F448750

General Info

Members Datasets Scaffolds Average Seq Length
461 288 459 174

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10831203|Ga0207657_108312032
Length 199
Sequence MPARYSAAMIDRRQFIALAAIPLAGLGAHTSQATGMSRVTAYAFMFKGLDGDDILLSSYAGHPLLVVNTASQCGYTPQYAGLQQIWTRYRDRGLIVLGVPSNDFGGQEPGSPEEIKEFCSTTYGVTFPMTEKVDVNGDDRHALYQQLTDVADGEGHSGDIRWNFEKFVIAPGGEIVARFNPMTDPEAPEVIETIEKSLP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
3 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
203 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
225 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
228 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
237 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
282 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
283 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
284 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
285 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.43
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 5.86
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5205499 2162886012 Bacteria 5989
2 JGI24736J21556_1012441 3300001904 Bacteria 1378
3 JGI24752J21851_1002221 3300001976 Bacteria 2593
4 JGI24746J21847_1004701 3300001977 Bacteria 2145
5 JGI24737J22298_10068218 3300001990 Bacteria 1063
6 JGI24737J22298_10091249 3300001990 Unclassified 904
7 JGI24750J21931_1006908 3300002070 Bacteria 1421
8 JGI24748J21848_1000593 3300002074 Bacteria 3879
9 JGI24749J21850_1002574 3300002076 Bacteria 2547
10 JGI24744J21845_10002590 3300002077 Bacteria 3692
11 JGI24035J26624_1008926 3300002126 Bacteria 984
12 JGI24034J26672_10003302 3300002239 Bacteria 2249
13 JGI24751J29686_10014240 3300002459 Bacteria 1642
14 JGI25404J52841_10013664 3300003659 Bacteria 1761
15 JGI25404J52841_10016991 3300003659 Bacteria 1578
16 JGI25404J52841_10025022 3300003659 Bacteria 1285
17 JGI25404J52841_10085017 3300003659 Bacteria 661
18 JGI25404J52841_10087694 3300003659 Bacteria 650
19 Ga0058860_12177635 3300004801 Bacteria 1223
20 Ga0065712_10152999 3300005290 Bacteria 1355
21 Ga0065715_10115064 3300005293 Bacteria 2428
22 Ga0065707_10000459 3300005295 Bacteria 38095
23 Ga0065707_10194203 3300005295 Bacteria 1344
24 Ga0070658_10000182 3300005327 Bacteria 55103
25 Ga0070658_10011200 3300005327 Bacteria 7188
26 Ga0070676_10000270 3300005328 Bacteria 22801
27 Ga0070683_100002766 3300005329 Bacteria 14026
28 Ga0070690_100000169 3300005330 Bacteria 33354
29 Ga0070670_100001193 3300005331 Bacteria 20623
30 Ga0070670_100946266 3300005331 Bacteria 782
31 Ga0070677_10000172 3300005333 Bacteria 22446
32 Ga0070677_10072762 3300005333 Bacteria 1450
33 Ga0068869_100000310 3300005334 Bacteria 25870
34 Ga0070666_10000597 3300005335 Bacteria 21688
35 Ga0070666_10206713 3300005335 Bacteria 1382
36 Ga0070680_100057418 3300005336 Bacteria 3182
37 Ga0070680_100091419 3300005336 Bacteria 2519
38 Ga0070680_100357000 3300005336 Bacteria 1243
39 Ga0070682_100021172 3300005337 Bacteria 3832
40 Ga0070682_100176717 3300005337 Bacteria 1488
41 Ga0068868_100000890 3300005338 Bacteria 20301
42 Ga0068868_100082896 3300005338 Bacteria 2573
43 Ga0068868_100261312 3300005338 Bacteria 1460
44 Ga0070660_100000798 3300005339 Bacteria 20892
45 Ga0070660_100705826 3300005339 Unclassified 846
46 Ga0070689_100000340 3300005340 Bacteria 27316
47 Ga0070689_100496813 3300005340 Bacteria 1044
48 Ga0070691_10042368 3300005341 Bacteria 2154
49 Ga0070687_100000027 3300005343 Bacteria 45546
50 Ga0070687_100424215 3300005343 Bacteria 878
51 Ga0070661_100000527 3300005344 Bacteria 29353
52 Ga0070661_100005001 3300005344 Bacteria 9134
53 Ga0070661_100068797 3300005344 Bacteria 2602
54 Ga0070692_10643559 3300005345 Bacteria 707
55 Ga0070668_100000988 3300005347 Bacteria 19949
56 Ga0070668_100506505 3300005347 Bacteria 1046
57 Ga0070669_100000180 3300005353 Bacteria 55244
58 Ga0070669_100133734 3300005353 Bacteria 1906
59 Ga0070675_100000427 3300005354 Bacteria 28547
60 Ga0070671_100000129 3300005355 Bacteria 48602
61 Ga0070674_100000142 3300005356 Bacteria 33193
62 Ga0070673_100000188 3300005364 Bacteria 30246
63 Ga0070673_101098498 3300005364 Bacteria 743
64 Ga0070688_100000422 3300005365 Bacteria 21445
65 Ga0070688_101087211 3300005365 Bacteria 639
66 Ga0070659_100000334 3300005366 Bacteria 36435
67 Ga0070659_100341856 3300005366 Unclassified 1254
68 Ga0070667_100002644 3300005367 Bacteria 15518
69 Ga0070667_100524253 3300005367 Bacteria 1087
70 Ga0070703_10041754 3300005406 Bacteria 1431
71 Ga0070714_100078482 3300005435 Bacteria 2869
72 Ga0070713_100240709 3300005436 Bacteria 1648
73 Ga0070701_10000920 3300005438 Bacteria 10644
74 Ga0070705_100000712 3300005440 Bacteria 18928
75 Ga0070700_100004754 3300005441 Bacteria 7124
76 Ga0070663_100001370 3300005455 Bacteria 13346
77 Ga0070663_100143514 3300005455 Bacteria 1825
78 Ga0070662_100000029 3300005457 Bacteria 82498
79 Ga0070662_100000603 3300005457 Bacteria 21951
80 Ga0068867_100001646 3300005459 Bacteria 15518
81 Ga0070685_10000029 3300005466 Bacteria 89387
82 Ga0070707_100827732 3300005468 Bacteria 890
83 Ga0070684_100640148 3300005535 Bacteria 989
84 Ga0070684_100794568 3300005535 Bacteria 884
85 Ga0068853_100000809 3300005539 Bacteria 21798
86 Ga0068853_100180862 3300005539 Bacteria 1912
87 Ga0070672_100000199 3300005543 Bacteria 33229
88 Ga0070672_100829058 3300005543 Bacteria 815
89 Ga0070686_100000095 3300005544 Bacteria 61204
90 Ga0070696_100055915 3300005546 Bacteria 2752
91 Ga0070693_100006389 3300005547 Bacteria 5712
92 Ga0070665_100000032 3300005548 Bacteria 333352
93 Ga0070665_100004804 3300005548 Bacteria 14047
94 Ga0070704_100006849 3300005549 Bacteria 6749
95 Ga0068855_100000320 3300005563 Bacteria 59730
96 Ga0068855_100000658 3300005563 Bacteria 42234
97 Ga0070664_100000516 3300005564 Bacteria 29322
98 Ga0070664_100002493 3300005564 Bacteria 14839
99 Ga0070664_100191943 3300005564 Bacteria 1820
100 Ga0070664_100624810 3300005564 Bacteria 1000
101 Ga0068857_100000394 3300005577 Bacteria 30691
102 Ga0068857_100011961 3300005577 Bacteria 7548
103 Ga0068857_100327872 3300005577 Bacteria 1414
104 Ga0068857_101062023 3300005577 Bacteria 781
105 Ga0068854_100000398 3300005578 Bacteria 27316
106 Ga0068856_100002998 3300005614 Bacteria 17283
107 Ga0068856_100274890 3300005614 Bacteria 1701
108 Ga0068856_100701925 3300005614 Bacteria 1032
109 Ga0070702_100124557 3300005615 Bacteria 1618
110 Ga0070702_100423572 3300005615 Bacteria 959
111 Ga0068852_100000158 3300005616 Bacteria 45258
112 Ga0068852_100792537 3300005616 Bacteria 961
113 Ga0068859_100003266 3300005617 Bacteria 16505
114 Ga0068864_100000608 3300005618 Bacteria 30244
115 Ga0068864_101267353 3300005618 Bacteria 737
116 Ga0068866_10000207 3300005718 Bacteria 27666
117 Ga0068861_100000079 3300005719 Bacteria 46599
118 Ga0068861_100096839 3300005719 Bacteria 2339
119 Ga0068851_10000389 3300005834 Bacteria 19891
120 Ga0068870_10000240 3300005840 Bacteria 20324
121 Ga0068863_100000361 3300005841 Bacteria 46280
122 Ga0068858_100001158 3300005842 Bacteria 27316
123 Ga0068860_100004483 3300005843 Bacteria 14241
124 Ga0068862_100001188 3300005844 Bacteria 24541
125 Ga0068862_100091713 3300005844 Bacteria 2647
126 Ga0081540_1000073 3300005983 Bacteria 108893
127 Ga0081540_1000149 3300005983 Bacteria 72363
128 Ga0081540_1002379 3300005983 Bacteria 15364
129 Ga0081540_1009944 3300005983 Bacteria 6486
130 Ga0081540_1073810 3300005983 Bacteria 1566
131 Ga0081540_1081519 3300005983 Bacteria 1455
132 Ga0075365_10773324 3300006038 Bacteria 678
133 Ga0075363_100238223 3300006048 Bacteria 1046
134 Ga0070716_100260759 3300006173 Bacteria 1186
135 Ga0097621_100000355 3300006237 Bacteria 31671
136 Ga0097621_100041824 3300006237 Bacteria 3691
137 Ga0075370_10250980 3300006353 Bacteria 1049
138 Ga0068871_100002137 3300006358 Bacteria 13402
139 Ga0068871_100190474 3300006358 Bacteria 1767
140 Ga0068871_100968254 3300006358 Bacteria 791
141 Ga0075428_100166520 3300006844 Bacteria 2391
142 Ga0075434_100276378 3300006871 Unclassified 1699
143 Ga0075429_100054504 3300006880 Bacteria 3478
144 Ga0075429_100113637 3300006880 Bacteria 2367
145 Ga0075429_100556442 3300006880 Bacteria 1005
146 Ga0068865_100000184 3300006881 Bacteria 34789
147 Ga0097620_100003266 3300006931 Bacteria 16505
148 Ga0075435_100122915 3300007076 Bacteria 2167
149 Ga0099794_10007233 3300007265 Bacteria 4547
150 Ga0099795_10003622 3300007788 Bacteria 3859
151 Ga0105240_10011753 3300009093 Bacteria 12164
152 Ga0105240_10014738 3300009093 Bacteria 10662
153 Ga0105240_10096408 3300009093 Bacteria 3604
154 Ga0105240_10282584 3300009093 Bacteria 1906
155 Ga0105240_10776659 3300009093 Bacteria 1039
156 Ga0105240_11477032 3300009093 Bacteria 713
157 Ga0111539_10057756 3300009094 Bacteria 4607
158 Ga0105245_10000137 3300009098 Bacteria 69634
159 Ga0105245_10007910 3300009098 Bacteria 9300
160 Ga0105247_10002555 3300009101 Bacteria 12346
161 Ga0105247_10060912 3300009101 Unclassified 2339
162 Ga0114129_10271549 3300009147 Bacteria 2268
163 Ga0114129_10273849 3300009147 Bacteria 2257
164 Ga0105243_10005150 3300009148 Bacteria 10241
165 Ga0105243_10296315 3300009148 Bacteria 1464
166 Ga0105243_11182538 3300009148 Bacteria 777
167 Ga0105241_10000305 3300009174 Bacteria 36958
168 Ga0105241_10013667 3300009174 Bacteria 5948
169 Ga0105241_11037551 3300009174 Bacteria 769
170 Ga0105242_10001362 3300009176 Bacteria 19279
171 Ga0105242_10156763 3300009176 Bacteria 1989
172 Ga0105242_11799423 3300009176 Bacteria 651
173 Ga0105248_10003453 3300009177 Bacteria 17547
174 Ga0105248_10025380 3300009177 Bacteria 6590
175 Ga0105248_10247030 3300009177 Bacteria 2009
176 Ga0105248_10251297 3300009177 Bacteria 1990
177 Ga0105237_10000599 3300009545 Bacteria 50226
178 Ga0105237_10228424 3300009545 Bacteria 1862
179 Ga0105238_10000359 3300009551 Bacteria 48860
180 Ga0105249_10000275 3300009553 Bacteria 54246
181 Ga0105249_10157981 3300009553 Bacteria 2188
182 Ga0099796_10001158 3300010159 Bacteria 5104
183 Ga0105239_10002073 3300010375 Bacteria 25976
184 Ga0105239_10189378 3300010375 Bacteria 2303
185 Ga0105239_10501999 3300010375 Bacteria 1379
186 Ga0105239_10608314 3300010375 Bacteria 1247
187 Ga0105246_10042030 3300011119 Bacteria 3094
188 Ga0105246_10119632 3300011119 Unclassified 1949
189 Ga0157373_10004616 3300013100 Bacteria 10363
190 Ga0157373_10033396 3300013100 Bacteria 3702
191 Ga0157371_10000815 3300013102 Bacteria 35833
192 Ga0157371_10049136 3300013102 Bacteria 2997
193 Ga0157370_10058109 3300013104 Bacteria 3676
194 Ga0157369_10000816 3300013105 Bacteria 39816
195 Ga0157369_10031188 3300013105 Bacteria 5873
196 Ga0157369_10031963 3300013105 Bacteria 5790
197 Ga0157374_10000700 3300013296 Bacteria 29512
198 Ga0157374_10001106 3300013296 Bacteria 23205
199 Ga0157374_10396989 3300013296 Bacteria 1375
200 Ga0157374_10945408 3300013296 Bacteria 880
201 Ga0157378_10043041 3300013297 Bacteria 4009
202 Ga0157378_10677661 3300013297 Bacteria 1049
203 Ga0163162_10000010 3300013306 Bacteria 302032
204 Ga0163162_10001976 3300013306 Bacteria 19247
205 Ga0163162_10010876 3300013306 Bacteria 8857
206 Ga0157372_10070857 3300013307 Bacteria 3924
207 Ga0157372_10087988 3300013307 Bacteria 3526
208 Ga0157375_10001185 3300013308 Bacteria 22487
209 Ga0157375_11769866 3300013308 Bacteria 732
210 Ga0163163_10007044 3300014325 Bacteria 9881
211 Ga0163163_10031468 3300014325 Bacteria 5121
212 Ga0163163_10818261 3300014325 Bacteria 995
213 Ga0157380_10369347 3300014326 Bacteria 1349
214 Ga0157380_10452782 3300014326 Bacteria 1233
215 Ga0157377_10000665 3300014745 Bacteria 14286
216 Ga0157377_10007176 3300014745 Bacteria 5363
217 Ga0157379_10000385 3300014968 Bacteria 35739
218 Ga0157379_10096570 3300014968 Plasmid 2652
219 Ga0157376_11184230 3300014969 Bacteria 792
220 Ga0182007_10205458 3300015262 Unclassified 690
221 Ga0163161_10008990 3300017792 Bacteria 6909
222 Ga0206353_10499471 3300020082 Bacteria 2215
223 Ga0213876_10263068 3300021384 Bacteria 917
224 Ga0209026_1000911 3300025250 Bacteria 15148
225 Ga0207673_1016048 3300025290 Bacteria 994
226 Ga0209564_1002559 3300025295 Bacteria 13986
227 Ga0207697_10000387 3300025315 Bacteria 24714
228 Ga0207656_10002324 3300025321 Bacteria 6386
229 Ga0207653_10078115 3300025885 Bacteria 1141
230 Ga0207682_10000028 3300025893 Bacteria 58704
231 Ga0207642_10000159 3300025899 Bacteria 19242
232 Ga0207710_10006294 3300025900 Bacteria 5077
233 Ga0207710_10310648 3300025900 Bacteria 798
234 Ga0207688_10011841 3300025901 Bacteria 4747
235 Ga0207688_10087240 3300025901 Bacteria 1789
236 Ga0207680_10001043 3300025903 Bacteria 13085
237 Ga0207680_10298461 3300025903 Bacteria 1123
238 Ga0207647_10000022 3300025904 Bacteria 118094
239 Ga0207647_10020220 3300025904 Bacteria 4465
240 Ga0207645_10000053 3300025907 Bacteria 83208
241 Ga0207643_10000013 3300025908 Bacteria 130464
242 Ga0207705_10069238 3300025909 Bacteria 2555
243 Ga0207654_10002352 3300025911 Bacteria 9698
244 Ga0207654_10007604 3300025911 Bacteria 5462
245 Ga0207707_10494777 3300025912 Bacteria 1043
246 Ga0207695_10004154 3300025913 Bacteria 19886
247 Ga0207695_10016757 3300025913 Bacteria 8556
248 Ga0207695_10064632 3300025913 Bacteria 3765
249 Ga0207695_10220802 3300025913 Bacteria 1802
250 Ga0207695_10505282 3300025913 Bacteria 1091
251 Ga0207671_10013720 3300025914 Bacteria 6434
252 Ga0207660_10098803 3300025917 Bacteria 2178
253 Ga0207660_10337417 3300025917 Bacteria 1206
254 Ga0207660_10366697 3300025917 Bacteria 1156
255 Ga0207662_10000009 3300025918 Bacteria 95358
256 Ga0207662_10626826 3300025918 Bacteria 750
257 Ga0207657_10000042 3300025919 Bacteria 118735
258 Ga0207657_10460382 3300025919 Unclassified 998
259 Ga0207657_10831203 3300025919 Bacteria 713
260 Ga0207649_10001283 3300025920 Bacteria 14994
261 Ga0207649_10033204 3300025920 Bacteria 3082
262 Ga0207649_10035508 3300025920 Bacteria 2996
263 Ga0207649_10203771 3300025920 Bacteria 1399
264 Ga0207652_10033368 3300025921 Bacteria 4334
265 Ga0207652_10315321 3300025921 Bacteria 1411
266 Ga0207652_10547717 3300025921 Bacteria 1040
267 Ga0207646_11364931 3300025922 Bacteria 617
268 Ga0207681_10000159 3300025923 Bacteria 56045
269 Ga0207681_10113077 3300025923 Bacteria 1979
270 Ga0207694_10005300 3300025924 Bacteria 9937
271 Ga0207650_10000245 3300025925 Bacteria 59462
272 Ga0207650_10471604 3300025925 Bacteria 1046
273 Ga0207659_10000115 3300025926 Bacteria 46765
274 Ga0207687_10000306 3300025927 Bacteria 33327
275 Ga0207687_10025912 3300025927 Bacteria 3925
276 Ga0207664_10084733 3300025929 Bacteria 2586
277 Ga0207644_10000201 3300025931 Bacteria 42183
278 Ga0207644_10286412 3300025931 Bacteria 1324
279 Ga0207690_10000574 3300025932 Bacteria 24039
280 Ga0207690_10029769 3300025932 Bacteria 3475
281 Ga0207706_10000046 3300025933 Bacteria 119273
282 Ga0207706_10000047 3300025933 Bacteria 119022
283 Ga0207686_10039959 3300025934 Bacteria 2849
284 Ga0207709_10009022 3300025935 Bacteria 5498
285 Ga0207670_10000600 3300025936 Bacteria 19693
286 Ga0207670_10688172 3300025936 Bacteria 846
287 Ga0207669_10000249 3300025937 Bacteria 24525
288 Ga0207704_10000174 3300025938 Bacteria 33930
289 Ga0207691_10000314 3300025940 Bacteria 48335
290 Ga0207691_10509635 3300025940 Bacteria 1021
291 Ga0207711_10000234 3300025941 Bacteria 59526
292 Ga0207711_10217126 3300025941 Bacteria 1748
293 Ga0207711_10224637 3300025941 Bacteria 1718
294 Ga0207689_10000071 3300025942 Bacteria 82580
295 Ga0207661_10007914 3300025944 Bacteria 7574
296 Ga0207661_10607302 3300025944 Bacteria 1004
297 Ga0207679_10000111 3300025945 Bacteria 66057
298 Ga0207679_10003347 3300025945 Bacteria 9902
299 Ga0207679_10429165 3300025945 Bacteria 1168
300 Ga0207667_10000045 3300025949 Bacteria 246053
301 Ga0207667_10000644 3300025949 Bacteria 45263
302 Ga0207667_10027131 3300025949 Bacteria 6243
303 Ga0207651_10000284 3300025960 Bacteria 21731
304 Ga0207712_10000329 3300025961 Bacteria 43533
305 Ga0207712_10090085 3300025961 Bacteria 2256
306 Ga0207668_10003991 3300025972 Bacteria 8695
307 Ga0207668_10762463 3300025972 Bacteria 854
308 Ga0207640_10001109 3300025981 Bacteria 14865
309 Ga0207658_10000748 3300025986 Bacteria 27984
310 Ga0207658_10477487 3300025986 Bacteria 1107
311 Ga0207677_10000181 3300026023 Bacteria 50309
312 Ga0207677_10045849 3300026023 Bacteria 2922
313 Ga0207703_10000303 3300026035 Bacteria 54018
314 Ga0207639_10013222 3300026041 Bacteria 5770
315 Ga0207639_10020923 3300026041 Bacteria 4693
316 Ga0207678_10003134 3300026067 Bacteria 14967
317 Ga0207678_10185659 3300026067 Bacteria 1776
318 Ga0207708_10009470 3300026075 Bacteria 7215
319 Ga0207702_10000249 3300026078 Bacteria 62542
320 Ga0207702_10000881 3300026078 Bacteria 31236
321 Ga0207641_10000652 3300026088 Bacteria 37792
322 Ga0207641_10561815 3300026088 Bacteria 1114
323 Ga0207648_10000302 3300026089 Bacteria 53741
324 Ga0207676_10000642 3300026095 Bacteria 28097
325 Ga0207674_10000038 3300026116 Bacteria 132350
326 Ga0207674_10009569 3300026116 Bacteria 11058
327 Ga0207674_10012352 3300026116 Bacteria 9547
328 Ga0207674_10921628 3300026116 Bacteria 842
329 Ga0207675_100000165 3300026118 Bacteria 58839
330 Ga0207675_100013512 3300026118 Bacteria 7620
331 Ga0207675_100148278 3300026118 Bacteria 2232
332 Ga0207675_100375562 3300026118 Bacteria 1397
333 Ga0207683_10000211 3300026121 Bacteria 50758
334 Ga0207698_10000588 3300026142 Bacteria 21187
335 Ga0207698_10705032 3300026142 Bacteria 1005
336 Ga0209179_1014218 3300027512 Bacteria 1458
337 Ga0268266_10000030 3300028379 Bacteria 417120
338 Ga0268266_10000389 3300028379 Bacteria 66723
339 Ga0268265_10000394 3300028380 Bacteria 46647
340 Ga0268264_10000191 3300028381 Bacteria 127257
341 Ga0268264_10352764 3300028381 Bacteria 1401
342 Ga0307515_10241306 3300028794 Bacteria 1577
343 Ga0307512_10120396 3300030522 Bacteria 1689
344 Ga0265325_10000029 3300031241 Bacteria 103942
345 Ga0265327_10004250 3300031251 Bacteria 12841
346 Ga0307513_10071326 3300031456 Bacteria 3626
347 Ga0307513_10326850 3300031456 Bacteria 1289
348 Ga0307509_10089275 3300031507 Bacteria 3161
349 Ga0265313_10014735 3300031595 Bacteria 4600
350 Ga0307508_10030919 3300031616 Bacteria 4840
351 Ga0307514_10039954 3300031649 Bacteria 3702
352 Ga0307413_10656848 3300031824 Bacteria 866
353 Ga0307412_11368525 3300031911 Bacteria 639
354 Ga0307409_100308862 3300031995 Bacteria 1475
355 Ga0307409_100725245 3300031995 Bacteria 996
356 Ga0307411_10923930 3300032005 Bacteria 777
357 Ga0307415_100475322 3300032126 Bacteria 1087
358 Ga0307507_10115036 3300033179 Bacteria 2179
359 Ga0373932_0353448 3300035112 Bacteria 559
360 Ga0373941_0014630 3300035115 Bacteria 2100
361 Ga0373927_0132266 3300035695 Bacteria 1630
362 Ga0373933_0633333 3300035724 Bacteria 703
363 Ga0373937_0142578 3300036401 Bacteria 2242
364 Ga0373937_0531470 3300036401 Bacteria 1117
365 Ga0395899_0000749 3300037312 Bacteria 32276
366 Ga0395900_0000406 3300037418 Bacteria 62078
367 Ga0395898_0069322 3300037466 Bacteria 3412
368 Ga0395905_0000175 3300037471 Bacteria 104024
369 Ga0395905_0471270 3300037471 Bacteria 1155
370 Ga0436364_1371341 3300037853 Bacteria 12381
371 Ga0395901_0000198 3300038443 Bacteria 76490
372 Ga0436365_0915990 3300039437 Bacteria 4120
373 Ga0436365_0960370 3300039437 Bacteria 5810
374 Ga0436360_0651923 3300039438 Bacteria 12688
375 Ga0436361_1063638 3300039447 Bacteria 2614
376 Ga0436361_1115393 3300039447 Bacteria 1153
377 Ga0436363_0772388 3300039450 Bacteria 1117
378 Ga0439455_0061245 3300042012 Bacteria 998
379 Ga0439458_0039368 3300042157 Bacteria 1143
380 Ga0451577_0029996 3300042876 Bacteria 4913
381 Ga0453684_0435488 3300044712 Bacteria 1462
382 Ga0451576_0006554 3300045051 Bacteria 14246
383 Ga0466967_0458712 3300045976 Bacteria 1246
384 Ga0466967_0657442 3300045976 Bacteria 1037
385 Ga0495603_0551717 3300046455 Bacteria 660
386 Ga0495629_0087155 3300046459 Bacteria 2178
387 Ga0495650_0140798 3300046471 Unclassified 873
388 Ga0495584_0130283 3300046491 Bacteria 1276
389 Ga0495583_0086280 3300046506 Bacteria 1358
390 Ga0495606_0020009 3300046507 Bacteria 4953
391 Ga0495630_0876103 3300046517 Bacteria 684
392 Ga0495625_0217523 3300046660 Bacteria 1253
393 Ga0495669_0468613 3300046684 Bacteria 612
394 Ga0495624_0125624 3300046690 Bacteria 1575
395 Ga0495614_0538859 3300048089 Bacteria 558
396 Ga0496100_0061599 3300048903 Bacteria 2473
397 Ga0496102_0000591 3300048905 Bacteria 38319
398 Ga0496104_0048908 3300048907 Bacteria 3988
399 Ga0496104_0237370 3300048907 Bacteria 1735
400 Ga0496105_0252342 3300048908 Bacteria 1429
401 Ga0496106_0010818 3300048909 Bacteria 6743
402 Ga0496107_0007960 3300048910 Bacteria 7315
403 Ga0496107_0675097 3300048910 Bacteria 761
404 Ga0496107_0822232 3300048910 Bacteria 679
405 Ga0496108_0006066 3300048911 Bacteria 9773
406 Ga0496108_0030756 3300048911 Bacteria 4449
407 Ga0496108_0195469 3300048911 Bacteria 1754
408 Ga0496109_0002713 3300048912 Bacteria 14832
409 Ga0496109_0012276 3300048912 Bacteria 7395
410 Ga0496109_0141843 3300048912 Bacteria 2247
411 Ga0496109_0413249 3300048912 Bacteria 1275
412 Ga0496109_0630046 3300048912 Bacteria 1009
413 Ga0496110_0090541 3300048913 Bacteria 2735
414 Ga0496110_0134300 3300048913 Bacteria 2236
415 Ga0496111_0128327 3300048914 Bacteria 1875
416 Ga0496111_0267531 3300048914 Bacteria 1268
417 Ga0496111_0336833 3300048914 Bacteria 1117
418 Ga0496112_0007230 3300048915 Bacteria 9840
419 Ga0496112_0009498 3300048915 Bacteria 8769
420 Ga0496112_1430763 3300048915 Bacteria 606
421 Ga0496113_0020145 3300048916 Bacteria 4683
422 Ga0496114_0684604 3300048917 Bacteria 900
423 Ga0496121_0082273 3300048924 Bacteria 2546
424 Ga0496123_0055975 3300048926 Bacteria 2583
425 Ga0501036_0100299 3300049572 Bacteria 2449
426 Ga0501039_0199082 3300049575 Bacteria 1575
427 Ga0501041_0579914 3300049577 Bacteria 715
428 Ga0501042_0076448 3300049578 Bacteria 2397
429 Ga0501046_0350586 3300049580 Bacteria 1072
430 Ga0501067_0051854 3300049583 Bacteria 2273
431 Ga0501071_0388112 3300049587 Bacteria 1065
432 Ga0501072_0004736 3300049588 Bacteria 10362
433 Ga0501074_0902066 3300049590 Bacteria 622
434 Ga0501075_0003455 3300049591 Bacteria 10560
435 Ga0501076_0077005 3300049592 Bacteria 2675
436 Ga0501080_0771631 3300049742 Bacteria 844
437 nmdc:mga03n38_207464_c1 3300050490 Bacteria 1017
438 nmdc:mga0yw44_374941_c1 3300050492 Bacteria 960
439 nmdc:mga07m45_164331_c1 3300050496 Bacteria 1289
440 nmdc:mga07m45_218937_c1 3300050496 Bacteria 1107
441 nmdc:mga05p37_31940_c1 3300050507 Bacteria 6437
442 nmdc:mga05p37_606335_c1 3300050507 Bacteria 1235
443 nmdc:mga05p37_717113_c1 3300050507 Bacteria 1108
444 nmdc:mga09592_51757_c1 3300050508 Bacteria 3465
445 Ga0495601_0222916 3300053077 Bacteria 1232
446 Ga0500635_0000361 3300053080 Bacteria 14493
447 Ga0495619_0098137 3300053085 Bacteria 1991
448 Ga0500646_0000619 3300053090 Bacteria 10164
449 Ga0500646_0201158 3300053090 Bacteria 683
450 Ga0500566_0151110 3300053094 Bacteria 1221
451 Ga0500654_156622 3300053099 Bacteria 785
452 Ga0500595_006085 3300053119 Bacteria 5173
453 Ga0500573_0115193 3300053140 Bacteria 1501
454 Ga0500588_0041707 3300053146 Bacteria 1386
455 Ga0500638_051439 3300053162 Bacteria 1992
456 Ga0500638_303248 3300053162 Bacteria 615
457 Ga0500636_0119216 3300053177 Bacteria 1482
458 Ga0501084_0090945 3300054114 Bacteria 2562
459 Ga0501082_0407789 3300060353 Bacteria 1186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10000459 Ga0065707_1000045931 155
2 3300005844 Ga0068862_100091713 Ga0068862_1000917133 155
3 3300025940 Ga0207691_10509635 Ga0207691_105096351 155
4 iso_pu_bacteria 2643221961 2645720391 156
5 3300009093 Ga0105240_10776659 Ga0105240_107766592 158
6 3300021384 Ga0213876_10263068 Ga0213876_102630681 158
7 3300025901 Ga0207688_10087240 Ga0207688_100872402 158
8 3300025941 Ga0207711_10217126 Ga0207711_102171262 158
9 3300025945 Ga0207679_10429165 Ga0207679_104291651 158
10 3300031616 Ga0307508_10030919 Ga0307508_100309193 158
11 3300031911 Ga0307412_11368525 Ga0307412_113685251 158
12 3300032126 Ga0307415_100475322 Ga0307415_1004753222 158
13 3300039437 Ga0436365_0915990 Ga0436365_0915990_2806_3288 158
14 3300048912 Ga0496109_0141843 Ga0496109_0141843_956_1438 158
15 3300048913 Ga0496110_0134300 Ga0496110_0134300_968_1450 158
16 3300048914 Ga0496111_0336833 Ga0496111_0336833_172_654 158
17 3300048915 Ga0496112_1430763 Ga0496112_1430763_108_590 158
18 3300001990 JGI24737J22298_10091249 JGI24737J22298_100912492 159
19 3300005331 Ga0070670_100946266 Ga0070670_1009462661 159
20 3300005338 Ga0068868_100082896 Ga0068868_1000828962 159
21 3300005339 Ga0070660_100705826 Ga0070660_1007058261 159
22 3300005344 Ga0070661_100068797 Ga0070661_1000687971 159
23 3300005347 Ga0070668_100506505 Ga0070668_1005065051 159
24 3300005353 Ga0070669_100133734 Ga0070669_1001337342 159
25 3300005364 Ga0070673_101098498 Ga0070673_1010984982 159
26 3300005366 Ga0070659_100341856 Ga0070659_1003418562 159
27 3300005457 Ga0070662_100000029 Ga0070662_1000000293 159
28 3300005563 Ga0068855_100000658 Ga0068855_1000006582 159
29 3300005564 Ga0070664_100624810 Ga0070664_1006248102 159
30 3300005719 Ga0068861_100096839 Ga0068861_1000968394 159
31 3300006038 Ga0075365_10773324 Ga0075365_107733241 159
32 3300006048 Ga0075363_100238223 Ga0075363_1002382232 159
33 3300006880 Ga0075429_100556442 Ga0075429_1005564421 159
34 3300007788 Ga0099795_10003622 Ga0099795_100036223 159
35 3300009093 Ga0105240_10014738 Ga0105240_1001473810 159
36 3300009098 Ga0105245_10007910 Ga0105245_100079103 159
37 3300009148 Ga0105243_11182538 Ga0105243_111825382 159
38 3300009174 Ga0105241_10000305 Ga0105241_1000030512 159
39 3300009176 Ga0105242_10156763 Ga0105242_101567632 159
40 3300009176 Ga0105242_11799423 Ga0105242_117994231 159
41 3300010159 Ga0099796_10001158 Ga0099796_100011582 159
42 3300010375 Ga0105239_10189378 Ga0105239_101893783 159
43 3300010375 Ga0105239_10608314 Ga0105239_106083142 159
44 3300011119 Ga0105246_10119632 Ga0105246_101196322 159
45 3300013100 Ga0157373_10033396 Ga0157373_100333963 159
46 3300013102 Ga0157371_10049136 Ga0157371_100491362 159
47 3300013105 Ga0157369_10031188 Ga0157369_100311881 159
48 3300013296 Ga0157374_10000700 Ga0157374_100007005 159
49 3300013296 Ga0157374_10945408 Ga0157374_109454081 159
50 3300013297 Ga0157378_10677661 Ga0157378_106776611 159
51 3300013308 Ga0157375_11769866 Ga0157375_117698662 159
52 3300014326 Ga0157380_10369347 Ga0157380_103693473 159
53 3300014326 Ga0157380_10452782 Ga0157380_104527822 159
54 3300014745 Ga0157377_10007176 Ga0157377_100071764 159
55 3300014969 Ga0157376_11184230 Ga0157376_111842302 159
56 3300025904 Ga0207647_10000022 Ga0207647_1000002277 159
57 3300025911 Ga0207654_10002352 Ga0207654_100023525 159
58 3300025913 Ga0207695_10016757 Ga0207695_100167576 159
59 3300025919 Ga0207657_10460382 Ga0207657_104603822 159
60 3300025920 Ga0207649_10203771 Ga0207649_102037712 159
61 3300025921 Ga0207652_10315321 Ga0207652_103153212 159
62 3300025923 Ga0207681_10113077 Ga0207681_101130774 159
63 3300025925 Ga0207650_10471604 Ga0207650_104716042 159
64 3300025927 Ga0207687_10025912 Ga0207687_100259123 159
65 3300025931 Ga0207644_10286412 Ga0207644_102864122 159
66 3300025933 Ga0207706_10000047 Ga0207706_1000004729 159
67 3300025944 Ga0207661_10607302 Ga0207661_106073022 159
68 3300025949 Ga0207667_10000644 Ga0207667_1000064439 159
69 3300026023 Ga0207677_10045849 Ga0207677_100458493 159
70 3300026075 Ga0207708_10009470 Ga0207708_100094707 159
71 3300026118 Ga0207675_100013512 Ga0207675_1000135124 159
72 3300026118 Ga0207675_100148278 Ga0207675_1001482782 159
73 3300026118 Ga0207675_100375562 Ga0207675_1003755623 159
74 3300028794 Ga0307515_10241306 Ga0307515_102413061 159
75 3300030522 Ga0307512_10120396 Ga0307512_101203962 159
76 3300031456 Ga0307513_10326850 Ga0307513_103268502 159
77 3300031649 Ga0307514_10039954 Ga0307514_100399544 159
78 3300031824 Ga0307413_10656848 Ga0307413_106568482 159
79 3300031995 Ga0307409_100308862 Ga0307409_1003088622 159
80 3300039447 Ga0436361_1115393 Ga0436361_1115393_300_788 159
81 3300045976 Ga0466967_0657442 Ga0466967_0657442_428_913 159
82 3300046507 Ga0495606_0020009 Ga0495606_0020009_4383_4877 159
83 3300046690 Ga0495624_0125624 Ga0495624_0125624_165_650 159
84 3300049583 Ga0501067_0051854 Ga0501067_0051854_1114_1599 159
85 3300050492 nmdc:mga0yw44_374941_c1 nmdc:mga0yw44_374941_c1_177_665 159
86 3300053140 Ga0500573_0115193 Ga0500573_0115193_330_818 159
87 3300003659 JGI25404J52841_10087694 JGI25404J52841_100876941 160
88 3300004801 Ga0058860_12177635 Ga0058860_121776351 160
89 3300005327 Ga0070658_10011200 Ga0070658_100112003 160
90 3300005336 Ga0070680_100091419 Ga0070680_1000914193 160
91 3300005337 Ga0070682_100176717 Ga0070682_1001767171 160
92 3300005338 Ga0068868_100261312 Ga0068868_1002613121 160
93 3300005340 Ga0070689_100496813 Ga0070689_1004968132 160
94 3300005345 Ga0070692_10643559 Ga0070692_106435591 160
95 3300005365 Ga0070688_101087211 Ga0070688_1010872111 160
96 3300005435 Ga0070714_100078482 Ga0070714_1000784821 160
97 3300005436 Ga0070713_100240709 Ga0070713_1002407092 160
98 3300005535 Ga0070684_100640148 Ga0070684_1006401482 160
99 3300005535 Ga0070684_100794568 Ga0070684_1007945681 160
100 3300005539 Ga0068853_100180862 Ga0068853_1001808622 160
101 3300005548 Ga0070665_100000032 Ga0070665_100000032260 160
102 3300005577 Ga0068857_100327872 Ga0068857_1003278722 160
103 3300005577 Ga0068857_101062023 Ga0068857_1010620231 160
104 3300005614 Ga0068856_100274890 Ga0068856_1002748902 160
105 3300005615 Ga0070702_100423572 Ga0070702_1004235721 160
106 3300005616 Ga0068852_100792537 Ga0068852_1007925372 160
107 3300005983 Ga0081540_1009944 Ga0081540_10099445 160
108 3300005983 Ga0081540_1073810 Ga0081540_10738101 160
109 3300006173 Ga0070716_100260759 Ga0070716_1002607591 160
110 3300006353 Ga0075370_10250980 Ga0075370_102509802 160
111 3300006880 Ga0075429_100113637 Ga0075429_1001136373 160
112 3300009093 Ga0105240_10096408 Ga0105240_100964084 160
113 3300009093 Ga0105240_10282584 Ga0105240_102825843 160
114 3300009093 Ga0105240_11477032 Ga0105240_114770322 160
115 3300009147 Ga0114129_10273849 Ga0114129_102738492 160
116 3300009148 Ga0105243_10296315 Ga0105243_102963152 160
117 3300009174 Ga0105241_11037551 Ga0105241_110375511 160
118 3300009177 Ga0105248_10247030 Ga0105248_102470302 160
119 3300009545 Ga0105237_10228424 Ga0105237_102284242 160
120 3300009553 Ga0105249_10157981 Ga0105249_101579813 160
121 3300010375 Ga0105239_10501999 Ga0105239_105019992 160
122 3300013104 Ga0157370_10058109 Ga0157370_100581093 160
123 3300013105 Ga0157369_10031963 Ga0157369_100319632 160
124 3300013296 Ga0157374_10396989 Ga0157374_103969892 160
125 3300013306 Ga0163162_10000010 Ga0163162_10000010204 160
126 3300013306 Ga0163162_10010876 Ga0163162_100108767 160
127 3300013307 Ga0157372_10087988 Ga0157372_100879882 160
128 3300020082 Ga0206353_10499471 Ga0206353_104994711 160
129 3300025250 Ga0209026_1000911 Ga0209026_100091113 160
130 3300025909 Ga0207705_10069238 Ga0207705_100692383 160
131 3300025912 Ga0207707_10494777 Ga0207707_104947772 160
132 3300025913 Ga0207695_10064632 Ga0207695_100646325 160
133 3300025913 Ga0207695_10220802 Ga0207695_102208022 160
134 3300025913 Ga0207695_10505282 Ga0207695_105052822 160
135 3300025917 Ga0207660_10366697 Ga0207660_103666972 160
136 3300025920 Ga0207649_10033204 Ga0207649_100332043 160
137 3300025921 Ga0207652_10033368 Ga0207652_100333685 160
138 3300025929 Ga0207664_10084733 Ga0207664_100847332 160
139 3300025932 Ga0207690_10029769 Ga0207690_100297693 160
140 3300025944 Ga0207661_10007914 Ga0207661_100079147 160
141 3300025949 Ga0207667_10000045 Ga0207667_10000045216 160
142 3300025961 Ga0207712_10090085 Ga0207712_100900853 160
143 3300025972 Ga0207668_10762463 Ga0207668_107624632 160
144 3300026041 Ga0207639_10020923 Ga0207639_100209235 160
145 3300026078 Ga0207702_10000249 Ga0207702_1000024929 160
146 3300026088 Ga0207641_10561815 Ga0207641_105618152 160
147 3300026116 Ga0207674_10012352 Ga0207674_100123524 160
148 3300026116 Ga0207674_10921628 Ga0207674_109216281 160
149 3300026142 Ga0207698_10705032 Ga0207698_107050322 160
150 3300028379 Ga0268266_10000030 Ga0268266_1000003072 160
151 3300031456 Ga0307513_10071326 Ga0307513_100713262 160
152 3300031507 Ga0307509_10089275 Ga0307509_100892752 160
153 3300031995 Ga0307409_100725245 Ga0307409_1007252452 160
154 3300032005 Ga0307411_10923930 Ga0307411_109239302 160
155 3300033179 Ga0307507_10115036 Ga0307507_101150362 160
156 3300037312 Ga0395899_0000749 Ga0395899_0000749_6975_7472 160
157 3300037418 Ga0395900_0000406 Ga0395900_0000406_28178_28675 160
158 3300037466 Ga0395898_0069322 Ga0395898_0069322_2783_3280 160
159 3300037471 Ga0395905_0000175 Ga0395905_0000175_78959_79456 160
160 3300037471 Ga0395905_0471270 Ga0395905_0471270_223_720 160
161 3300038443 Ga0395901_0000198 Ga0395901_0000198_16204_16701 160
162 3300039438 Ga0436360_0651923 Ga0436360_0651923_6003_6491 160
163 3300039447 Ga0436361_1063638 Ga0436361_1063638_879_1367 160
164 3300046455 Ga0495603_0551717 Ga0495603_0551717_121_609 160
165 3300046471 Ga0495650_0140798 Ga0495650_0140798_69_566 160
166 3300046506 Ga0495583_0086280 Ga0495583_0086280_772_1272 160
167 3300046517 Ga0495630_0876103 Ga0495630_0876103_172_660 160
168 3300046660 Ga0495625_0217523 Ga0495625_0217523_314_814 160
169 3300046684 Ga0495669_0468613 Ga0495669_0468613_14_514 160
170 3300048089 Ga0495614_0538859 Ga0495614_0538859_59_547 160
171 3300048911 Ga0496108_0195469 Ga0496108_0195469_1121_1612 160
172 3300048912 Ga0496109_0413249 Ga0496109_0413249_365_853 160
173 3300048912 Ga0496109_0630046 Ga0496109_0630046_32_523 160
174 3300048913 Ga0496110_0090541 Ga0496110_0090541_1569_2060 160
175 3300049572 Ga0501036_0100299 Ga0501036_0100299_101_589 160
176 3300049575 Ga0501039_0199082 Ga0501039_0199082_514_1002 160
177 3300049577 Ga0501041_0579914 Ga0501041_0579914_111_599 160
178 3300049578 Ga0501042_0076448 Ga0501042_0076448_200_688 160
179 3300049580 Ga0501046_0350586 Ga0501046_0350586_420_908 160
180 3300049587 Ga0501071_0388112 Ga0501071_0388112_31_519 160
181 3300049588 Ga0501072_0004736 Ga0501072_0004736_9465_9953 160
182 3300049590 Ga0501074_0902066 Ga0501074_0902066_102_590 160
183 3300049591 Ga0501075_0003455 Ga0501075_0003455_3803_4291 160
184 3300049592 Ga0501076_0077005 Ga0501076_0077005_710_1198 160
185 3300049742 Ga0501080_0771631 Ga0501080_0771631_111_599 160
186 3300050490 nmdc:mga03n38_207464_c1 nmdc:mga03n38_207464_c1_488_1003 160
187 3300050496 nmdc:mga07m45_164331_c1 nmdc:mga07m45_164331_c1_704_1201 160
188 3300050496 nmdc:mga07m45_218937_c1 nmdc:mga07m45_218937_c1_233_748 160
189 3300050507 nmdc:mga05p37_606335_c1 nmdc:mga05p37_606335_c1_536_1024 160
190 3300053080 Ga0500635_0000361 Ga0500635_0000361_2446_2946 160
191 3300053090 Ga0500646_0000619 Ga0500646_0000619_9376_9864 160
192 3300053090 Ga0500646_0201158 Ga0500646_0201158_50_538 160
193 3300053094 Ga0500566_0151110 Ga0500566_0151110_55_543 160
194 3300053099 Ga0500654_156622 Ga0500654_156622_150_638 160
195 3300053146 Ga0500588_0041707 Ga0500588_0041707_842_1330 160
196 3300053162 Ga0500638_051439 Ga0500638_051439_99_587 160
197 3300053162 Ga0500638_303248 Ga0500638_303248_85_570 160
198 3300053177 Ga0500636_0119216 Ga0500636_0119216_490_978 160
199 3300054114 Ga0501084_0090945 Ga0501084_0090945_1841_2329 160
200 3300060353 Ga0501082_0407789 Ga0501082_0407789_619_1107 160
201 3300003659 JGI25404J52841_10016991 JGI25404J52841_100169912 161
202 3300005468 Ga0070707_100827732 Ga0070707_1008277322 161
203 3300006880 Ga0075429_100054504 Ga0075429_1000545043 161
204 3300009147 Ga0114129_10271549 Ga0114129_102715491 161
205 3300025290 Ga0207673_1016048 Ga0207673_10160482 161
206 3300025295 Ga0209564_1002559 Ga0209564_10025593 161
207 3300025922 Ga0207646_11364931 Ga0207646_113649311 161
208 3300031241 Ga0265325_10000029 Ga0265325_1000002970 161
209 3300031595 Ga0265313_10014735 Ga0265313_100147355 161
210 3300035112 Ga0373932_0353448 Ga0373932_0353448_39_524 161
211 3300035115 Ga0373941_0014630 Ga0373941_0014630_1251_1751 161
212 3300037853 Ga0436364_1371341 Ga0436364_1371341_7175_7672 161
213 3300039437 Ga0436365_0960370 Ga0436365_0960370_3495_3992 161
214 3300046491 Ga0495584_0130283 Ga0495584_0130283_668_1156 161
215 3300048917 Ga0496114_0684604 Ga0496114_0684604_390_878 161
216 3300050507 nmdc:mga05p37_31940_c1 nmdc:mga05p37_31940_c1_4190_4687 161
217 3300050508 nmdc:mga09592_51757_c1 nmdc:mga09592_51757_c1_1496_1993 161
218 3300053077 Ga0495601_0222916 Ga0495601_0222916_684_1172 161
219 3300006844 Ga0075428_100166520 Ga0075428_1001665202 163
220 3300050507 nmdc:mga05p37_717113_c1 nmdc:mga05p37_717113_c1_512_1021 163
221 3300005543 Ga0070672_100829058 Ga0070672_1008290581 168
222 3300035724 Ga0373933_0633333 Ga0373933_0633333_85_645 172
223 3300036401 Ga0373937_0142578 Ga0373937_0142578_1224_1784 172
224 3300046459 Ga0495629_0087155 Ga0495629_0087155_1225_1785 172
225 3300053085 Ga0495619_0098137 Ga0495619_0098137_953_1513 172
226 3300048924 Ga0496121_0082273 Ga0496121_0082273_161_724 173
227 3300005333 Ga0070677_10072762 Ga0070677_100727622 174
228 3300005336 Ga0070680_100357000 Ga0070680_1003570001 174
229 3300025917 Ga0207660_10337417 Ga0207660_103374171 174
230 3300048926 Ga0496123_0055975 Ga0496123_0055975_844_1413 174
231 3300007076 Ga0075435_100122915 Ga0075435_1001229154 175
232 3300014325 Ga0163163_10818261 Ga0163163_108182612 175
233 3300027512 Ga0209179_1014218 Ga0209179_10142182 175
234 3300031251 Ga0265327_10004250 Ga0265327_100042504 175
235 3300005335 Ga0070666_10206713 Ga0070666_102067132 176
236 3300005343 Ga0070687_100424215 Ga0070687_1004242151 176
237 3300005367 Ga0070667_100524253 Ga0070667_1005242531 176
238 3300005455 Ga0070663_100143514 Ga0070663_1001435142 176
239 3300005564 Ga0070664_100191943 Ga0070664_1001919433 176
240 3300005614 Ga0068856_100701925 Ga0068856_1007019252 176
241 3300005618 Ga0068864_101267353 Ga0068864_1012673531 176
242 3300006358 Ga0068871_100968254 Ga0068871_1009682541 176
243 3300006871 Ga0075434_100276378 Ga0075434_1002763782 176
244 3300009101 Ga0105247_10060912 Ga0105247_100609125 176
245 3300009177 Ga0105248_10025380 Ga0105248_100253806 176
246 3300009177 Ga0105248_10251297 Ga0105248_102512972 176
247 3300014325 Ga0163163_10031468 Ga0163163_100314682 176
248 3300014968 Ga0157379_10096570 Ga0157379_100965704 176
249 3300025900 Ga0207710_10310648 Ga0207710_103106481 176
250 3300025903 Ga0207680_10298461 Ga0207680_102984611 176
251 3300025918 Ga0207662_10626826 Ga0207662_106268261 176
252 3300025936 Ga0207670_10688172 Ga0207670_106881721 176
253 3300025941 Ga0207711_10224637 Ga0207711_102246372 176
254 3300025986 Ga0207658_10477487 Ga0207658_104774871 176
255 3300026067 Ga0207678_10185659 Ga0207678_101856593 176
256 3300028381 Ga0268264_10352764 Ga0268264_103527642 176
257 3300035695 Ga0373927_0132266 Ga0373927_0132266_106_678 176
258 3300048907 Ga0496104_0048908 Ga0496104_0048908_13_582 176
259 3300048910 Ga0496107_0675097 Ga0496107_0675097_99_665 176
260 3300048910 Ga0496107_0822232 Ga0496107_0822232_23_616 176
261 3300048911 Ga0496108_0006066 Ga0496108_0006066_692_1285 176
262 3300048912 Ga0496109_0012276 Ga0496109_0012276_173_766 176
263 3300048914 Ga0496111_0128327 Ga0496111_0128327_363_956 176
264 3300048915 Ga0496112_0007230 Ga0496112_0007230_5467_6060 176
265 3300048916 Ga0496113_0020145 Ga0496113_0020145_1041_1634 176
266 3300053119 Ga0500595_006085 Ga0500595_006085_1572_2168 176
267 3300005983 Ga0081540_1081519 Ga0081540_10815192 177
268 3300007265 Ga0099794_10007233 Ga0099794_100072332 177
269 3300025919 Ga0207657_10831203 Ga0207657_108312032 177
270 3300045976 Ga0466967_0458712 Ga0466967_0458712_416_1021 177
271 3300036401 Ga0373937_0531470 Ga0373937_0531470_504_1070 179
272 2162886012 MBSR1b_contig_5205499 MBSR1b_0107.00004680 180
273 3300001904 JGI24736J21556_1012441 JGI24736J21556_10124412 180
274 3300001976 JGI24752J21851_1002221 JGI24752J21851_10022213 180
275 3300001977 JGI24746J21847_1004701 JGI24746J21847_10047013 180
276 3300001990 JGI24737J22298_10068218 JGI24737J22298_100682181 180
277 3300002070 JGI24750J21931_1006908 JGI24750J21931_10069081 180
278 3300002074 JGI24748J21848_1000593 JGI24748J21848_10005935 180
279 3300002076 JGI24749J21850_1002574 JGI24749J21850_10025743 180
280 3300002077 JGI24744J21845_10002590 JGI24744J21845_100025903 180
281 3300002126 JGI24035J26624_1008926 JGI24035J26624_10089261 180
282 3300002239 JGI24034J26672_10003302 JGI24034J26672_100033023 180
283 3300002459 JGI24751J29686_10014240 JGI24751J29686_100142403 180
284 3300003659 JGI25404J52841_10013664 JGI25404J52841_100136641 180
285 3300003659 JGI25404J52841_10025022 JGI25404J52841_100250222 180
286 3300003659 JGI25404J52841_10085017 JGI25404J52841_100850171 180
287 3300005290 Ga0065712_10152999 Ga0065712_101529993 180
288 3300005293 Ga0065715_10115064 Ga0065715_101150643 180
289 3300005295 Ga0065707_10194203 Ga0065707_101942033 180
290 3300005327 Ga0070658_10000182 Ga0070658_1000018235 180
291 3300005328 Ga0070676_10000270 Ga0070676_1000027018 180
292 3300005329 Ga0070683_100002766 Ga0070683_1000027665 180
293 3300005330 Ga0070690_100000169 Ga0070690_10000016919 180
294 3300005331 Ga0070670_100001193 Ga0070670_1000011937 180
295 3300005333 Ga0070677_10000172 Ga0070677_100001728 180
296 3300005334 Ga0068869_100000310 Ga0068869_10000031019 180
297 3300005335 Ga0070666_10000597 Ga0070666_100005975 180
298 3300005336 Ga0070680_100057418 Ga0070680_1000574183 180
299 3300005337 Ga0070682_100021172 Ga0070682_1000211723 180
300 3300005338 Ga0068868_100000890 Ga0068868_10000089013 180
301 3300005339 Ga0070660_100000798 Ga0070660_10000079813 180
302 3300005340 Ga0070689_100000340 Ga0070689_10000034013 180
303 3300005341 Ga0070691_10042368 Ga0070691_100423683 180
304 3300005343 Ga0070687_100000027 Ga0070687_10000002734 180
305 3300005344 Ga0070661_100000527 Ga0070661_10000052713 180
306 3300005344 Ga0070661_100005001 Ga0070661_1000050014 180
307 3300005347 Ga0070668_100000988 Ga0070668_1000009885 180
308 3300005353 Ga0070669_100000180 Ga0070669_10000018013 180
309 3300005354 Ga0070675_100000427 Ga0070675_10000042721 180
310 3300005355 Ga0070671_100000129 Ga0070671_10000012914 180
311 3300005356 Ga0070674_100000142 Ga0070674_10000014219 180
312 3300005364 Ga0070673_100000188 Ga0070673_10000018819 180
313 3300005365 Ga0070688_100000422 Ga0070688_1000004227 180
314 3300005366 Ga0070659_100000334 Ga0070659_10000033432 180
315 3300005367 Ga0070667_100002644 Ga0070667_10000264413 180
316 3300005406 Ga0070703_10041754 Ga0070703_100417542 180
317 3300005438 Ga0070701_10000920 Ga0070701_1000092010 180
318 3300005440 Ga0070705_100000712 Ga0070705_10000071219 180
319 3300005441 Ga0070700_100004754 Ga0070700_1000047548 180
320 3300005455 Ga0070663_100001370 Ga0070663_1000013702 180
321 3300005457 Ga0070662_100000603 Ga0070662_1000006037 180
322 3300005459 Ga0068867_100001646 Ga0068867_10000164613 180
323 3300005466 Ga0070685_10000029 Ga0070685_1000002972 180
324 3300005539 Ga0068853_100000809 Ga0068853_1000008097 180
325 3300005543 Ga0070672_100000199 Ga0070672_10000019919 180
326 3300005544 Ga0070686_100000095 Ga0070686_10000009523 180
327 3300005546 Ga0070696_100055915 Ga0070696_1000559153 180
328 3300005547 Ga0070693_100006389 Ga0070693_1000063894 180
329 3300005548 Ga0070665_100004804 Ga0070665_10000480413 180
330 3300005549 Ga0070704_100006849 Ga0070704_1000068495 180
331 3300005563 Ga0068855_100000320 Ga0068855_10000032019 180
332 3300005564 Ga0070664_100000516 Ga0070664_10000051623 180
333 3300005564 Ga0070664_100002493 Ga0070664_1000024936 180
334 3300005577 Ga0068857_100000394 Ga0068857_10000039416 180
335 3300005577 Ga0068857_100011961 Ga0068857_1000119617 180
336 3300005578 Ga0068854_100000398 Ga0068854_10000039813 180
337 3300005614 Ga0068856_100002998 Ga0068856_1000029989 180
338 3300005615 Ga0070702_100124557 Ga0070702_1001245573 180
339 3300005616 Ga0068852_100000158 Ga0068852_10000015813 180
340 3300005617 Ga0068859_100003266 Ga0068859_10000326618 180
341 3300005618 Ga0068864_100000608 Ga0068864_10000060819 180
342 3300005718 Ga0068866_10000207 Ga0068866_1000020715 180
343 3300005719 Ga0068861_100000079 Ga0068861_10000007915 180
344 3300005834 Ga0068851_10000389 Ga0068851_100003895 180
345 3300005840 Ga0068870_10000240 Ga0068870_100002405 180
346 3300005841 Ga0068863_100000361 Ga0068863_10000036115 180
347 3300005842 Ga0068858_100001158 Ga0068858_10000115813 180
348 3300005843 Ga0068860_100004483 Ga0068860_10000448313 180
349 3300005844 Ga0068862_100001188 Ga0068862_10000118814 180
350 3300005983 Ga0081540_1000073 Ga0081540_100007343 180
351 3300005983 Ga0081540_1000149 Ga0081540_100014913 180
352 3300005983 Ga0081540_1002379 Ga0081540_100237916 180
353 3300006237 Ga0097621_100000355 Ga0097621_10000035521 180
354 3300006237 Ga0097621_100041824 Ga0097621_1000418245 180
355 3300006358 Ga0068871_100002137 Ga0068871_10000213713 180
356 3300006358 Ga0068871_100190474 Ga0068871_1001904742 180
357 3300006881 Ga0068865_100000184 Ga0068865_10000018419 180
358 3300006931 Ga0097620_100003266 Ga0097620_10000326618 180
359 3300009093 Ga0105240_10011753 Ga0105240_1001175313 180
360 3300009094 Ga0111539_10057756 Ga0111539_100577562 180
361 3300009098 Ga0105245_10000137 Ga0105245_1000013732 180
362 3300009101 Ga0105247_10002555 Ga0105247_1000255510 180
363 3300009148 Ga0105243_10005150 Ga0105243_100051509 180
364 3300009174 Ga0105241_10013667 Ga0105241_100136675 180
365 3300009176 Ga0105242_10001362 Ga0105242_1000136212 180
366 3300009177 Ga0105248_10003453 Ga0105248_1000345310 180
367 3300009545 Ga0105237_10000599 Ga0105237_1000059934 180
368 3300009551 Ga0105238_10000359 Ga0105238_1000035945 180
369 3300009553 Ga0105249_10000275 Ga0105249_1000027542 180
370 3300010375 Ga0105239_10002073 Ga0105239_1000207318 180
371 3300011119 Ga0105246_10042030 Ga0105246_100420304 180
372 3300013100 Ga0157373_10004616 Ga0157373_1000461613 180
373 3300013102 Ga0157371_10000815 Ga0157371_1000081523 180
374 3300013105 Ga0157369_10000816 Ga0157369_100008165 180
375 3300013296 Ga0157374_10001106 Ga0157374_1000110617 180
376 3300013297 Ga0157378_10043041 Ga0157378_100430412 180
377 3300013306 Ga0163162_10001976 Ga0163162_100019765 180
378 3300013307 Ga0157372_10070857 Ga0157372_100708575 180
379 3300013308 Ga0157375_10001185 Ga0157375_1000118524 180
380 3300014325 Ga0163163_10007044 Ga0163163_1000704410 180
381 3300014745 Ga0157377_10000665 Ga0157377_1000066514 180
382 3300014968 Ga0157379_10000385 Ga0157379_1000038534 180
383 3300015262 Ga0182007_10205458 Ga0182007_102054581 180
384 3300017792 Ga0163161_10008990 Ga0163161_100089907 180
385 3300025315 Ga0207697_10000387 Ga0207697_1000038713 180
386 3300025321 Ga0207656_10002324 Ga0207656_100023248 180
387 3300025885 Ga0207653_10078115 Ga0207653_100781152 180
388 3300025893 Ga0207682_10000028 Ga0207682_1000002853 180
389 3300025899 Ga0207642_10000159 Ga0207642_100001594 180
390 3300025900 Ga0207710_10006294 Ga0207710_100062944 180
391 3300025901 Ga0207688_10011841 Ga0207688_100118411 180
392 3300025903 Ga0207680_10001043 Ga0207680_1000104310 180
393 3300025904 Ga0207647_10020220 Ga0207647_100202203 180
394 3300025907 Ga0207645_10000053 Ga0207645_1000005341 180
395 3300025908 Ga0207643_10000013 Ga0207643_1000001372 180
396 3300025911 Ga0207654_10007604 Ga0207654_100076044 180
397 3300025913 Ga0207695_10004154 Ga0207695_1000415415 180
398 3300025914 Ga0207671_10013720 Ga0207671_100137205 180
399 3300025917 Ga0207660_10098803 Ga0207660_100988034 180
400 3300025918 Ga0207662_10000009 Ga0207662_1000000959 180
401 3300025919 Ga0207657_10000042 Ga0207657_1000004240 180
402 3300025920 Ga0207649_10001283 Ga0207649_100012833 180
403 3300025920 Ga0207649_10035508 Ga0207649_100355084 180
404 3300025921 Ga0207652_10547717 Ga0207652_105477171 180
405 3300025923 Ga0207681_10000159 Ga0207681_1000015919 180
406 3300025924 Ga0207694_10005300 Ga0207694_1000530012 180
407 3300025925 Ga0207650_10000245 Ga0207650_1000024541 180
408 3300025926 Ga0207659_10000115 Ga0207659_1000011542 180
409 3300025927 Ga0207687_10000306 Ga0207687_1000030621 180
410 3300025931 Ga0207644_10000201 Ga0207644_1000020131 180
411 3300025932 Ga0207690_10000574 Ga0207690_1000057417 180
412 3300025933 Ga0207706_10000046 Ga0207706_1000004640 180
413 3300025934 Ga0207686_10039959 Ga0207686_100399594 180
414 3300025935 Ga0207709_10009022 Ga0207709_100090224 180
415 3300025936 Ga0207670_10000600 Ga0207670_1000060018 180
416 3300025937 Ga0207669_10000249 Ga0207669_1000024913 180
417 3300025938 Ga0207704_10000174 Ga0207704_1000017421 180
418 3300025940 Ga0207691_10000314 Ga0207691_1000031436 180
419 3300025941 Ga0207711_10000234 Ga0207711_1000023441 180
420 3300025942 Ga0207689_10000071 Ga0207689_1000007140 180
421 3300025945 Ga0207679_10000111 Ga0207679_1000011134 180
422 3300025945 Ga0207679_10003347 Ga0207679_100033476 180
423 3300025949 Ga0207667_10027131 Ga0207667_100271315 180
424 3300025960 Ga0207651_10000284 Ga0207651_1000028419 180
425 3300025961 Ga0207712_10000329 Ga0207712_1000032932 180
426 3300025972 Ga0207668_10003991 Ga0207668_100039917 180
427 3300025981 Ga0207640_10001109 Ga0207640_1000110912 180
428 3300025986 Ga0207658_10000748 Ga0207658_1000074813 180
429 3300026023 Ga0207677_10000181 Ga0207677_1000018119 180
430 3300026035 Ga0207703_10000303 Ga0207703_1000030318 180
431 3300026041 Ga0207639_10013222 Ga0207639_100132222 180
432 3300026067 Ga0207678_10003134 Ga0207678_1000313417 180
433 3300026078 Ga0207702_10000881 Ga0207702_1000088130 180
434 3300026088 Ga0207641_10000652 Ga0207641_1000065214 180
435 3300026089 Ga0207648_10000302 Ga0207648_1000030240 180
436 3300026095 Ga0207676_10000642 Ga0207676_100006425 180
437 3300026116 Ga0207674_10000038 Ga0207674_100000384 180
438 3300026116 Ga0207674_10009569 Ga0207674_100095696 180
439 3300026118 Ga0207675_100000165 Ga0207675_10000016541 180
440 3300026121 Ga0207683_10000211 Ga0207683_1000021131 180
441 3300026142 Ga0207698_10000588 Ga0207698_1000058821 180
442 3300028379 Ga0268266_10000389 Ga0268266_1000038951 180
443 3300028380 Ga0268265_10000394 Ga0268265_100003945 180
444 3300028381 Ga0268264_10000191 Ga0268264_1000019183 180
445 3300039450 Ga0436363_0772388 Ga0436363_0772388_353_895 180
446 3300042012 Ga0439455_0061245 Ga0439455_0061245_286_828 180
447 3300042157 Ga0439458_0039368 Ga0439458_0039368_504_1046 180
448 3300042876 Ga0451577_0029996 Ga0451577_0029996_1899_2441 180
449 3300044712 Ga0453684_0435488 Ga0453684_0435488_211_753 180
450 3300045051 Ga0451576_0006554 Ga0451576_0006554_7054_7596 180
451 3300048903 Ga0496100_0061599 Ga0496100_0061599_206_748 180
452 3300048905 Ga0496102_0000591 Ga0496102_0000591_13719_14261 180
453 3300048907 Ga0496104_0237370 Ga0496104_0237370_574_1116 180
454 3300048908 Ga0496105_0252342 Ga0496105_0252342_363_905 180
455 3300048909 Ga0496106_0010818 Ga0496106_0010818_1517_2059 180
456 3300048910 Ga0496107_0007960 Ga0496107_0007960_2288_2830 180
457 3300048911 Ga0496108_0030756 Ga0496108_0030756_283_825 180
458 3300048912 Ga0496109_0002713 Ga0496109_0002713_11249_11791 180
459 3300048914 Ga0496111_0267531 Ga0496111_0267531_632_1174 180
460 3300048915 Ga0496112_0009498 Ga0496112_0009498_3402_3944 180
461 iso_pu_bacteria 2920107658 2920113055 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

41

148

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9633 19 177
7u4k-assembly1.cif.gz_A crystal structure of human gpx4-u46c-r152h in complex with ml162 0.9569 19 177
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.9542 20 176
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.9476 20 177
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.9426 19 177
ID Description Score Start End Superfamily
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9629 21 176 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9476 20 177 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.945 21 179 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.944 21 180 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.942 20 177 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5J6SXM0-F1-model_v4 deleted 0.992 22 177
AF-A0A7Y5SXA8-F1-model_v4 Glutathione peroxidase 0.9902 22 176 GO:0004601
GO:0034599
AF-A0A7R8B7K5-F1-model_v4 deleted 0.9902 19 176
AF-A0A3C1M208-F1-model_v4 Glutathione peroxidase 0.9891 19 176 GO:0004601
GO:0034599
AF-A0A2P2DZK9-F1-model_v4 Glutathione peroxidase 0.9857 20 177 GO:0004601
GO:0034599

Feature Viewer

pLDDT pTM Quality
91.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map