 1699
88 Ga0068857_100308416 3300005577 Bacteria 1460
89 Ga0068854_100125501 3300005578 Bacteria 1954
90 Ga0068856_100003200 3300005614 Bacteria 16677
91 Ga0068856_100271985 3300005614 Bacteria 1710
92 Ga0068859_100049527 3300005617 Bacteria 4218
93 Ga0068859_100205630 3300005617 Bacteria 2054
94 Ga0068859_100829555 3300005617 Bacteria 1011
95 Ga0068870_10175578 3300005840 Unclassified 1282
96 Ga0068863_100556658 3300005841 Unclassified 1133
97 Ga0068863_100573490 3300005841 Bacteria 1115
98 Ga0068863_100780709 3300005841 Unclassified 952
99 Ga0068858_100695478 3300005842 Bacteria 989
100 Ga0068860_100146781 3300005843 Bacteria 2270
101 Ga0068860_100563383 3300005843 Bacteria 1142
102 Ga0068862_100078644 3300005844 Bacteria 2858
103 Ga0068862_100408864 3300005844 Bacteria 1271
104 Ga0068862_100598743 3300005844 Unclassified 1058
105 Ga0081455_10000711 3300005937 Bacteria 43229
106 Ga0081455_10202877 3300005937 Bacteria 1484
107 Ga0081538_10051320 3300005981 Bacteria 2478
108 Ga0081538_10070870 3300005981 Bacteria 1921
109 Ga0081540_1110264 3300005983 Bacteria 1165
110 Ga0081539_10000368 3300005985 Bacteria 98580
111 Ga0070715_10131549 3300006163 Unclassified 1205
112 Ga0070716_100086123 3300006173 Bacteria 1889
113 Ga0070712_100110905 3300006175 Bacteria 2047
114 Ga0075428_100189007 3300006844 Bacteria 2228
115 Ga0075428_100498403 3300006844 Unclassified 1303
116 Ga0075428_101050020 3300006844 Bacteria 862
117 Ga0075428_101779016 3300006844 Bacteria 642
118 Ga0075430_100014897 3300006846 Bacteria 6623
119 Ga0075430_100132918 3300006846 Bacteria 2074
120 Ga0075431_100085307 3300006847 Bacteria 3259
121 Ga0075431_100121284 3300006847 Bacteria 2698
122 Ga0075431_100184230 3300006847 Unclassified 2142
123 Ga0075431_100578369 3300006847 Bacteria 1109
124 Ga0075431_100916166 3300006847 Bacteria 846
125 Ga0075433_10013095 3300006852 Bacteria 6730
126 Ga0075433_10151484 3300006852 Unclassified 2063
127 Ga0075433_10377389 3300006852 Bacteria 1252
128 Ga0075433_10542075 3300006852 Unclassified 1023
129 Ga0075434_100076907 3300006871 Bacteria 3332
130 Ga0075434_100166727 3300006871 Unclassified 2223
131 Ga0075434_100617118 3300006871 Unclassified 1103
132 Ga0075434_101016245 3300006871 Bacteria 843
133 Ga0075429_100100926 3300006880 Unclassified 2519
134 Ga0075429_100419182 3300006880 Bacteria 1172
135 Ga0068865_100121955 3300006881 Bacteria 1940
136 Ga0068865_100566707 3300006881 Unclassified 956
137 Ga0068865_100779581 3300006881 Bacteria 823
138 Ga0075436_100012185 3300006914 Bacteria 5891
139 Ga0075436_100847933 3300006914 Bacteria 682
140 Ga0097620_100049530 3300006931 Bacteria 4218
141 Ga0097620_100205620 3300006931 Bacteria 2054
142 Ga0097620_100829625 3300006931 Bacteria 1011
143 Ga0075435_100052486 3300007076 Unclassified 3286
144 Ga0105240_10038235 3300009093 Bacteria 6157
145 Ga0105240_10117596 3300009093 Bacteria 3204
146 Ga0105240_10380345 3300009093 Bacteria 1595
147 Ga0111539_10009485 3300009094 Bacteria 12281
148 Ga0111539_10098691 3300009094 Bacteria 3430
149 Ga0111539_10379200 3300009094 Bacteria 1646
150 Ga0111539_10931330 3300009094 Bacteria 1010
151 Ga0105245_10157353 3300009098 Unclassified 2153
152 Ga0105247_10176621 3300009101 Unclassified 1423
153 Ga0105247_10390946 3300009101 Bacteria 988
154 Ga0114129_10013360 3300009147 Bacteria 11698
155 Ga0114129_10021068 3300009147 Bacteria 9257
156 Ga0114129_10044231 3300009147 Bacteria 6264
157 Ga0114129_10047137 3300009147 Bacteria 6057
158 Ga0114129_10132144 3300009147 Bacteria 3427
159 Ga0114129_10590040 3300009147 Bacteria 1441
160 Ga0114129_10626029 3300009147 Bacteria 1391
161 Ga0114129_10874591 3300009147 Bacteria 1141
162 Ga0114129_10903785 3300009147 Bacteria 1119
163 Ga0105243_11068748 3300009148 Bacteria 814
164 Ga0105241_10104284 3300009174 Unclassified 2259
165 Ga0105241_10566079 3300009174 Bacteria 1022
166 Ga0105242_10127233 3300009176 Unclassified 2194
167 Ga0105242_10638591 3300009176 Bacteria 1034
168 Ga0105237_10059208 3300009545 Bacteria 3832
169 Ga0105238_10016545 3300009551 Bacteria 7466
170 Ga0105249_10172517 3300009553 Bacteria 2098
171 Ga0105249_10242477 3300009553 Bacteria 1783
172 Ga0105239_10067273 3300010375 Bacteria 3935
173 Ga0105239_10974225 3300010375 Bacteria 975
174 Ga0105246_10026038 3300011119 Unclassified 3816
175 Ga0157345_1005332 3300012498 Unclassified 991
176 Ga0157314_1014540 3300012500 Unclassified 733
177 Ga0157324_1007232 3300012506 Unclassified 860
178 Ga0157315_1002099 3300012508 Unclassified 1205
179 Ga0157373_10115672 3300013100 Bacteria 1885
180 Ga0157370_10469185 3300013104 Bacteria 1157
181 Ga0157374_10044898 3300013296 Bacteria 4087
182 Ga0157378_10045289 3300013297 Bacteria 3908
183 Ga0157378_10096480 3300013297 Unclassified 2694
184 Ga0163162_10020067 3300013306 Bacteria 6563
185 Ga0163162_10033313 3300013306 Bacteria 5119
186 Ga0163162_10193965 3300013306 Bacteria 2159
187 Ga0163162_10410126 3300013306 Bacteria 1487
188 Ga0157372_10044822 3300013307 Bacteria 4902
189 Ga0157375_10779604 3300013308 Bacteria 1106
190 Ga0157375_11213607 3300013308 Unclassified 885
191 Ga0157375_11227848 3300013308 Unclassified 880
192 Ga0157375_11971705 3300013308 Unclassified 694
193 Ga0157380_10161724 3300014326 Bacteria 1947
194 Ga0157379_10318339 3300014968 Bacteria 1420
195 Ga0157379_10345983 3300014968 Bacteria 1360
196 Ga0157379_10413190 3300014968 Bacteria 1242
197 Ga0157376_10058820 3300014969 Bacteria 3221
198 Ga0163161_10279445 3300017792 Unclassified 1309
199 Ga0197907_10491903 3300020069 Bacteria 1002
200 Ga0206355_1720799 3300020076 Bacteria 609
201 Ga0206352_11223901 3300020078 Bacteria 658
202 Ga0206350_11108487 3300020080 Bacteria 740
203 Ga0213872_10190080 3300021361 Bacteria 884
204 Ga0224712_10083632 3300022467 Bacteria 1323
205 Ga0207688_10024217 3300025901 Bacteria 3328
206 Ga0207688_10034135 3300025901 Bacteria 2816
207 Ga0207645_10000324 3300025907 Bacteria 39789
208 Ga0207684_10243169 3300025910 Unclassified 1552
209 Ga0207684_10480934 3300025910 Bacteria 1065
210 Ga0207684_10501001 3300025910 Bacteria 1041
211 Ga0207684_10791726 3300025910 Bacteria 802
212 Ga0207707_10026340 3300025912 Bacteria 5082
213 Ga0207707_10183087 3300025912 Bacteria 1828
214 Ga0207695_10011847 3300025913 Bacteria 10519
215 Ga0207695_10937961 3300025913 Bacteria 745
216 Ga0207671_10153430 3300025914 Bacteria 1780
217 Ga0207693_10259494 3300025915 Bacteria 1363
218 Ga0207663_10426161 3300025916 Bacteria 1019
219 Ga0207660_10080473 3300025917 Bacteria 2393
220 Ga0207660_10096377 3300025917 Bacteria 2202
221 Ga0207660_11230582 3300025917 Bacteria 609
222 Ga0207662_10116790 3300025918 Bacteria 1669
223 Ga0207657_10026569 3300025919 Bacteria 5316
224 Ga0207649_10034600 3300025920 Unclassified 3029
225 Ga0207652_10034117 3300025921 Bacteria 4288
226 Ga0207652_10288576 3300025921 Bacteria 1480
227 Ga0207681_10034232 3300025923 Bacteria 3338
228 Ga0207694_10002793 3300025924 Bacteria 14095
229 Ga0207650_10000318 3300025925 Bacteria 47192
230 Ga0207690_10057874 3300025932 Unclassified 2620
231 Ga0207706_10008073 3300025933 Bacteria 9714
232 Ga0207686_10594428 3300025934 Bacteria 870
233 Ga0207670_10124707 3300025936 Bacteria 1878
234 Ga0207670_10192604 3300025936 Bacteria 1544
235 Ga0207669_10134843 3300025937 Bacteria 1703
236 Ga0207665_10195715 3300025939 Bacteria 1471
237 Ga0207691_10019467 3300025940 Bacteria 6421
238 Ga0207689_10176799 3300025942 Bacteria 1760
239 Ga0207679_10051445 3300025945 Bacteria 3015
240 Ga0207668_10092097 3300025972 Bacteria 2230
241 Ga0207668_10271322 3300025972 Bacteria 1387
242 Ga0207668_10443919 3300025972 Unclassified 1106
243 Ga0207640_10992545 3300025981 Unclassified 738
244 Ga0207658_11259859 3300025986 Bacteria 676
245 Ga0207703_10588567 3300026035 Bacteria 1052
246 Ga0207639_10132922 3300026041 Bacteria 2062
247 Ga0207678_10024204 3300026067 Bacteria 5304
248 Ga0207708_10039926 3300026075 Bacteria 3577
249 Ga0207708_10086658 3300026075 Unclassified 2410
250 Ga0207641_10330577 3300026088 Bacteria 1448
251 Ga0207641_10389857 3300026088 Unclassified 1336
252 Ga0207641_10545439 3300026088 Bacteria 1130
253 Ga0207648_10079495 3300026089 Bacteria 2861
254 Ga0207676_10946026 3300026095 Bacteria 847
255 Ga0207675_100082774 3300026118 Bacteria 3010
256 Ga0207683_10000497 3300026121 Bacteria 36379
257 Ga0209999_1004106 3300027543 Bacteria 2618
258 Ga0210002_1014153 3300027617 Unclassified 1249
259 Ga0209983_1030991 3300027665 Bacteria 1140
260 Ga0209971_1002978 3300027682 Bacteria 4049
261 Ga0209998_10004842 3300027717 Bacteria 2840
262 Ga0209974_10004732 3300027876 Bacteria 4832
263 Ga0207428_10023047 3300027907 Bacteria 5242
264 Ga0268265_10057170 3300028380 Bacteria 2972
265 Ga0268264_10490332 3300028381 Unclassified 1197
266 Ga0268264_11595342 3300028381 Bacteria 663
267 Ga0265760_10022290 3300031090 Bacteria 1835
268 Ga0265332_10009125 3300031238 Bacteria 4435
269 Ga0265325_10114447 3300031241 Bacteria 1307
270 Ga0265339_10005630 3300031249 Bacteria 8312
271 Ga0265339_10012259 3300031249 Bacteria 5241
272 Ga0265331_10001911 3300031250 Bacteria 14591
273 Ga0265316_10293310 3300031344 Bacteria 1186
274 Ga0307408_100139911 3300031548 Bacteria 1899
275 Ga0265314_10001292 3300031711 Bacteria 28401
276 Ga0265314_10011922 3300031711 Bacteria 7136
277 Ga0307413_10013594 3300031824 Bacteria 4098
278 Ga0307413_10014972 3300031824 Bacteria 3960
279 Ga0307410_10047829 3300031852 Bacteria 2861
280 Ga0307407_10032433 3300031903 Bacteria 2840
281 Ga0307409_100024484 3300031995 Bacteria 4211
282 Ga0307416_100022135 3300032002 Bacteria 4581
283 Ga0307416_100032332 3300032002 Bacteria 3951
284 Ga0307416_100062945 3300032002 Unclassified 3036
285 Ga0307414_10051410 3300032004 Bacteria 2861
286 Ga0307414_10271597 3300032004 Bacteria 1420
287 Ga0307411_10004054 3300032005 Bacteria 6937
288 Ga0307411_10046255 3300032005 Bacteria 2804
289 Ga0307415_100003089 3300032126 Bacteria 8411
290 Ga0307415_100012406 3300032126 Bacteria 4926
291 Ga0373926_0008353 3300035083 Bacteria 3444
292 Ga0373928_0031910 3300035084 Bacteria 1172
293 Ga0373946_0005612 3300035171 Bacteria 4531
294 Ga0373962_0031590 3300035242 Bacteria 1453
295 Ga0373962_0190301 3300035242 Bacteria 690
296 Ga0373931_0178729 3300035691 Bacteria 1255
297 Ga0373931_0195344 3300035691 Bacteria 1206
298 Ga0373935_0087033 3300035692 Bacteria 2039
299 Ga0373927_0553636 3300035695 Bacteria 760
300 Ga0373927_0797058 3300035695 Bacteria 624
301 Ga0373937_0996381 3300036401 Bacteria 787
302 Ga0316584_0538467 3300036712 Bacteria 816
303 Ga0373925_0006219 3300037068 Bacteria 8811
304 Ga0373925_0259807 3300037068 Bacteria 1395
305 Ga0373925_0278384 3300037068 Bacteria 1347
306 Ga0395905_1704310 3300037471 Bacteria 535
307 Ga0436361_0721965 3300039447 Bacteria 2459
308 Ga0436362_0174700 3300039453 Unclassified 1339
309 Ga0439446_0017526 3300042156 Bacteria 2003
310 Ga0439435_0052944 3300042436 Bacteria 1166
311 Ga0439444_0072539 3300042437 Unclassified 740
312 Ga0439460_0211252 3300042461 Bacteria 663
313 Ga0451577_0245396 3300042876 Bacteria 1621
314 Ga0451577_1372325 3300042876 Bacteria 627
315 Ga0453683_0002667 3300044673 Bacteria 13647
316 Ga0453684_0644197 3300044712 Bacteria 1157
317 Ga0451576_0359038 3300045051 Unclassified 1526
318 Ga0451576_1398758 3300045051 Unclassified 728
319 Ga0495603_0600431 3300046455 Bacteria 630
320 Ga0495651_0065497 3300046462 Bacteria 2775
321 Ga0495651_0424539 3300046462 Bacteria 864
322 Ga0495639_0214561 3300046475 Bacteria 945
323 Ga0495585_0242470 3300046492 Unclassified 902
324 Ga0495640_0193964 3300046533 Bacteria 1290
325 Ga0495658_0139420 3300046683 Unclassified 1482
326 Ga0495604_0026112 3300047317 Bacteria 4650
327 Ga0495680_0231172 3300047322 Bacteria 1317
328 Ga0495684_0768090 3300047471 Bacteria 633
329 Ga0495602_0045965 3300048088 Bacteria 3948
330 Ga0496100_0392334 3300048903 Bacteria 1056
331 Ga0496102_0243283 3300048905 Unclassified 1696
332 Ga0496102_0335568 3300048905 Bacteria 1424
333 Ga0496106_0119639 3300048909 Bacteria 2057
334 Ga0496108_0049267 3300048911 Bacteria 3523
335 Ga0496108_0305947 3300048911 Bacteria 1385
336 Ga0496109_0003357 3300048912 Bacteria 13393
337 Ga0496109_0111504 3300048912 Bacteria 2544
338 Ga0496109_0173420 3300048912 Unclassified 2024
339 Ga0496110_0211914 3300048913 Bacteria 1761
340 Ga0496111_0015326 3300048914 Bacteria 5259
341 Ga0496112_0002245 3300048915 Bacteria 15439
342 Ga0496112_0011470 3300048915 Bacteria 8094
343 Ga0496112_0020925 3300048915 Bacteria 6211
344 Ga0496112_0280128 3300048915 Bacteria 1615
345 Ga0496113_0017127 3300048916 Bacteria 5023
346 Ga0496113_0455406 3300048916 Bacteria 1028
347 Ga0501292_013673 3300049515 Bacteria 1251
348 Ga0501299_037284 3300049522 Bacteria 962
349 Ga0501031_0031462 3300049568 Unclassified 3462
350 Ga0501031_0044369 3300049568 Bacteria 2901
351 Ga0501033_0010217 3300049570 Bacteria 7206
352 Ga0501034_0171013 3300049571 Bacteria 2140
353 Ga0501036_0005872 3300049572 Bacteria 9945
354 Ga0501036_0760948 3300049572 Bacteria 799
355 Ga0501037_0011205 3300049573 Bacteria 6600
356 Ga0501038_0002353 3300049574 Bacteria 17620
357 Ga0501039_0005567 3300049575 Bacteria 9531
358 Ga0501039_0071811 3300049575 Bacteria 2690
359 Ga0501039_0104375 3300049575 Bacteria 2212
360 Ga0501040_0000257 3300049576 Bacteria 31177
361 Ga0501040_0020103 3300049576 Bacteria 4448
362 Ga0501041_0000147 3300049577 Bacteria 31091
363 Ga0501041_0202196 3300049577 Bacteria 1245
364 Ga0501042_0000310 3300049578 Bacteria 24323
365 Ga0501042_0239583 3300049578 Bacteria 1309
366 Ga0501043_0057927 3300049579 Unclassified 3041
367 Ga0501046_0009860 3300049580 Bacteria 8231
368 Ga0501046_0035313 3300049580 Bacteria 4029
369 Ga0501046_0052174 3300049580 Bacteria 3224
370 Ga0501046_0285951 3300049580 Bacteria 1207
371 Ga0501047_0158013 3300049581 Bacteria 2140
372 Ga0501048_0001644 3300049582 Bacteria 17033
373 Ga0501048_0258728 3300049582 Bacteria 1236
374 Ga0501068_0012828 3300049584 Unclassified 4759
375 Ga0501068_0061302 3300049584 Bacteria 2286
376 Ga0501069_0191572 3300049585 Bacteria 1183
377 Ga0501071_0000628 3300049587 Bacteria 18332
378 Ga0501071_0059500 3300049587 Bacteria 2764
379 Ga0501071_0102507 3300049587 Bacteria 2110
380 Ga0501071_0117102 3300049587 Bacteria 1973
381 Ga0501072_0001002 3300049588 Bacteria 20896
382 Ga0501072_0066392 3300049588 Bacteria 2846
383 Ga0501073_0037236 3300049589 Unclassified 3455
384 Ga0501074_0028728 3300049590 Unclassified 4029
385 Ga0501075_0000732 3300049591 Bacteria 20380
386 Ga0501075_0027679 3300049591 Bacteria 4179
387 Ga0501075_0077743 3300049591 Bacteria 2511
388 Ga0501075_0370358 3300049591 Unclassified 1092
389 Ga0501076_0000510 3300049592 Bacteria 24634
390 Ga0501076_0026998 3300049592 Bacteria 4452
391 Ga0501076_0046129 3300049592 Bacteria 3443
392 Ga0501076_0352101 3300049592 Unclassified 1209
393 Ga0501077_0011342 3300049593 Bacteria 5566
394 Ga0501077_0032355 3300049593 Unclassified 3329
395 Ga0501077_0073107 3300049593 Bacteria 2172
396 Ga0501217_117823 3300049661 Bacteria 768
397 Ga0501079_0000267 3300049741 Bacteria 32073
398 Ga0501079_0036363 3300049741 Bacteria 3793
399 Ga0501079_0143160 3300049741 Bacteria 1862
400 Ga0501079_1095406 3300049741 Bacteria 628
401 Ga0501080_0006138 3300049742 Bacteria 10780
402 Ga0501080_1180903 3300049742 Bacteria 658
403 Ga0501081_0000973 3300049743 Bacteria 17042
404 Ga0501081_0010567 3300049743 Bacteria 6028
405 Ga0501081_0548019 3300049743 Unclassified 864
406 Ga0501083_0046902 3300049744 Unclassified 2921
407 Ga0501035_0013482 3300049822 Bacteria 7545
408 Ga0501035_0016376 3300049822 Bacteria 6838
409 Ga0501044_1048711 3300049823 Bacteria 686
410 Ga0501045_0000960 3300049824 Bacteria 18837
411 Ga0501045_0059249 3300049824 Bacteria 2804
412 Ga0501045_0176186 3300049824 Bacteria 1593
413 Ga0501212_060908 3300049851 Bacteria 654
414 nmdc:mga05p37_17287_c1 3300050507 Bacteria 8700
415 nmdc:mga05p37_193386_c1 3300050507 Bacteria 2469
416 nmdc:mga05p37_439685_c1 3300050507 Bacteria 1513
417 nmdc:mga05p37_515625_c1 3300050507 Bacteria 1369
418 nmdc:mga05p37_5563_c1 3300050507 Bacteria 14817
419 nmdc:mga05p37_65313_c1 3300050507 Bacteria 4477
420 nmdc:mga05p37_656234_c1 3300050507 Bacteria 1174
421 nmdc:mga05p37_785001_c1 3300050507 Bacteria 1044
422 nmdc:mga05p37_9075_c1 3300050507 Bacteria 11755
423 nmdc:mga09592_1078293_c1 3300050508 Bacteria 668
424 nmdc:mga0qj67_221884_c1 3300050509 Bacteria 1534
425 nmdc:mga0qj67_246840_c1 3300050509 Bacteria 1448
426 nmdc:mga0qj67_580086_c1 3300050509 Unclassified 898
427 nmdc:mga0qj67_74217_c1 3300050509 Bacteria 2718
428 nmdc:mga0qj67_7678_c1 3300050509 Bacteria 7971
429 nmdc:mga06r32_114292_c1 3300050510 Bacteria 2658
430 nmdc:mga06r32_119243_c1 3300050510 Bacteria 2601
431 nmdc:mga06r32_130007_c1 3300050510 Bacteria 2490
432 nmdc:mga08y16_1350364_c1 3300050511 Unclassified 678
433 nmdc:mga08y16_209047_c1 3300050511 Bacteria 2021
434 nmdc:mga08y16_28852_c1 3300050511 Bacteria 5850
435 nmdc:mga0n895_1082971_c1 3300050512 Bacteria 779
436 nmdc:mga0n895_11529_c1 3300050512 Bacteria 7892
437 nmdc:mga0n895_18576_c1 3300050512 Bacteria 6438
438 nmdc:mga0n895_708607_c1 3300050512 Bacteria 1002
439 nmdc:mga0rr50_1334788_c1 3300050513 Bacteria 608
440 nmdc:mga0rr50_228253_c1 3300050513 Bacteria 1540
441 nmdc:mga0rr50_352723_c1 3300050513 Unclassified 1237
442 nmdc:mga0rr50_66799_c1 3300050513 Unclassified 2729
443 nmdc:mga08x19_10990_c1 3300050514 Bacteria 5447
444 nmdc:mga08x19_247944_c1 3300050514 Unclassified 1229
445 nmdc:mga08x19_378489_c1 3300050514 Bacteria 991
446 nmdc:mga08x19_88521_c1 3300050514 Unclassified 2041
447 nmdc:mga0a205_109411_c1 3300050515 Bacteria 2661
448 nmdc:mga0a205_466026_c1 3300050515 Bacteria 1123
449 Ga0501084_0003814 3300054114 Bacteria 12253
450 Ga0501084_0159420 3300054114 Bacteria 1903
451 Ga0501084_0359244 3300054114 Bacteria 1231
452 Ga0590071_075130 3300059421 Viruses 836
453 Ga0590075_011209 3300059424 Bacteria 2165
454 Ga0587070_136487 3300059491 Bacteria 602
455 Ga0501082_0009853 3300060353 Bacteria 8233
456 Ga0501082_0023136 3300060353 Bacteria 5359
457 Ga0501082_0879937 3300060353 Bacteria 784
458 Ga0530510_0001110 3300061734 Bacteria 17877
459 Ga0530510_0017839 3300061734 Bacteria 5032
460 Ga0530510_0099835 3300061734 Bacteria 2122
461 Ga0530510_0176619 3300061734 Bacteria 1583
462 Ga0530510_0312746 3300061734 Bacteria 1176
463 Ga0373927_0137003
464 MBSR1b_contig_3605660
465 ARcpr5yngRDRAFT_c007533
466 ARCol0yngRDRAFT_1001796
467 JGI25405J52794_10002797
468 Ga0065712_10068974
469 Ga0065712_10083479
470 Ga0065715_10002567
471 Ga0065715_10007213
472 Ga0065715_10495370
473 Ga0065707_10192778
474 Ga0070658_10301059
475 Ga0070676_10006868
476 Ga0070690_100065501
477 Ga0070670_100010044
478 Ga0070677_10040551
479 Ga0070666_10008204
480 Ga0070680_100006453
481 Ga0070680_100037960
482 Ga0070660_100049849
483 Ga0070689_100194415
484 Ga0070689_100272298
485 Ga0070691_10022483
486 Ga0070691_10116954
487 Ga0070661_100010912
488 Ga0070668_100075264
489 Ga0070668_100095583
490 Ga0070668_100136736
491 Ga0070668_100325730
492 Ga0070675_100652841
493 Ga0070674_100026167
494 Ga0070673_100015568
495 Ga0070659_100575325
496 Ga0070667_100126507
497 Ga0070667_100604517
498 Ga0070701_10264834
499 Ga0070711_100505362
500 Ga0070705_100010222
501 Ga0070705_100239088
502 Ga0070700_100086192
503 Ga0070700_100834025
504 Ga0070694_100072846
505 Ga0070708_100188320
506 Ga0070708_100534632
507 Ga0070708_101051280
508 Ga0070663_100062353
509 Ga0070678_100076814
510 Ga0070662_100752229
511 Ga0070681_10002698
512 Ga0070681_10063052
513 Ga0068867_100088816
514 Ga0070706_100033912
515 Ga0070706_100129597
516 Ga0070706_100504334
517 Ga0070706_100599274
518 Ga0070706_100921600
519 Ga0070707_100038529
520 Ga0070707_100723880
521 Ga0070698_100096619
522 Ga0070698_100104469
523 Ga0070698_100788234
524 Ga0070699_100389593
525 Ga0070679_100007323
526 Ga0070679_100311301
527 Ga0070684_100633161
528 Ga0070684_100971153
529 Ga0070697_100041964
530 Ga0070697_100129153
531 Ga0070697_100285694
532 Ga0070697_100581255
533 Ga0070697_100780486
534 Ga0068853_100062188
535 Ga0070672_101133858
536 Ga0070686_100234972
537 Ga0070695_100035313
538 Ga0070695_100106192
539 Ga0070696_100171183
540 Ga0070696_100688300
541 Ga0070665_100438810
542 Ga0070665_100449391
543 Ga0070704_100023780
544 Ga0070704_100036975
545 Ga0070704_100126205
546 Ga0070704_100491417
547 Ga0068855_101107302
548 Ga0070664_100002221
549 Ga0070664_100219899
550 Ga0068857_100308416
551 Ga0068854_100125501
552 Ga0068856_100003200
553 Ga0068856_100271985
554 Ga0068859_100049527
555 Ga0068859_100205630
556 Ga0068859_100829555
557 Ga0068870_10175578
558 Ga0068863_100556658
559 Ga0068863_100573490
560 Ga0068863_100780709
561 Ga0068858_100695478
562 Ga0068860_100146781
563 Ga0068860_100563383
564 Ga0068862_100078644
565 Ga0068862_100408864
566 Ga0068862_100598743
567 Ga0081455_10000711
568 Ga0081455_10202877
569 Ga0081538_10051320
570 Ga0081538_10070870
571 Ga0081540_1110264
572 Ga0081539_10000368
573 Ga0070715_10131549
574 Ga0070716_100086123
575 Ga0070712_100110905
576 Ga0075428_100189007
577 Ga0075428_100498403
578 Ga0075428_101050020
579 Ga0075428_101779016
580 Ga0075430_100014897
581 Ga0075430_100132918
582 Ga0075431_100085307
583 Ga0075431_100121284
584 Ga0075431_100184230
585 Ga0075431_100578369
586 Ga0075431_100916166
587 Ga0075433_10013095
588 Ga0075433_10151484
589 Ga0075433_10377389
590 Ga0075433_10542075
591 Ga0075434_100076907
592 Ga0075434_100166727
593 Ga0075434_100617118
594 Ga0075434_101016245
595 Ga0075429_100100926
596 Ga0075429_100419182
597 Ga0068865_100121955
598 Ga0068865_100566707
599 Ga0068865_100779581
600 Ga0075436_100012185
601 Ga0075436_100847933
602 Ga0097620_100049530
603 Ga0097620_100205620
604 Ga0097620_100829625
605 Ga0075435_100052486
606 Ga0105240_10038235
607 Ga0105240_10117596
608 Ga0105240_10380345
609 Ga0111539_10009485
610 Ga0111539_10098691
611 Ga0111539_10379200
612 Ga0111539_10931330
613 Ga0105245_10157353
614 Ga0105247_10176621
615 Ga0105247_10390946
616 Ga0114129_10013360
617 Ga0114129_10021068
618 Ga0114129_10044231
619 Ga0114129_10047137
620 Ga0114129_10132144
621 Ga0114129_10590040
622 Ga0114129_10626029
623 Ga0114129_10874591
624 Ga0114129_10903785
625 Ga0105243_11068748
626 Ga0105241_10104284
627 Ga0105241_10566079
628 Ga0105242_10127233
629 Ga0105242_10638591
630 Ga0105237_10059208
631 Ga0105238_10016545
632 Ga0105249_10172517
633 Ga0105249_10242477
634 Ga0105239_10067273
635 Ga0105239_10974225
636 Ga0105246_10026038
637 Ga0157345_1005332
638 Ga0157314_1014540
639 Ga0157324_1007232
640 Ga0157315_1002099
641 Ga0157373_10115672
642 Ga0157370_10469185
643 Ga0157374_10044898
644 Ga0157378_10045289
645 Ga0157378_10096480
646 Ga0163162_10020067
647 Ga0163162_10033313
648 Ga0163162_10193965
649 Ga0163162_10410126
650 Ga0157372_10044822
651 Ga0157375_10779604
652 Ga0157375_11213607
653 Ga0157375_11227848
654 Ga0157375_11971705
655 Ga0157380_10161724
656 Ga0157379_10318339
657 Ga0157379_10345983
658 Ga0157379_10413190
659 Ga0157376_10058820
660 Ga0163161_10279445
661 Ga0197907_10491903
662 Ga0206355_1720799
663 Ga0206352_11223901
664 Ga0206350_11108487
665 Ga0213872_10190080
666 Ga0224712_10083632
667 Ga0207688_10024217
668 Ga0207688_10034135
669 Ga0207645_10000324
670 Ga0207684_10243169
671 Ga0207684_10480934
672 Ga0207684_10501001
673 Ga0207684_10791726
674 Ga0207707_10026340
675 Ga0207707_10183087
676 Ga0207695_10011847
677 Ga0207695_10937961
678 Ga0207671_10153430
679 Ga0207693_10259494
680 Ga0207663_10426161
681 Ga0207660_10080473
682 Ga0207660_10096377
683 Ga0207660_11230582
684 Ga0207662_10116790
685 Ga0207657_10026569
686 Ga0207649_10034600
687 Ga0207652_10034117
688 Ga0207652_10288576
689 Ga0207681_10034232
690 Ga0207694_10002793
691 Ga0207650_10000318
692 Ga0207690_10057874
693 Ga0207706_10008073
694 Ga0207686_10594428
695 Ga0207670_10124707
696 Ga0207670_10192604
697 Ga0207669_10134843
698 Ga0207665_10195715
699 Ga0207691_10019467
700 Ga0207689_10176799
701 Ga0207679_10051445
702 Ga0207668_10092097
703 Ga0207668_10271322
704 Ga0207668_10443919
705 Ga0207640_10992545
706 Ga0207658_11259859
707 Ga0207703_10588567
708 Ga0207639_10132922
709 Ga0207678_10024204
710 Ga0207708_10039926
711 Ga0207708_10086658
712 Ga0207641_10330577
713 Ga0207641_10389857
714 Ga0207641_10545439
715 Ga0207648_10079495
716 Ga0207676_10946026
717 Ga0207675_100082774
718 Ga0207683_10000497
719 Ga0209999_1004106
720 Ga0210002_1014153
721 Ga0209983_1030991
722 Ga0209971_1002978
723 Ga0209998_10004842
724 Ga0209974_10004732
725 Ga0207428_10023047
726 Ga0268265_10057170
727 Ga0268264_10490332
728 Ga0268264_11595342
729 Ga0265760_10022290
730 Ga0265332_10009125
731 Ga0265325_10114447
732 Ga0265339_10005630
733 Ga0265339_10012259
734 Ga0265331_10001911
735 Ga0265316_10293310
736 Ga0307408_100139911
737 Ga0265314_10001292
738 Ga0265314_10011922
739 Ga0307413_10013594
740 Ga0307413_10014972
741 Ga0307410_10047829
742 Ga0307407_10032433
743 Ga0307409_100024484
744 Ga0307416_100022135
745 Ga0307416_100032332
746 Ga0307416_100062945
747 Ga0307414_10051410
748 Ga0307414_10271597
749 Ga0307411_10004054
750 Ga0307411_10046255
751 Ga0307415_100003089
752 Ga0307415_100012406
753 Ga0373926_0008353
754 Ga0373928_0031910
755 Ga0373946_0005612
756 Ga0373962_0031590
757 Ga0373962_0190301
758 Ga0373931_0178729
759 Ga0373931_0195344
760 Ga0373935_0087033
761 Ga0373927_0553636
762 Ga0373927_0797058
763 Ga0373937_0996381
764 Ga0316584_0538467
765 Ga0373925_0006219
766 Ga0373925_0259807
767 Ga0373925_0278384
768 Ga0395905_1704310
769 Ga0436361_0721965
770 Ga0436362_0174700
771 Ga0439446_0017526
772 Ga0439435_0052944
773 Ga0439444_0072539
774 Ga0439460_0211252
775 Ga0451577_0245396
776 Ga0451577_1372325
777 Ga0453683_0002667
778 Ga0453684_0644197
779 Ga0451576_0359038
780 Ga0451576_1398758
781 Ga0495603_0600431
782 Ga0495651_0065497
783 Ga0495651_0424539
784 Ga0495639_0214561
785 Ga0495585_0242470
786 Ga0495640_0193964
787 Ga0495658_0139420
788 Ga0495604_0026112
789 Ga0495680_0231172
790 Ga0495684_0768090
791 Ga0495602_0045965
792 Ga0496100_0392334
793 Ga0496102_0243283
794 Ga0496102_0335568
795 Ga0496106_0119639
796 Ga0496108_0049267
797 Ga0496108_0305947
798 Ga0496109_0003357
799 Ga0496109_0111504
800 Ga0496109_0173420
801 Ga0496110_0211914
802 Ga0496111_0015326
803 Ga0496112_0002245
804 Ga0496112_0011470
805 Ga0496112_0020925
806 Ga0496112_0280128
807 Ga0496113_0017127
808 Ga0496113_0455406
809 Ga0501292_013673
810 Ga0501299_037284
811 Ga0501031_0031462
812 Ga0501031_0044369
813 Ga0501033_0010217
814 Ga0501034_0171013
815 Ga0501036_0005872
816 Ga0501036_0760948
817 Ga0501037_0011205
818 Ga0501038_0002353
819 Ga0501039_0005567
820 Ga0501039_0071811
821 Ga0501039_0104375
822 Ga0501040_0000257
823 Ga0501040_0020103
824 Ga0501041_0000147
825 Ga0501041_0202196
826 Ga0501042_0000310
827 Ga0501042_0239583
828 Ga0501043_0057927
829 Ga0501046_0009860
830 Ga0501046_0035313
831 Ga0501046_0052174
832 Ga0501046_0285951
833 Ga0501047_0158013
834 Ga0501048_0001644
835 Ga0501048_0258728
836 Ga0501068_0012828
837 Ga0501068_0061302
838 Ga0501069_0191572
839 Ga0501071_0000628
840 Ga0501071_0059500
841 Ga0501071_0102507
842 Ga0501071_0117102
843 Ga0501072_0001002
844 Ga0501072_0066392
845 Ga0501073_0037236
846 Ga0501074_0028728
847 Ga0501075_0000732
848 Ga0501075_0027679
849 Ga0501075_0077743
850 Ga0501075_0370358
851 Ga0501076_0000510
852 Ga0501076_0026998
853 Ga0501076_0046129
854 Ga0501076_0352101
855 Ga0501077_0011342
856 Ga0501077_0032355
857 Ga0501077_0073107
858 Ga0501217_117823
859 Ga0501079_0000267
860 Ga0501079_0036363
861 Ga0501079_0143160
862 Ga0501079_1095406
863 Ga0501080_0006138
864 Ga0501080_1180903
865 Ga0501081_0000973
866 Ga0501081_0010567
867 Ga0501081_0548019
868 Ga0501083_0046902
869 Ga0501035_0013482
870 Ga0501035_0016376
871 Ga0501044_1048711
872 Ga0501045_0000960
873 Ga0501045_0059249
874 Ga0501045_0176186
875 Ga0501212_060908
876 nmdc:mga05p37_17287_c1
877 nmdc:mga05p37_193386_c1
878 nmdc:mga05p37_439685_c1
879 nmdc:mga05p37_515625_c1
880 nmdc:mga05p37_5563_c1
881 nmdc:mga05p37_65313_c1
882 nmdc:mga05p37_656234_c1
883 nmdc:mga05p37_785001_c1
884 nmdc:mga05p37_9075_c1
885 nmdc:mga09592_1078293_c1
886 nmdc:mga0qj67_221884_c1
887 nmdc:mga0qj67_246840_c1
888 nmdc:mga0qj67_580086_c1
889 nmdc:mga0qj67_74217_c1
890 nmdc:mga0qj67_7678_c1
891 nmdc:mga06r32_114292_c1
892 nmdc:mga06r32_119243_c1
893 nmdc:mga06r32_130007_c1
894 nmdc:mga08y16_1350364_c1
895 nmdc:mga08y16_209047_c1
896 nmdc:mga08y16_28852_c1
897 nmdc:mga0n895_1082971_c1
898 nmdc:mga0n895_11529_c1
899 nmdc:mga0n895_18576_c1
900 nmdc:mga0n895_708607_c1
901 nmdc:mga0rr50_1334788_c1
902 nmdc:mga0rr50_228253_c1
903 nmdc:mga0rr50_352723_c1
904 nmdc:mga0rr50_66799_c1
905 nmdc:mga08x19_10990_c1
906 nmdc:mga08x19_247944_c1
907 nmdc:mga08x19_378489_c1
908 nmdc:mga08x19_88521_c1
909 nmdc:mga0a205_109411_c1
910 nmdc:mga0a205_466026_c1
911 Ga0501084_0003814
912 Ga0501084_0159420
913 Ga0501084_0359244
914 Ga0590071_075130
915 Ga0590075_011209
916 Ga0587070_136487
917 Ga0501082_0009853
918 Ga0501082_0023136
919 Ga0501082_0879937
920 Ga0530510_0001110
921 Ga0530510_0017839
922 Ga0530510_0099835
923 Ga0530510_0176619
924 Ga0530510_0312746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

22

174

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9776 3 160
3k6l-assembly1.cif.gz_A the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9706 2 166
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.9663 1 151
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9636 1 150
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.9632 3 166
ID Description Score Start End Superfamily
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9663 1 151 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9632 1 150 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9504 1 150 3.90.45.10
2ew5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9446 2 163 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9413 1 151 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1W1DPA0-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9914 2 167 GO:0042586
GO:0043686
AF-A0A3C0FFK7-F1-model_v4 Multifunctional fusion protein [Includes: Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase); Methionyl-tRNA formyltransferase (EC 2.1.2.9)] 0.9881 2 148 GO:0004479
GO:0005829
GO:0042586
GO:0046872
AF-A0A831KHQ7-F1-model_v4 Peptide deformylase (EC 3.5.1.88) (Polypeptide deformylase) 0.9872 1 149 GO:0042586
GO:0043686
GO:0046872
AF-A0A485M0L7-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.987 1 148 GO:0042586
GO:0043686
AF-A0A143WPL9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9868 1 149 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Map