F448637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 460 | 304 | 460 | 69 |
Family's Representative Sequence
| Representative Sequence | 3300053739|Ga0500587_034280|Ga0500587_034280_40_297 |
| Length | 85 |
| Sequence | MSARLVHKRINARKAKMATGTVKFFNAQKGFGFIQPADGSKDVFVHISAVERAGLGSLNEGQKVSFEATVDSKRGKTSAENLRAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 84 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 127 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 140 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 144 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 149 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 154 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 155 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 156 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 157 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 213 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 241 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 242 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 243 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 252 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 253 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 256 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 257 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 259 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 260 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 262 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 263 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 264 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 265 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 266 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 267 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 269 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 270 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 273 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 274 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 278 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 279 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 280 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 281 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 283 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 286 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 289 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 290 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 292 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 293 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 294 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 295 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 297 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 298 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 299 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 300 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.57 |
| Nodule | 0 |
| Rhizoplane | 4.78 |
| Rhizosphere | 63.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10039473 | 3300003215 | Bacteria | 1475 |
| 2 | Ga0055536_1008093 | 3300003781 | Bacteria | 4586 |
| 3 | Ga0055530_10000337 | 3300003791 | Bacteria | 42372 |
| 4 | Ga0055530_10015205 | 3300003791 | Bacteria | 2526 |
| 5 | Ga0055531_10000915 | 3300003794 | Bacteria | 23931 |
| 6 | Ga0055531_10012998 | 3300003794 | Bacteria | 3871 |
| 7 | Ga0055531_10017100 | 3300003794 | Bacteria | 3081 |
| 8 | Ga0055531_10057166 | 3300003794 | Bacteria | 979 |
| 9 | Ga0065165_1017934 | 3300005262 | Bacteria | 2585 |
| 10 | Ga0065165_1122586 | 3300005262 | Bacteria | 629 |
| 11 | Ga0070658_10949209 | 3300005327 | Bacteria | 748 |
| 12 | Ga0070683_101614217 | 3300005329 | Bacteria | 624 |
| 13 | Ga0070683_102071723 | 3300005329 | Bacteria | 547 |
| 14 | Ga0070670_101076986 | 3300005331 | Bacteria | 732 |
| 15 | Ga0068869_100234594 | 3300005334 | Bacteria | 1459 |
| 16 | Ga0070666_11358144 | 3300005335 | Bacteria | 531 |
| 17 | Ga0070680_100670477 | 3300005336 | Bacteria | 892 |
| 18 | Ga0070682_100879420 | 3300005337 | Bacteria | 734 |
| 19 | Ga0070660_100026203 | 3300005339 | Bacteria | 4339 |
| 20 | Ga0070689_100541909 | 3300005340 | Bacteria | 1002 |
| 21 | Ga0070689_100584363 | 3300005340 | Bacteria | 966 |
| 22 | Ga0070661_100546111 | 3300005344 | Bacteria | 932 |
| 23 | Ga0070668_100080095 | 3300005347 | Bacteria | 2558 |
| 24 | Ga0070668_100376961 | 3300005347 | Bacteria | 1206 |
| 25 | Ga0070668_101448208 | 3300005347 | Bacteria | 627 |
| 26 | Ga0070669_100317966 | 3300005353 | Bacteria | 1256 |
| 27 | Ga0070669_100633028 | 3300005353 | Bacteria | 899 |
| 28 | Ga0070675_101679735 | 3300005354 | Bacteria | 586 |
| 29 | Ga0070667_100793782 | 3300005367 | Bacteria | 879 |
| 30 | Ga0070714_100326147 | 3300005435 | Bacteria | 1437 |
| 31 | Ga0070714_100378000 | 3300005435 | Bacteria | 1335 |
| 32 | Ga0070663_100029850 | 3300005455 | Bacteria | 3730 |
| 33 | Ga0070678_101483133 | 3300005456 | Bacteria | 635 |
| 34 | Ga0070681_10199509 | 3300005458 | Bacteria | 1919 |
| 35 | Ga0070681_11590773 | 3300005458 | Bacteria | 579 |
| 36 | Ga0068867_101027515 | 3300005459 | Bacteria | 749 |
| 37 | Ga0068867_101503387 | 3300005459 | Bacteria | 627 |
| 38 | Ga0070698_101404935 | 3300005471 | Bacteria | 649 |
| 39 | Ga0070684_101623619 | 3300005535 | Bacteria | 610 |
| 40 | Ga0070672_100805281 | 3300005543 | Bacteria | 827 |
| 41 | Ga0070686_101583762 | 3300005544 | Bacteria | 554 |
| 42 | Ga0070695_100288233 | 3300005545 | Bacteria | 1209 |
| 43 | Ga0070693_100738918 | 3300005547 | Bacteria | 724 |
| 44 | Ga0070665_100005904 | 3300005548 | Bacteria | 12540 |
| 45 | Ga0070665_100464623 | 3300005548 | Bacteria | 1276 |
| 46 | Ga0068855_100060409 | 3300005563 | Bacteria | 4433 |
| 47 | Ga0068855_100146673 | 3300005563 | Bacteria | 2686 |
| 48 | Ga0068855_100540840 | 3300005563 | Bacteria | 1262 |
| 49 | Ga0068855_100989877 | 3300005563 | Bacteria | 884 |
| 50 | Ga0068857_101012417 | 3300005577 | Bacteria | 800 |
| 51 | Ga0068854_100245352 | 3300005578 | Bacteria | 1428 |
| 52 | Ga0068854_101382101 | 3300005578 | Bacteria | 636 |
| 53 | Ga0068854_101581571 | 3300005578 | Bacteria | 597 |
| 54 | Ga0068854_102232237 | 3300005578 | Bacteria | 507 |
| 55 | Ga0068856_100011504 | 3300005614 | Bacteria | 8588 |
| 56 | Ga0068856_100309582 | 3300005614 | Bacteria | 1597 |
| 57 | Ga0068856_100673893 | 3300005614 | Bacteria | 1055 |
| 58 | Ga0068856_102349778 | 3300005614 | Bacteria | 541 |
| 59 | Ga0068852_100013033 | 3300005616 | Bacteria | 6346 |
| 60 | Ga0068859_102417112 | 3300005617 | Bacteria | 579 |
| 61 | Ga0068866_10594438 | 3300005718 | Bacteria | 746 |
| 62 | Ga0068861_101524187 | 3300005719 | Bacteria | 656 |
| 63 | Ga0068863_100917160 | 3300005841 | Bacteria | 877 |
| 64 | Ga0068863_101326413 | 3300005841 | Bacteria | 727 |
| 65 | Ga0068863_101417389 | 3300005841 | Bacteria | 703 |
| 66 | Ga0068858_102156860 | 3300005842 | Bacteria | 551 |
| 67 | Ga0068860_100000037 | 3300005843 | Bacteria | 234524 |
| 68 | Ga0068862_100054756 | 3300005844 | Bacteria | 3415 |
| 69 | Ga0068862_100260857 | 3300005844 | Bacteria | 1582 |
| 70 | Ga0081455_10001951 | 3300005937 | Bacteria | 24782 |
| 71 | Ga0070717_10118798 | 3300006028 | Bacteria | 2263 |
| 72 | Ga0075365_10023371 | 3300006038 | Bacteria | 3887 |
| 73 | Ga0075363_100039586 | 3300006048 | Bacteria | 2481 |
| 74 | Ga0075364_10246667 | 3300006051 | Bacteria | 1213 |
| 75 | Ga0075364_10279124 | 3300006051 | Bacteria | 1136 |
| 76 | Ga0070712_100974651 | 3300006175 | Bacteria | 733 |
| 77 | Ga0075367_10022115 | 3300006178 | Bacteria | 3563 |
| 78 | Ga0075369_10195233 | 3300006186 | Bacteria | 933 |
| 79 | Ga0075369_10384901 | 3300006186 | Bacteria | 660 |
| 80 | Ga0075366_10509985 | 3300006195 | Bacteria | 744 |
| 81 | Ga0097621_100344937 | 3300006237 | Bacteria | 1323 |
| 82 | Ga0075370_10079587 | 3300006353 | Bacteria | 1882 |
| 83 | Ga0075370_10108230 | 3300006353 | Bacteria | 1613 |
| 84 | Ga0075370_10185246 | 3300006353 | Bacteria | 1226 |
| 85 | Ga0068871_100300072 | 3300006358 | Bacteria | 1410 |
| 86 | Ga0068871_100570836 | 3300006358 | Bacteria | 1026 |
| 87 | Ga0068871_101128480 | 3300006358 | Bacteria | 734 |
| 88 | Ga0075428_102574753 | 3300006844 | Bacteria | 520 |
| 89 | Ga0075433_10450118 | 3300006852 | Bacteria | 1135 |
| 90 | Ga0068865_100002490 | 3300006881 | Bacteria | 10907 |
| 91 | Ga0068865_100509048 | 3300006881 | Bacteria | 1005 |
| 92 | Ga0075436_101426886 | 3300006914 | Bacteria | 525 |
| 93 | Ga0097620_102416754 | 3300006931 | Bacteria | 579 |
| 94 | Ga0099795_10079903 | 3300007788 | Bacteria | 1249 |
| 95 | Ga0105240_11682394 | 3300009093 | Bacteria | 663 |
| 96 | Ga0105240_12069702 | 3300009093 | Bacteria | 591 |
| 97 | Ga0111539_13443358 | 3300009094 | Bacteria | 508 |
| 98 | Ga0105245_11376453 | 3300009098 | Bacteria | 755 |
| 99 | Ga0105247_10360574 | 3300009101 | Bacteria | 1025 |
| 100 | Ga0105248_10741995 | 3300009177 | Bacteria | 1108 |
| 101 | Ga0105237_11530400 | 3300009545 | Bacteria | 674 |
| 102 | Ga0105238_12162816 | 3300009551 | Bacteria | 591 |
| 103 | Ga0105249_11204986 | 3300009553 | Bacteria | 828 |
| 104 | Ga0099796_10014563 | 3300010159 | Bacteria | 2275 |
| 105 | Ga0105246_10372721 | 3300011119 | Bacteria | 1177 |
| 106 | Ga0105246_10709144 | 3300011119 | Bacteria | 883 |
| 107 | Ga0157369_10064024 | 3300013105 | Bacteria | 3960 |
| 108 | Ga0157369_10901797 | 3300013105 | Bacteria | 907 |
| 109 | Ga0163162_10501172 | 3300013306 | Bacteria | 1345 |
| 110 | Ga0163162_12874535 | 3300013306 | Bacteria | 554 |
| 111 | Ga0157375_11466552 | 3300013308 | Bacteria | 805 |
| 112 | Ga0163163_10542515 | 3300014325 | Bacteria | 1225 |
| 113 | Ga0163163_12900816 | 3300014325 | Bacteria | 535 |
| 114 | Ga0157380_10921799 | 3300014326 | Bacteria | 901 |
| 115 | Ga0157380_11041165 | 3300014326 | Bacteria | 854 |
| 116 | Ga0157380_11280522 | 3300014326 | Bacteria | 780 |
| 117 | Ga0157380_11361511 | 3300014326 | Bacteria | 759 |
| 118 | Ga0157380_11601540 | 3300014326 | Bacteria | 707 |
| 119 | Ga0157380_11751543 | 3300014326 | Bacteria | 680 |
| 120 | Ga0157380_12233478 | 3300014326 | Bacteria | 611 |
| 121 | Ga0182008_10143737 | 3300014497 | Bacteria | 1194 |
| 122 | Ga0157377_10613212 | 3300014745 | Bacteria | 778 |
| 123 | Ga0157379_10654342 | 3300014968 | Bacteria | 984 |
| 124 | Ga0157379_10766713 | 3300014968 | Bacteria | 909 |
| 125 | Ga0157376_10461238 | 3300014969 | Bacteria | 1241 |
| 126 | Ga0182007_10012367 | 3300015262 | Bacteria | 3284 |
| 127 | Ga0163161_10375478 | 3300017792 | Bacteria | 1135 |
| 128 | Ga0163161_11292726 | 3300017792 | Bacteria | 634 |
| 129 | Ga0213872_10075297 | 3300021361 | Bacteria | 1519 |
| 130 | Ga0213875_10037946 | 3300021388 | Bacteria | 2270 |
| 131 | Ga0209026_1004463 | 3300025250 | Bacteria | 4132 |
| 132 | Ga0209148_1020118 | 3300025254 | Bacteria | 1101 |
| 133 | Ga0209233_1053394 | 3300025261 | Bacteria | 811 |
| 134 | Ga0209455_1041381 | 3300025272 | Bacteria | 698 |
| 135 | Ga0209676_1000282 | 3300025292 | Bacteria | 105777 |
| 136 | Ga0209564_1010399 | 3300025295 | Bacteria | 4292 |
| 137 | Ga0209758_1003525 | 3300025297 | Bacteria | 14108 |
| 138 | Ga0209050_1000095 | 3300025298 | Bacteria | 242722 |
| 139 | Ga0209050_1001911 | 3300025298 | Bacteria | 19933 |
| 140 | Ga0209257_1000106 | 3300025304 | Bacteria | 242634 |
| 141 | Ga0209257_1000332 | 3300025304 | Bacteria | 98632 |
| 142 | Ga0209257_1000641 | 3300025304 | Bacteria | 55911 |
| 143 | Ga0207688_10246264 | 3300025901 | Bacteria | 1082 |
| 144 | Ga0207654_10222856 | 3300025911 | Bacteria | 1252 |
| 145 | Ga0207707_10457787 | 3300025912 | Bacteria | 1091 |
| 146 | Ga0207695_10383141 | 3300025913 | Bacteria | 1292 |
| 147 | Ga0207695_11063388 | 3300025913 | Bacteria | 689 |
| 148 | Ga0207695_11257804 | 3300025913 | Bacteria | 620 |
| 149 | Ga0207671_10897630 | 3300025914 | Bacteria | 701 |
| 150 | Ga0207657_10028470 | 3300025919 | Bacteria | 5096 |
| 151 | Ga0207657_10995826 | 3300025919 | Bacteria | 643 |
| 152 | Ga0207657_11027570 | 3300025919 | Bacteria | 632 |
| 153 | Ga0207681_10322349 | 3300025923 | Bacteria | 1229 |
| 154 | Ga0207681_10804391 | 3300025923 | Bacteria | 785 |
| 155 | Ga0207694_10037753 | 3300025924 | Bacteria | 3712 |
| 156 | Ga0207694_10320212 | 3300025924 | Bacteria | 1280 |
| 157 | Ga0207650_10329371 | 3300025925 | Bacteria | 1252 |
| 158 | Ga0207650_11022772 | 3300025925 | Bacteria | 703 |
| 159 | Ga0207650_11644062 | 3300025925 | Bacteria | 545 |
| 160 | Ga0207659_10795104 | 3300025926 | Bacteria | 812 |
| 161 | Ga0207659_11443643 | 3300025926 | Bacteria | 589 |
| 162 | Ga0207664_11009887 | 3300025929 | Bacteria | 745 |
| 163 | Ga0207670_11053952 | 3300025936 | Bacteria | 685 |
| 164 | Ga0207704_10023565 | 3300025938 | Bacteria | 3320 |
| 165 | Ga0207704_10499026 | 3300025938 | Bacteria | 981 |
| 166 | Ga0207691_11112307 | 3300025940 | Bacteria | 657 |
| 167 | Ga0207661_11198285 | 3300025944 | Bacteria | 699 |
| 168 | Ga0207661_11668391 | 3300025944 | Bacteria | 582 |
| 169 | Ga0207667_10111987 | 3300025949 | Bacteria | 2815 |
| 170 | Ga0207667_10228837 | 3300025949 | Bacteria | 1904 |
| 171 | Ga0207667_10289251 | 3300025949 | Bacteria | 1674 |
| 172 | Ga0207667_10820046 | 3300025949 | Bacteria | 926 |
| 173 | Ga0207667_10829305 | 3300025949 | Bacteria | 920 |
| 174 | Ga0207667_11587597 | 3300025949 | Bacteria | 623 |
| 175 | Ga0207668_10130453 | 3300025972 | Bacteria | 1918 |
| 176 | Ga0207668_11211633 | 3300025972 | Bacteria | 679 |
| 177 | Ga0207668_11585544 | 3300025972 | Bacteria | 591 |
| 178 | Ga0207640_10013118 | 3300025981 | Bacteria | 4740 |
| 179 | Ga0207640_11570031 | 3300025981 | Bacteria | 592 |
| 180 | Ga0207658_10411778 | 3300025986 | Bacteria | 1190 |
| 181 | Ga0207678_10027553 | 3300026067 | Bacteria | 4958 |
| 182 | Ga0207702_10034487 | 3300026078 | Bacteria | 4231 |
| 183 | Ga0207702_10203336 | 3300026078 | Bacteria | 1837 |
| 184 | Ga0207702_10316145 | 3300026078 | Bacteria | 1486 |
| 185 | Ga0207702_10894247 | 3300026078 | Bacteria | 880 |
| 186 | Ga0207702_10943505 | 3300026078 | Bacteria | 855 |
| 187 | Ga0207641_10618680 | 3300026088 | Bacteria | 1062 |
| 188 | Ga0207648_10532371 | 3300026089 | Bacteria | 1077 |
| 189 | Ga0207648_11645839 | 3300026089 | Bacteria | 603 |
| 190 | Ga0207674_11247145 | 3300026116 | Bacteria | 713 |
| 191 | Ga0207674_11402948 | 3300026116 | Bacteria | 668 |
| 192 | Ga0207675_102328974 | 3300026118 | Bacteria | 549 |
| 193 | Ga0207683_10897424 | 3300026121 | Bacteria | 823 |
| 194 | Ga0207698_10047667 | 3300026142 | Bacteria | 3248 |
| 195 | Ga0207698_11001791 | 3300026142 | Bacteria | 846 |
| 196 | Ga0209179_1026856 | 3300027512 | Bacteria | 1158 |
| 197 | Ga0268266_10002702 | 3300028379 | Bacteria | 18611 |
| 198 | Ga0268266_10130329 | 3300028379 | Bacteria | 2249 |
| 199 | Ga0268265_10005623 | 3300028380 | Bacteria | 8562 |
| 200 | Ga0268265_10128073 | 3300028380 | Bacteria | 2105 |
| 201 | Ga0268265_10178342 | 3300028380 | Bacteria | 1823 |
| 202 | Ga0268265_10494293 | 3300028380 | Bacteria | 1151 |
| 203 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 204 | Ga0307515_10147271 | 3300028794 | Bacteria | 2486 |
| 205 | Ga0307511_10009257 | 3300030521 | Bacteria | 9811 |
| 206 | Ga0265330_10339156 | 3300031235 | Bacteria | 634 |
| 207 | Ga0307513_10122822 | 3300031456 | Bacteria | 2560 |
| 208 | Ga0307408_102529699 | 3300031548 | Bacteria | 500 |
| 209 | Ga0316579_10040909 | 3300031691 | Bacteria | 2151 |
| 210 | Ga0316579_10103418 | 3300031691 | Bacteria | 1365 |
| 211 | Ga0265314_10144092 | 3300031711 | Bacteria | 1469 |
| 212 | Ga0307405_10101846 | 3300031731 | Bacteria | 1928 |
| 213 | Ga0307405_11467339 | 3300031731 | Bacteria | 598 |
| 214 | Ga0307405_11908103 | 3300031731 | Bacteria | 530 |
| 215 | Ga0307405_12048939 | 3300031731 | Bacteria | 513 |
| 216 | Ga0307413_10155204 | 3300031824 | Bacteria | 1600 |
| 217 | Ga0307413_10367673 | 3300031824 | Bacteria | 1116 |
| 218 | Ga0307406_11387418 | 3300031901 | Bacteria | 615 |
| 219 | Ga0307409_102054729 | 3300031995 | Bacteria | 601 |
| 220 | Ga0307416_102888180 | 3300032002 | Bacteria | 575 |
| 221 | Ga0307414_10218288 | 3300032004 | Bacteria | 1563 |
| 222 | Ga0307411_10137932 | 3300032005 | Bacteria | 1794 |
| 223 | Ga0307411_10236234 | 3300032005 | Bacteria | 1428 |
| 224 | Ga0316583_10000048 | 3300032133 | Bacteria | 23093 |
| 225 | Ga0316593_10037294 | 3300032168 | Bacteria | 1606 |
| 226 | Ga0316593_10161695 | 3300032168 | Bacteria | 818 |
| 227 | Ga0316593_10226330 | 3300032168 | Bacteria | 696 |
| 228 | Ga0307510_10054322 | 3300033180 | Bacteria | 4197 |
| 229 | Ga0307510_10149207 | 3300033180 | Bacteria | 1962 |
| 230 | Ga0373934_0054909 | 3300035086 | Bacteria | 1582 |
| 231 | Ga0373924_0582914 | 3300035410 | Bacteria | 504 |
| 232 | Ga0373933_0631117 | 3300035724 | Bacteria | 704 |
| 233 | Ga0373925_0113154 | 3300037068 | Bacteria | 2098 |
| 234 | Ga0395898_0257306 | 3300037466 | Bacteria | 1665 |
| 235 | Ga0395905_0279921 | 3300037471 | Bacteria | 1554 |
| 236 | Ga0395905_0554713 | 3300037471 | Bacteria | 1050 |
| 237 | Ga0395905_0872781 | 3300037471 | Bacteria | 803 |
| 238 | Ga0395905_1581827 | 3300037471 | Bacteria | 560 |
| 239 | Ga0316581_0153903 | 3300037588 | Bacteria | 709 |
| 240 | Ga0436364_1205445 | 3300037853 | Bacteria | 4539 |
| 241 | Ga0395901_1222831 | 3300038443 | Bacteria | 716 |
| 242 | Ga0436365_0332337 | 3300039437 | Bacteria | 581 |
| 243 | Ga0451793_1733260 | 3300041452 | Bacteria | 603 |
| 244 | Ga0451841_0587899 | 3300041498 | Bacteria | 712 |
| 245 | Ga0451855_1514446 | 3300041511 | Bacteria | 530 |
| 246 | Ga0451853_0315559 | 3300041512 | Bacteria | 555 |
| 247 | Ga0451853_2618744 | 3300041512 | Bacteria | 509 |
| 248 | Ga0439431_0019146 | 3300041997 | Bacteria | 1624 |
| 249 | Ga0453684_0457212 | 3300044712 | Bacteria | 1420 |
| 250 | Ga0495603_0021713 | 3300046455 | Bacteria | 3888 |
| 251 | Ga0495638_0084882 | 3300046460 | Bacteria | 1915 |
| 252 | Ga0495638_0099278 | 3300046460 | Bacteria | 1743 |
| 253 | Ga0495650_0060370 | 3300046471 | Bacteria | 1523 |
| 254 | Ga0495639_0117027 | 3300046475 | Bacteria | 1269 |
| 255 | Ga0495607_0211014 | 3300046501 | Bacteria | 955 |
| 256 | Ga0495583_0054853 | 3300046506 | Bacteria | 1803 |
| 257 | Ga0495606_0289302 | 3300046507 | Bacteria | 892 |
| 258 | Ga0495606_0591326 | 3300046507 | Bacteria | 546 |
| 259 | Ga0495610_0079773 | 3300046512 | Bacteria | 1506 |
| 260 | Ga0495616_0033362 | 3300046513 | Bacteria | 2683 |
| 261 | Ga0495620_0033380 | 3300046515 | Bacteria | 2337 |
| 262 | Ga0495628_0213659 | 3300046516 | Bacteria | 1450 |
| 263 | Ga0495630_0906438 | 3300046517 | Bacteria | 671 |
| 264 | Ga0495631_0189527 | 3300046518 | Bacteria | 880 |
| 265 | Ga0495632_0064449 | 3300046519 | Bacteria | 1772 |
| 266 | Ga0495637_0148318 | 3300046520 | Bacteria | 886 |
| 267 | Ga0495643_0130520 | 3300046522 | Bacteria | 1262 |
| 268 | Ga0495643_0340730 | 3300046522 | Bacteria | 673 |
| 269 | Ga0495648_0000580 | 3300046524 | Bacteria | 39129 |
| 270 | Ga0495648_0240396 | 3300046524 | Bacteria | 880 |
| 271 | Ga0495666_0303304 | 3300046526 | Bacteria | 722 |
| 272 | Ga0495654_0023909 | 3300046530 | Bacteria | 3161 |
| 273 | Ga0495609_0090384 | 3300046538 | Bacteria | 1332 |
| 274 | Ga0495621_0154455 | 3300046539 | Bacteria | 904 |
| 275 | Ga0495597_0063998 | 3300046542 | Bacteria | 1598 |
| 276 | Ga0495645_0061511 | 3300046543 | Bacteria | 2720 |
| 277 | Ga0495668_0000037 | 3300046616 | Bacteria | 233981 |
| 278 | Ga0495668_0044827 | 3300046616 | Bacteria | 2458 |
| 279 | Ga0495668_0134058 | 3300046616 | Bacteria | 1355 |
| 280 | Ga0495668_0184923 | 3300046616 | Bacteria | 1141 |
| 281 | Ga0495668_0546499 | 3300046616 | Bacteria | 639 |
| 282 | Ga0495611_0083825 | 3300046648 | Bacteria | 1469 |
| 283 | Ga0495625_0205883 | 3300046660 | Bacteria | 1296 |
| 284 | Ga0495625_0209604 | 3300046660 | Bacteria | 1281 |
| 285 | Ga0495659_0293472 | 3300046664 | Bacteria | 686 |
| 286 | Ga0495661_0167295 | 3300046665 | Bacteria | 1175 |
| 287 | Ga0495588_0182761 | 3300046674 | Bacteria | 1108 |
| 288 | Ga0495658_0476425 | 3300046683 | Bacteria | 798 |
| 289 | Ga0495670_0063486 | 3300046691 | Bacteria | 1859 |
| 290 | Ga0495670_0370750 | 3300046691 | Bacteria | 772 |
| 291 | Ga0495671_0069471 | 3300046692 | Bacteria | 1731 |
| 292 | Ga0495660_0089247 | 3300046810 | Bacteria | 1605 |
| 293 | Ga0495674_1248187 | 3300047319 | Bacteria | 560 |
| 294 | Ga0495672_0517392 | 3300047320 | Bacteria | 528 |
| 295 | Ga0495673_0000191 | 3300047469 | Bacteria | 96817 |
| 296 | Ga0495681_0117065 | 3300047470 | Bacteria | 1147 |
| 297 | Ga0495686_0138549 | 3300047472 | Bacteria | 1437 |
| 298 | Ga0495686_0177123 | 3300047472 | Bacteria | 1237 |
| 299 | Ga0495686_0306569 | 3300047472 | Bacteria | 874 |
| 300 | Ga0495686_0366145 | 3300047472 | Bacteria | 780 |
| 301 | Ga0495686_0393412 | 3300047472 | Bacteria | 745 |
| 302 | Ga0495686_0456106 | 3300047472 | Bacteria | 678 |
| 303 | Ga0495686_0660918 | 3300047472 | Bacteria | 536 |
| 304 | Ga0495626_0223030 | 3300048091 | Bacteria | 765 |
| 305 | Ga0496100_0131602 | 3300048903 | Bacteria | 1763 |
| 306 | Ga0496100_0149359 | 3300048903 | Bacteria | 1665 |
| 307 | Ga0496100_0507851 | 3300048903 | Bacteria | 929 |
| 308 | Ga0496102_0200750 | 3300048905 | Bacteria | 1880 |
| 309 | Ga0496102_1044327 | 3300048905 | Bacteria | 737 |
| 310 | Ga0496103_0681367 | 3300048906 | Bacteria | 652 |
| 311 | Ga0496104_1538263 | 3300048907 | Bacteria | 568 |
| 312 | Ga0496105_1089907 | 3300048908 | Bacteria | 593 |
| 313 | Ga0496106_0472933 | 3300048909 | Bacteria | 1007 |
| 314 | Ga0496107_0862791 | 3300048910 | Bacteria | 661 |
| 315 | Ga0496108_0473908 | 3300048911 | Bacteria | 1094 |
| 316 | Ga0496108_0841170 | 3300048911 | Bacteria | 790 |
| 317 | Ga0496109_0556628 | 3300048912 | Bacteria | 1082 |
| 318 | Ga0496110_0023917 | 3300048913 | Bacteria | 5202 |
| 319 | Ga0496111_1186162 | 3300048914 | Bacteria | 541 |
| 320 | Ga0496112_0090897 | 3300048915 | Bacteria | 3022 |
| 321 | Ga0496112_0228214 | 3300048915 | Bacteria | 1817 |
| 322 | Ga0496112_0571638 | 3300048915 | Bacteria | 1063 |
| 323 | Ga0496113_0217892 | 3300048916 | Bacteria | 1521 |
| 324 | Ga0496114_1681055 | 3300048917 | Bacteria | 523 |
| 325 | Ga0496115_1223373 | 3300048918 | Bacteria | 563 |
| 326 | Ga0496116_0002966 | 3300048919 | Bacteria | 17265 |
| 327 | Ga0496116_0192452 | 3300048919 | Bacteria | 1078 |
| 328 | Ga0496117_0091572 | 3300048920 | Bacteria | 1955 |
| 329 | Ga0496118_0070949 | 3300048921 | Bacteria | 2511 |
| 330 | Ga0496118_0151844 | 3300048921 | Bacteria | 1448 |
| 331 | Ga0496119_0377553 | 3300048922 | Bacteria | 680 |
| 332 | Ga0496120_0012249 | 3300048923 | Bacteria | 5845 |
| 333 | Ga0496121_0006360 | 3300048924 | Bacteria | 14719 |
| 334 | Ga0496121_0012038 | 3300048924 | Bacteria | 9504 |
| 335 | Ga0496122_0027335 | 3300048925 | Bacteria | 4882 |
| 336 | Ga0496123_0012473 | 3300048926 | Bacteria | 7244 |
| 337 | Ga0496123_0123285 | 3300048926 | Bacteria | 1452 |
| 338 | Ga0496124_0022257 | 3300048927 | Bacteria | 5817 |
| 339 | Ga0496124_0316771 | 3300048927 | Bacteria | 1119 |
| 340 | Ga0496125_0045576 | 3300048928 | Bacteria | 3688 |
| 341 | Ga0496125_0072227 | 3300048928 | Bacteria | 2690 |
| 342 | Ga0496125_0520966 | 3300048928 | Bacteria | 664 |
| 343 | Ga0496126_0023915 | 3300048929 | Bacteria | 5908 |
| 344 | Ga0496126_0044792 | 3300048929 | Bacteria | 4071 |
| 345 | Ga0496126_0428547 | 3300048929 | Bacteria | 1068 |
| 346 | Ga0501306_045825 | 3300049127 | Bacteria | 690 |
| 347 | Ga0501306_073932 | 3300049127 | Bacteria | 579 |
| 348 | Ga0501343_024323 | 3300049132 | Bacteria | 544 |
| 349 | Ga0495678_063370 | 3300049459 | Bacteria | 1381 |
| 350 | Ga0501316_081007 | 3300049532 | Bacteria | 502 |
| 351 | Ga0501317_071148 | 3300049533 | Bacteria | 587 |
| 352 | Ga0501319_023815 | 3300049535 | Bacteria | 562 |
| 353 | Ga0501320_015656 | 3300049536 | Bacteria | 831 |
| 354 | Ga0501320_041686 | 3300049536 | Bacteria | 603 |
| 355 | Ga0501320_045908 | 3300049536 | Bacteria | 584 |
| 356 | Ga0501321_031487 | 3300049537 | Bacteria | 711 |
| 357 | Ga0501323_023887 | 3300049539 | Bacteria | 823 |
| 358 | Ga0501323_050245 | 3300049539 | Bacteria | 631 |
| 359 | Ga0501324_006409 | 3300049540 | Bacteria | 991 |
| 360 | Ga0501324_025039 | 3300049540 | Bacteria | 628 |
| 361 | Ga0501325_035543 | 3300049541 | Bacteria | 588 |
| 362 | Ga0501325_053934 | 3300049541 | Bacteria | 517 |
| 363 | Ga0501329_03055 | 3300049545 | Bacteria | 833 |
| 364 | Ga0501047_1017092 | 3300049581 | Bacteria | 642 |
| 365 | Ga0501070_0696324 | 3300049586 | Bacteria | 804 |
| 366 | Ga0501073_0734234 | 3300049589 | Bacteria | 681 |
| 367 | Ga0501074_0516773 | 3300049590 | Bacteria | 846 |
| 368 | Ga0501080_0188462 | 3300049742 | Bacteria | 1896 |
| 369 | Ga0501241_098287 | 3300049758 | Bacteria | 628 |
| 370 | Ga0501269_067686 | 3300049766 | Bacteria | 514 |
| 371 | nmdc:mga03683_95265_c1 | 3300050489 | Bacteria | 1303 |
| 372 | nmdc:mga03n38_186224_c1 | 3300050490 | Bacteria | 1067 |
| 373 | nmdc:mga03n38_764186_c1 | 3300050490 | Bacteria | 561 |
| 374 | nmdc:mga00v17_187603_c1 | 3300050491 | Bacteria | 1335 |
| 375 | nmdc:mga0yw44_220863_c1 | 3300050492 | Bacteria | 1256 |
| 376 | nmdc:mga0yw44_4055_c1 | 3300050492 | Bacteria | 6630 |
| 377 | nmdc:mga0yw44_893201_c1 | 3300050492 | Bacteria | 603 |
| 378 | nmdc:mga06z11_541356_c1 | 3300050494 | Bacteria | 707 |
| 379 | nmdc:mga07m45_40638_c1 | 3300050496 | Bacteria | 2602 |
| 380 | nmdc:mga07m45_558820_c1 | 3300050496 | Bacteria | 662 |
| 381 | nmdc:mga07m45_614948_c1 | 3300050496 | Bacteria | 627 |
| 382 | nmdc:mga07m45_78543_c1 | 3300050496 | Bacteria | 1883 |
| 383 | nmdc:mga0n895_1100334_c1 | 3300050512 | Bacteria | 772 |
| 384 | nmdc:mga0a205_880589_c1 | 3300050515 | Bacteria | 742 |
| 385 | nmdc:mga0sz30_13911_c1 | 3300050516 | Bacteria | 3159 |
| 386 | nmdc:mga0sz30_7935_c1 | 3300050516 | Bacteria | 3995 |
| 387 | Ga0500635_0110332 | 3300053080 | Bacteria | 1021 |
| 388 | Ga0500643_041656 | 3300053087 | Bacteria | 1347 |
| 389 | Ga0500643_093981 | 3300053087 | Bacteria | 816 |
| 390 | Ga0500644_0000187 | 3300053088 | Bacteria | 39159 |
| 391 | Ga0500644_0168901 | 3300053088 | Bacteria | 888 |
| 392 | Ga0500581_083483 | 3300053089 | Bacteria | 1591 |
| 393 | Ga0500646_0049813 | 3300053090 | Bacteria | 1205 |
| 394 | Ga0500651_0018719 | 3300053093 | Bacteria | 4289 |
| 395 | Ga0500651_0075557 | 3300053093 | Bacteria | 2093 |
| 396 | Ga0500651_0549756 | 3300053093 | Bacteria | 631 |
| 397 | Ga0500566_0000474 | 3300053094 | Bacteria | 22351 |
| 398 | Ga0500566_0247505 | 3300053094 | Bacteria | 869 |
| 399 | Ga0500641_0226320 | 3300053096 | Bacteria | 791 |
| 400 | Ga0500650_0099254 | 3300053098 | Bacteria | 1362 |
| 401 | Ga0500650_0493270 | 3300053098 | Bacteria | 521 |
| 402 | Ga0500654_196690 | 3300053099 | Bacteria | 615 |
| 403 | Ga0500554_000457 | 3300053102 | Bacteria | 8572 |
| 404 | Ga0500554_104201 | 3300053102 | Bacteria | 951 |
| 405 | Ga0500556_0000029 | 3300053104 | Bacteria | 165326 |
| 406 | Ga0500562_069532 | 3300053108 | Bacteria | 949 |
| 407 | Ga0500569_019245 | 3300053109 | Bacteria | 1774 |
| 408 | Ga0500592_003760 | 3300053116 | Bacteria | 2420 |
| 409 | Ga0500593_224053 | 3300053117 | Bacteria | 658 |
| 410 | Ga0500594_0009753 | 3300053118 | Bacteria | 2217 |
| 411 | Ga0500594_0021347 | 3300053118 | Bacteria | 1623 |
| 412 | Ga0500595_001500 | 3300053119 | Bacteria | 12403 |
| 413 | Ga0500595_089940 | 3300053119 | Bacteria | 889 |
| 414 | Ga0500607_053935 | 3300053121 | Bacteria | 2130 |
| 415 | Ga0500608_000022 | 3300053122 | Bacteria | 72979 |
| 416 | Ga0500608_002234 | 3300053122 | Bacteria | 6992 |
| 417 | Ga0500618_006496 | 3300053125 | Bacteria | 3426 |
| 418 | Ga0500642_0000020 | 3300053130 | Bacteria | 159498 |
| 419 | Ga0500642_0007119 | 3300053130 | Bacteria | 3739 |
| 420 | Ga0500642_0013646 | 3300053130 | Bacteria | 2995 |
| 421 | Ga0500652_007586 | 3300053131 | Bacteria | 3561 |
| 422 | Ga0500658_0217967 | 3300053134 | Bacteria | 874 |
| 423 | Ga0500559_0000593 | 3300053136 | Bacteria | 24618 |
| 424 | Ga0500559_0004746 | 3300053136 | Bacteria | 6378 |
| 425 | Ga0500564_000079 | 3300053138 | Bacteria | 25002 |
| 426 | Ga0500564_290234 | 3300053138 | Bacteria | 632 |
| 427 | Ga0500568_0000521 | 3300053139 | Bacteria | 28398 |
| 428 | Ga0500568_0001940 | 3300053139 | Bacteria | 12677 |
| 429 | Ga0500568_0175801 | 3300053139 | Bacteria | 788 |
| 430 | Ga0500577_0166737 | 3300053142 | Bacteria | 940 |
| 431 | Ga0500586_114418 | 3300053145 | Bacteria | 941 |
| 432 | Ga0500588_0120154 | 3300053146 | Bacteria | 926 |
| 433 | Ga0500590_004588 | 3300053148 | Bacteria | 6537 |
| 434 | Ga0500603_000474 | 3300053150 | Bacteria | 10282 |
| 435 | Ga0500604_0004356 | 3300053151 | Bacteria | 3761 |
| 436 | Ga0500616_0000112 | 3300053153 | Bacteria | 151210 |
| 437 | Ga0500622_0000717 | 3300053156 | Bacteria | 28993 |
| 438 | Ga0500622_0012486 | 3300053156 | Bacteria | 4598 |
| 439 | Ga0500627_0131462 | 3300053158 | Bacteria | 1130 |
| 440 | Ga0500633_0043783 | 3300053160 | Bacteria | 1516 |
| 441 | Ga0500634_0044297 | 3300053161 | Bacteria | 2409 |
| 442 | Ga0500634_0333752 | 3300053161 | Bacteria | 586 |
| 443 | Ga0500639_178119 | 3300053163 | Bacteria | 944 |
| 444 | Ga0500636_0377057 | 3300053177 | Bacteria | 666 |
| 445 | Ga0500637_0077801 | 3300053178 | Bacteria | 1913 |
| 446 | Ga0500567_057661 | 3300053723 | Bacteria | 1751 |
| 447 | Ga0500570_222923 | 3300053724 | Bacteria | 537 |
| 448 | Ga0500611_099405 | 3300053727 | Bacteria | 751 |
| 449 | Ga0500645_002004 | 3300053730 | Bacteria | 9558 |
| 450 | Ga0500645_048766 | 3300053730 | Bacteria | 1239 |
| 451 | Ga0500609_003288 | 3300053731 | Bacteria | 2281 |
| 452 | Ga0500609_003661 | 3300053731 | Bacteria | 2144 |
| 453 | Ga0500587_034280 | 3300053739 | Bacteria | 708 |
| 454 | Ga0590075_002461 | 3300059424 | Bacteria | 4428 |
| 455 | Ga0590077_020797 | 3300059426 | Bacteria | 1395 |
| 456 | Ga0587066_144466 | 3300059490 | Bacteria | 584 |
| 457 | Ga0587080_154573 | 3300059503 | Bacteria | 534 |
| 458 | Ga0587111_0016459 | 3300060346 | Bacteria | 1365 |
| 459 | Ga0501082_0557152 | 3300060353 | Bacteria | 1003 |
| 460 | Ga0530510_1279447 | 3300061734 | Bacteria | 562 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025919 | Ga0207657_11027570 | Ga0207657_110275701 | 63 |
| 2 | 3300005545 | Ga0070695_100288233 | Ga0070695_1002882332 | 67 |
| 3 | 3300005547 | Ga0070693_100738918 | Ga0070693_1007389182 | 67 |
| 4 | 3300005937 | Ga0081455_10001951 | Ga0081455_1000195118 | 67 |
| 5 | 3300009551 | Ga0105238_12162816 | Ga0105238_121628161 | 67 |
| 6 | 3300005337 | Ga0070682_100879420 | Ga0070682_1008794202 | 68 |
| 7 | 3300005340 | Ga0070689_100541909 | Ga0070689_1005419091 | 68 |
| 8 | 3300005347 | Ga0070668_100376961 | Ga0070668_1003769612 | 68 |
| 9 | 3300005458 | Ga0070681_11590773 | Ga0070681_115907732 | 68 |
| 10 | 3300005563 | Ga0068855_100989877 | Ga0068855_1009898772 | 68 |
| 11 | 3300005614 | Ga0068856_102349778 | Ga0068856_1023497781 | 68 |
| 12 | 3300006175 | Ga0070712_100974651 | Ga0070712_1009746511 | 68 |
| 13 | 3300006358 | Ga0068871_100570836 | Ga0068871_1005708363 | 68 |
| 14 | 3300013105 | Ga0157369_10901797 | Ga0157369_109017972 | 68 |
| 15 | 3300014326 | Ga0157380_11041165 | Ga0157380_110411651 | 68 |
| 16 | 3300017792 | Ga0163161_10375478 | Ga0163161_103754781 | 68 |
| 17 | 3300021361 | Ga0213872_10075297 | Ga0213872_100752972 | 68 |
| 18 | 3300021388 | Ga0213875_10037946 | Ga0213875_100379462 | 68 |
| 19 | 3300025901 | Ga0207688_10246264 | Ga0207688_102462642 | 68 |
| 20 | 3300025949 | Ga0207667_10829305 | Ga0207667_108293052 | 68 |
| 21 | 3300026078 | Ga0207702_10943505 | Ga0207702_109435052 | 68 |
| 22 | 3300028380 | Ga0268265_10178342 | Ga0268265_101783421 | 68 |
| 23 | 3300035086 | Ga0373934_0054909 | Ga0373934_0054909_213_419 | 68 |
| 24 | 3300035410 | Ga0373924_0582914 | Ga0373924_0582914_215_421 | 68 |
| 25 | 3300037466 | Ga0395898_0257306 | Ga0395898_0257306_799_1005 | 68 |
| 26 | 3300037853 | Ga0436364_1205445 | Ga0436364_1205445_1200_1406 | 68 |
| 27 | 3300039437 | Ga0436365_0332337 | Ga0436365_0332337_40_249 | 68 |
| 28 | 3300049586 | Ga0501070_0696324 | Ga0501070_0696324_495_701 | 68 |
| 29 | 3300053130 | Ga0500642_0007119 | Ga0500642_0007119_1610_1816 | 68 |
| 30 | 3300003215 | JGI25153J46596_10039473 | JGI25153J46596_100394732 | 69 |
| 31 | 3300003781 | Ga0055536_1008093 | Ga0055536_10080935 | 69 |
| 32 | 3300003791 | Ga0055530_10000337 | Ga0055530_100003375 | 69 |
| 33 | 3300003791 | Ga0055530_10015205 | Ga0055530_100152054 | 69 |
| 34 | 3300003794 | Ga0055531_10000915 | Ga0055531_1000091523 | 69 |
| 35 | 3300003794 | Ga0055531_10012998 | Ga0055531_100129986 | 69 |
| 36 | 3300003794 | Ga0055531_10017100 | Ga0055531_100171007 | 69 |
| 37 | 3300003794 | Ga0055531_10057166 | Ga0055531_100571663 | 69 |
| 38 | 3300005262 | Ga0065165_1017934 | Ga0065165_10179342 | 69 |
| 39 | 3300005262 | Ga0065165_1122586 | Ga0065165_11225861 | 69 |
| 40 | 3300005327 | Ga0070658_10949209 | Ga0070658_109492091 | 69 |
| 41 | 3300005329 | Ga0070683_101614217 | Ga0070683_1016142171 | 69 |
| 42 | 3300005329 | Ga0070683_102071723 | Ga0070683_1020717231 | 69 |
| 43 | 3300005331 | Ga0070670_101076986 | Ga0070670_1010769863 | 69 |
| 44 | 3300005334 | Ga0068869_100234594 | Ga0068869_1002345943 | 69 |
| 45 | 3300005335 | Ga0070666_11358144 | Ga0070666_113581441 | 69 |
| 46 | 3300005336 | Ga0070680_100670477 | Ga0070680_1006704771 | 69 |
| 47 | 3300005339 | Ga0070660_100026203 | Ga0070660_1000262034 | 69 |
| 48 | 3300005340 | Ga0070689_100584363 | Ga0070689_1005843632 | 69 |
| 49 | 3300005344 | Ga0070661_100546111 | Ga0070661_1005461113 | 69 |
| 50 | 3300005347 | Ga0070668_100080095 | Ga0070668_1000800955 | 69 |
| 51 | 3300005347 | Ga0070668_101448208 | Ga0070668_1014482082 | 69 |
| 52 | 3300005353 | Ga0070669_100317966 | Ga0070669_1003179662 | 69 |
| 53 | 3300005353 | Ga0070669_100633028 | Ga0070669_1006330282 | 69 |
| 54 | 3300005354 | Ga0070675_101679735 | Ga0070675_1016797351 | 69 |
| 55 | 3300005367 | Ga0070667_100793782 | Ga0070667_1007937822 | 69 |
| 56 | 3300005435 | Ga0070714_100326147 | Ga0070714_1003261471 | 69 |
| 57 | 3300005435 | Ga0070714_100378000 | Ga0070714_1003780001 | 69 |
| 58 | 3300005455 | Ga0070663_100029850 | Ga0070663_1000298505 | 69 |
| 59 | 3300005456 | Ga0070678_101483133 | Ga0070678_1014831331 | 69 |
| 60 | 3300005458 | Ga0070681_10199509 | Ga0070681_101995093 | 69 |
| 61 | 3300005459 | Ga0068867_101027515 | Ga0068867_1010275152 | 69 |
| 62 | 3300005459 | Ga0068867_101503387 | Ga0068867_1015033871 | 69 |
| 63 | 3300005471 | Ga0070698_101404935 | Ga0070698_1014049351 | 69 |
| 64 | 3300005535 | Ga0070684_101623619 | Ga0070684_1016236192 | 69 |
| 65 | 3300005543 | Ga0070672_100805281 | Ga0070672_1008052812 | 69 |
| 66 | 3300005544 | Ga0070686_101583762 | Ga0070686_1015837622 | 69 |
| 67 | 3300005548 | Ga0070665_100005904 | Ga0070665_1000059043 | 69 |
| 68 | 3300005548 | Ga0070665_100464623 | Ga0070665_1004646232 | 69 |
| 69 | 3300005563 | Ga0068855_100060409 | Ga0068855_1000604096 | 69 |
| 70 | 3300005563 | Ga0068855_100146673 | Ga0068855_1001466733 | 69 |
| 71 | 3300005563 | Ga0068855_100540840 | Ga0068855_1005408403 | 69 |
| 72 | 3300005577 | Ga0068857_101012417 | Ga0068857_1010124172 | 69 |
| 73 | 3300005578 | Ga0068854_100245352 | Ga0068854_1002453522 | 69 |
| 74 | 3300005578 | Ga0068854_101382101 | Ga0068854_1013821012 | 69 |
| 75 | 3300005578 | Ga0068854_101581571 | Ga0068854_1015815712 | 69 |
| 76 | 3300005578 | Ga0068854_102232237 | Ga0068854_1022322371 | 69 |
| 77 | 3300005614 | Ga0068856_100011504 | Ga0068856_1000115047 | 69 |
| 78 | 3300005614 | Ga0068856_100309582 | Ga0068856_1003095822 | 69 |
| 79 | 3300005614 | Ga0068856_100673893 | Ga0068856_1006738931 | 69 |
| 80 | 3300005616 | Ga0068852_100013033 | Ga0068852_1000130333 | 69 |
| 81 | 3300005617 | Ga0068859_102417112 | Ga0068859_1024171121 | 69 |
| 82 | 3300005718 | Ga0068866_10594438 | Ga0068866_105944382 | 69 |
| 83 | 3300005719 | Ga0068861_101524187 | Ga0068861_1015241871 | 69 |
| 84 | 3300005841 | Ga0068863_100917160 | Ga0068863_1009171603 | 69 |
| 85 | 3300005841 | Ga0068863_101326413 | Ga0068863_1013264132 | 69 |
| 86 | 3300005841 | Ga0068863_101417389 | Ga0068863_1014173893 | 69 |
| 87 | 3300005842 | Ga0068858_102156860 | Ga0068858_1021568602 | 69 |
| 88 | 3300005843 | Ga0068860_100000037 | Ga0068860_100000037131 | 69 |
| 89 | 3300005844 | Ga0068862_100054756 | Ga0068862_1000547562 | 69 |
| 90 | 3300005844 | Ga0068862_100260857 | Ga0068862_1002608572 | 69 |
| 91 | 3300006028 | Ga0070717_10118798 | Ga0070717_101187982 | 69 |
| 92 | 3300006038 | Ga0075365_10023371 | Ga0075365_100233714 | 69 |
| 93 | 3300006048 | Ga0075363_100039586 | Ga0075363_1000395863 | 69 |
| 94 | 3300006051 | Ga0075364_10246667 | Ga0075364_102466673 | 69 |
| 95 | 3300006051 | Ga0075364_10279124 | Ga0075364_102791242 | 69 |
| 96 | 3300006178 | Ga0075367_10022115 | Ga0075367_100221152 | 69 |
| 97 | 3300006186 | Ga0075369_10195233 | Ga0075369_101952332 | 69 |
| 98 | 3300006186 | Ga0075369_10384901 | Ga0075369_103849012 | 69 |
| 99 | 3300006195 | Ga0075366_10509985 | Ga0075366_105099851 | 69 |
| 100 | 3300006237 | Ga0097621_100344937 | Ga0097621_1003449375 | 69 |
| 101 | 3300006353 | Ga0075370_10079587 | Ga0075370_100795871 | 69 |
| 102 | 3300006353 | Ga0075370_10108230 | Ga0075370_101082303 | 69 |
| 103 | 3300006353 | Ga0075370_10185246 | Ga0075370_101852463 | 69 |
| 104 | 3300006358 | Ga0068871_100300072 | Ga0068871_1003000724 | 69 |
| 105 | 3300006358 | Ga0068871_101128480 | Ga0068871_1011284802 | 69 |
| 106 | 3300006844 | Ga0075428_102574753 | Ga0075428_1025747531 | 69 |
| 107 | 3300006852 | Ga0075433_10450118 | Ga0075433_104501181 | 69 |
| 108 | 3300006881 | Ga0068865_100002490 | Ga0068865_1000024906 | 69 |
| 109 | 3300006881 | Ga0068865_100509048 | Ga0068865_1005090481 | 69 |
| 110 | 3300006914 | Ga0075436_101426886 | Ga0075436_1014268861 | 69 |
| 111 | 3300006931 | Ga0097620_102416754 | Ga0097620_1024167541 | 69 |
| 112 | 3300007788 | Ga0099795_10079903 | Ga0099795_100799032 | 69 |
| 113 | 3300009093 | Ga0105240_11682394 | Ga0105240_116823941 | 69 |
| 114 | 3300009093 | Ga0105240_12069702 | Ga0105240_120697022 | 69 |
| 115 | 3300009094 | Ga0111539_13443358 | Ga0111539_134433581 | 69 |
| 116 | 3300009098 | Ga0105245_11376453 | Ga0105245_113764531 | 69 |
| 117 | 3300009101 | Ga0105247_10360574 | Ga0105247_103605742 | 69 |
| 118 | 3300009177 | Ga0105248_10741995 | Ga0105248_107419952 | 69 |
| 119 | 3300009545 | Ga0105237_11530400 | Ga0105237_115304001 | 69 |
| 120 | 3300009553 | Ga0105249_11204986 | Ga0105249_112049862 | 69 |
| 121 | 3300010159 | Ga0099796_10014563 | Ga0099796_100145633 | 69 |
| 122 | 3300011119 | Ga0105246_10372721 | Ga0105246_103727212 | 69 |
| 123 | 3300011119 | Ga0105246_10709144 | Ga0105246_107091441 | 69 |
| 124 | 3300013105 | Ga0157369_10064024 | Ga0157369_100640244 | 69 |
| 125 | 3300013306 | Ga0163162_10501172 | Ga0163162_105011724 | 69 |
| 126 | 3300013306 | Ga0163162_12874535 | Ga0163162_128745351 | 69 |
| 127 | 3300013308 | Ga0157375_11466552 | Ga0157375_114665522 | 69 |
| 128 | 3300014325 | Ga0163163_10542515 | Ga0163163_105425152 | 69 |
| 129 | 3300014325 | Ga0163163_12900816 | Ga0163163_129008161 | 69 |
| 130 | 3300014326 | Ga0157380_10921799 | Ga0157380_109217992 | 69 |
| 131 | 3300014326 | Ga0157380_11280522 | Ga0157380_112805221 | 69 |
| 132 | 3300014326 | Ga0157380_11361511 | Ga0157380_113615112 | 69 |
| 133 | 3300014326 | Ga0157380_11601540 | Ga0157380_116015402 | 69 |
| 134 | 3300014326 | Ga0157380_11751543 | Ga0157380_117515431 | 69 |
| 135 | 3300014326 | Ga0157380_12233478 | Ga0157380_122334781 | 69 |
| 136 | 3300014497 | Ga0182008_10143737 | Ga0182008_101437373 | 69 |
| 137 | 3300014745 | Ga0157377_10613212 | Ga0157377_106132121 | 69 |
| 138 | 3300014968 | Ga0157379_10654342 | Ga0157379_106543422 | 69 |
| 139 | 3300014968 | Ga0157379_10766713 | Ga0157379_107667131 | 69 |
| 140 | 3300014969 | Ga0157376_10461238 | Ga0157376_104612382 | 69 |
| 141 | 3300015262 | Ga0182007_10012367 | Ga0182007_100123675 | 69 |
| 142 | 3300017792 | Ga0163161_11292726 | Ga0163161_112927261 | 69 |
| 143 | 3300025250 | Ga0209026_1004463 | Ga0209026_10044638 | 69 |
| 144 | 3300025254 | Ga0209148_1020118 | Ga0209148_10201182 | 69 |
| 145 | 3300025261 | Ga0209233_1053394 | Ga0209233_10533942 | 69 |
| 146 | 3300025272 | Ga0209455_1041381 | Ga0209455_10413812 | 69 |
| 147 | 3300025292 | Ga0209676_1000282 | Ga0209676_100028281 | 69 |
| 148 | 3300025295 | Ga0209564_1010399 | Ga0209564_10103992 | 69 |
| 149 | 3300025297 | Ga0209758_1003525 | Ga0209758_10035259 | 69 |
| 150 | 3300025298 | Ga0209050_1000095 | Ga0209050_1000095191 | 69 |
| 151 | 3300025298 | Ga0209050_1001911 | Ga0209050_10019114 | 69 |
| 152 | 3300025304 | Ga0209257_1000106 | Ga0209257_100010662 | 69 |
| 153 | 3300025304 | Ga0209257_1000332 | Ga0209257_100033275 | 69 |
| 154 | 3300025304 | Ga0209257_1000641 | Ga0209257_100064157 | 69 |
| 155 | 3300025911 | Ga0207654_10222856 | Ga0207654_102228562 | 69 |
| 156 | 3300025912 | Ga0207707_10457787 | Ga0207707_104577873 | 69 |
| 157 | 3300025913 | Ga0207695_10383141 | Ga0207695_103831412 | 69 |
| 158 | 3300025913 | Ga0207695_11063388 | Ga0207695_110633882 | 69 |
| 159 | 3300025913 | Ga0207695_11257804 | Ga0207695_112578041 | 69 |
| 160 | 3300025914 | Ga0207671_10897630 | Ga0207671_108976302 | 69 |
| 161 | 3300025919 | Ga0207657_10028470 | Ga0207657_100284703 | 69 |
| 162 | 3300025919 | Ga0207657_10995826 | Ga0207657_109958262 | 69 |
| 163 | 3300025923 | Ga0207681_10322349 | Ga0207681_103223491 | 69 |
| 164 | 3300025923 | Ga0207681_10804391 | Ga0207681_108043912 | 69 |
| 165 | 3300025924 | Ga0207694_10037753 | Ga0207694_100377537 | 69 |
| 166 | 3300025924 | Ga0207694_10320212 | Ga0207694_103202122 | 69 |
| 167 | 3300025925 | Ga0207650_10329371 | Ga0207650_103293715 | 69 |
| 168 | 3300025925 | Ga0207650_11022772 | Ga0207650_110227721 | 69 |
| 169 | 3300025925 | Ga0207650_11644062 | Ga0207650_116440622 | 69 |
| 170 | 3300025926 | Ga0207659_10795104 | Ga0207659_107951044 | 69 |
| 171 | 3300025926 | Ga0207659_11443643 | Ga0207659_114436431 | 69 |
| 172 | 3300025929 | Ga0207664_11009887 | Ga0207664_110098871 | 69 |
| 173 | 3300025936 | Ga0207670_11053952 | Ga0207670_110539523 | 69 |
| 174 | 3300025938 | Ga0207704_10023565 | Ga0207704_100235656 | 69 |
| 175 | 3300025938 | Ga0207704_10499026 | Ga0207704_104990261 | 69 |
| 176 | 3300025940 | Ga0207691_11112307 | Ga0207691_111123072 | 69 |
| 177 | 3300025944 | Ga0207661_11198285 | Ga0207661_111982851 | 69 |
| 178 | 3300025944 | Ga0207661_11668391 | Ga0207661_116683911 | 69 |
| 179 | 3300025949 | Ga0207667_10111987 | Ga0207667_101119876 | 69 |
| 180 | 3300025949 | Ga0207667_10228837 | Ga0207667_102288372 | 69 |
| 181 | 3300025949 | Ga0207667_10289251 | Ga0207667_102892513 | 69 |
| 182 | 3300025949 | Ga0207667_10820046 | Ga0207667_108200463 | 69 |
| 183 | 3300025949 | Ga0207667_11587597 | Ga0207667_115875972 | 69 |
| 184 | 3300025972 | Ga0207668_10130453 | Ga0207668_101304534 | 69 |
| 185 | 3300025972 | Ga0207668_11211633 | Ga0207668_112116331 | 69 |
| 186 | 3300025972 | Ga0207668_11585544 | Ga0207668_115855441 | 69 |
| 187 | 3300025981 | Ga0207640_10013118 | Ga0207640_100131186 | 69 |
| 188 | 3300025981 | Ga0207640_11570031 | Ga0207640_115700311 | 69 |
| 189 | 3300025986 | Ga0207658_10411778 | Ga0207658_104117782 | 69 |
| 190 | 3300026067 | Ga0207678_10027553 | Ga0207678_100275534 | 69 |
| 191 | 3300026078 | Ga0207702_10034487 | Ga0207702_100344873 | 69 |
| 192 | 3300026078 | Ga0207702_10203336 | Ga0207702_102033365 | 69 |
| 193 | 3300026078 | Ga0207702_10316145 | Ga0207702_103161453 | 69 |
| 194 | 3300026078 | Ga0207702_10894247 | Ga0207702_108942471 | 69 |
| 195 | 3300026088 | Ga0207641_10618680 | Ga0207641_106186802 | 69 |
| 196 | 3300026089 | Ga0207648_10532371 | Ga0207648_105323712 | 69 |
| 197 | 3300026089 | Ga0207648_11645839 | Ga0207648_116458392 | 69 |
| 198 | 3300026116 | Ga0207674_11247145 | Ga0207674_112471452 | 69 |
| 199 | 3300026116 | Ga0207674_11402948 | Ga0207674_114029481 | 69 |
| 200 | 3300026118 | Ga0207675_102328974 | Ga0207675_1023289742 | 69 |
| 201 | 3300026121 | Ga0207683_10897424 | Ga0207683_108974243 | 69 |
| 202 | 3300026142 | Ga0207698_10047667 | Ga0207698_100476674 | 69 |
| 203 | 3300026142 | Ga0207698_11001791 | Ga0207698_110017911 | 69 |
| 204 | 3300027512 | Ga0209179_1026856 | Ga0209179_10268562 | 69 |
| 205 | 3300028379 | Ga0268266_10002702 | Ga0268266_100027024 | 69 |
| 206 | 3300028379 | Ga0268266_10130329 | Ga0268266_101303294 | 69 |
| 207 | 3300028380 | Ga0268265_10005623 | Ga0268265_100056239 | 69 |
| 208 | 3300028380 | Ga0268265_10128073 | Ga0268265_101280731 | 69 |
| 209 | 3300028380 | Ga0268265_10494293 | Ga0268265_104942934 | 69 |
| 210 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002209 | 69 |
| 211 | 3300028794 | Ga0307515_10147271 | Ga0307515_101472712 | 69 |
| 212 | 3300030521 | Ga0307511_10009257 | Ga0307511_100092577 | 69 |
| 213 | 3300031235 | Ga0265330_10339156 | Ga0265330_103391562 | 69 |
| 214 | 3300031456 | Ga0307513_10122822 | Ga0307513_101228221 | 69 |
| 215 | 3300031548 | Ga0307408_102529699 | Ga0307408_1025296992 | 69 |
| 216 | 3300031691 | Ga0316579_10040909 | Ga0316579_100409092 | 69 |
| 217 | 3300031691 | Ga0316579_10103418 | Ga0316579_101034182 | 69 |
| 218 | 3300031711 | Ga0265314_10144092 | Ga0265314_101440921 | 69 |
| 219 | 3300031731 | Ga0307405_10101846 | Ga0307405_101018464 | 69 |
| 220 | 3300031731 | Ga0307405_11467339 | Ga0307405_114673391 | 69 |
| 221 | 3300031731 | Ga0307405_11908103 | Ga0307405_119081031 | 69 |
| 222 | 3300031731 | Ga0307405_12048939 | Ga0307405_120489391 | 69 |
| 223 | 3300031824 | Ga0307413_10155204 | Ga0307413_101552044 | 69 |
| 224 | 3300031824 | Ga0307413_10367673 | Ga0307413_103676731 | 69 |
| 225 | 3300031901 | Ga0307406_11387418 | Ga0307406_113874182 | 69 |
| 226 | 3300031995 | Ga0307409_102054729 | Ga0307409_1020547292 | 69 |
| 227 | 3300032002 | Ga0307416_102888180 | Ga0307416_1028881802 | 69 |
| 228 | 3300032004 | Ga0307414_10218288 | Ga0307414_102182884 | 69 |
| 229 | 3300032005 | Ga0307411_10137932 | Ga0307411_101379321 | 69 |
| 230 | 3300032005 | Ga0307411_10236234 | Ga0307411_102362344 | 69 |
| 231 | 3300032133 | Ga0316583_10000048 | Ga0316583_1000004814 | 69 |
| 232 | 3300032168 | Ga0316593_10037294 | Ga0316593_100372944 | 69 |
| 233 | 3300032168 | Ga0316593_10161695 | Ga0316593_101616952 | 69 |
| 234 | 3300032168 | Ga0316593_10226330 | Ga0316593_102263301 | 69 |
| 235 | 3300033180 | Ga0307510_10054322 | Ga0307510_100543224 | 69 |
| 236 | 3300033180 | Ga0307510_10149207 | Ga0307510_101492072 | 69 |
| 237 | 3300035724 | Ga0373933_0631117 | Ga0373933_0631117_481_690 | 69 |
| 238 | 3300037068 | Ga0373925_0113154 | Ga0373925_0113154_1449_1658 | 69 |
| 239 | 3300037471 | Ga0395905_0279921 | Ga0395905_0279921_405_614 | 69 |
| 240 | 3300037471 | Ga0395905_0554713 | Ga0395905_0554713_716_925 | 69 |
| 241 | 3300037471 | Ga0395905_0872781 | Ga0395905_0872781_446_655 | 69 |
| 242 | 3300037471 | Ga0395905_1581827 | Ga0395905_1581827_161_370 | 69 |
| 243 | 3300037588 | Ga0316581_0153903 | Ga0316581_0153903_189_398 | 69 |
| 244 | 3300038443 | Ga0395901_1222831 | Ga0395901_1222831_419_628 | 69 |
| 245 | 3300041452 | Ga0451793_1733260 | Ga0451793_1733260_20_229 | 69 |
| 246 | 3300041498 | Ga0451841_0587899 | Ga0451841_0587899_389_598 | 69 |
| 247 | 3300041511 | Ga0451855_1514446 | Ga0451855_1514446_193_450 | 69 |
| 248 | 3300041512 | Ga0451853_0315559 | Ga0451853_0315559_164_373 | 69 |
| 249 | 3300041512 | Ga0451853_2618744 | Ga0451853_2618744_151_360 | 69 |
| 250 | 3300041997 | Ga0439431_0019146 | Ga0439431_0019146_1113_1322 | 69 |
| 251 | 3300044712 | Ga0453684_0457212 | Ga0453684_0457212_141_350 | 69 |
| 252 | 3300046455 | Ga0495603_0021713 | Ga0495603_0021713_301_510 | 69 |
| 253 | 3300046460 | Ga0495638_0084882 | Ga0495638_0084882_190_399 | 69 |
| 254 | 3300046460 | Ga0495638_0099278 | Ga0495638_0099278_1238_1447 | 69 |
| 255 | 3300046471 | Ga0495650_0060370 | Ga0495650_0060370_509_718 | 69 |
| 256 | 3300046475 | Ga0495639_0117027 | Ga0495639_0117027_127_336 | 69 |
| 257 | 3300046501 | Ga0495607_0211014 | Ga0495607_0211014_200_409 | 69 |
| 258 | 3300046506 | Ga0495583_0054853 | Ga0495583_0054853_1502_1711 | 69 |
| 259 | 3300046507 | Ga0495606_0289302 | Ga0495606_0289302_334_543 | 69 |
| 260 | 3300046507 | Ga0495606_0591326 | Ga0495606_0591326_145_354 | 69 |
| 261 | 3300046512 | Ga0495610_0079773 | Ga0495610_0079773_975_1184 | 69 |
| 262 | 3300046513 | Ga0495616_0033362 | Ga0495616_0033362_1416_1625 | 69 |
| 263 | 3300046515 | Ga0495620_0033380 | Ga0495620_0033380_1410_1619 | 69 |
| 264 | 3300046516 | Ga0495628_0213659 | Ga0495628_0213659_889_1098 | 69 |
| 265 | 3300046517 | Ga0495630_0906438 | Ga0495630_0906438_417_626 | 69 |
| 266 | 3300046518 | Ga0495631_0189527 | Ga0495631_0189527_452_661 | 69 |
| 267 | 3300046519 | Ga0495632_0064449 | Ga0495632_0064449_547_756 | 69 |
| 268 | 3300046520 | Ga0495637_0148318 | Ga0495637_0148318_517_726 | 69 |
| 269 | 3300046522 | Ga0495643_0130520 | Ga0495643_0130520_531_740 | 69 |
| 270 | 3300046522 | Ga0495643_0340730 | Ga0495643_0340730_289_498 | 69 |
| 271 | 3300046524 | Ga0495648_0000580 | Ga0495648_0000580_27960_28169 | 69 |
| 272 | 3300046524 | Ga0495648_0240396 | Ga0495648_0240396_486_695 | 69 |
| 273 | 3300046526 | Ga0495666_0303304 | Ga0495666_0303304_309_518 | 69 |
| 274 | 3300046530 | Ga0495654_0023909 | Ga0495654_0023909_649_858 | 69 |
| 275 | 3300046538 | Ga0495609_0090384 | Ga0495609_0090384_20_229 | 69 |
| 276 | 3300046539 | Ga0495621_0154455 | Ga0495621_0154455_127_336 | 69 |
| 277 | 3300046542 | Ga0495597_0063998 | Ga0495597_0063998_397_606 | 69 |
| 278 | 3300046543 | Ga0495645_0061511 | Ga0495645_0061511_1376_1585 | 69 |
| 279 | 3300046616 | Ga0495668_0000037 | Ga0495668_0000037_162673_162882 | 69 |
| 280 | 3300046616 | Ga0495668_0044827 | Ga0495668_0044827_1555_1764 | 69 |
| 281 | 3300046616 | Ga0495668_0134058 | Ga0495668_0134058_905_1114 | 69 |
| 282 | 3300046616 | Ga0495668_0184923 | Ga0495668_0184923_474_683 | 69 |
| 283 | 3300046616 | Ga0495668_0546499 | Ga0495668_0546499_171_380 | 69 |
| 284 | 3300046648 | Ga0495611_0083825 | Ga0495611_0083825_829_1038 | 69 |
| 285 | 3300046660 | Ga0495625_0205883 | Ga0495625_0205883_194_403 | 69 |
| 286 | 3300046660 | Ga0495625_0209604 | Ga0495625_0209604_391_600 | 69 |
| 287 | 3300046664 | Ga0495659_0293472 | Ga0495659_0293472_39_251 | 69 |
| 288 | 3300046665 | Ga0495661_0167295 | Ga0495661_0167295_532_741 | 69 |
| 289 | 3300046674 | Ga0495588_0182761 | Ga0495588_0182761_243_452 | 69 |
| 290 | 3300046683 | Ga0495658_0476425 | Ga0495658_0476425_79_288 | 69 |
| 291 | 3300046691 | Ga0495670_0063486 | Ga0495670_0063486_1308_1517 | 69 |
| 292 | 3300046691 | Ga0495670_0370750 | Ga0495670_0370750_39_248 | 69 |
| 293 | 3300046692 | Ga0495671_0069471 | Ga0495671_0069471_840_1049 | 69 |
| 294 | 3300046810 | Ga0495660_0089247 | Ga0495660_0089247_549_758 | 69 |
| 295 | 3300047319 | Ga0495674_1248187 | Ga0495674_1248187_20_229 | 69 |
| 296 | 3300047320 | Ga0495672_0517392 | Ga0495672_0517392_184_393 | 69 |
| 297 | 3300047469 | Ga0495673_0000191 | Ga0495673_0000191_10702_10911 | 69 |
| 298 | 3300047470 | Ga0495681_0117065 | Ga0495681_0117065_566_775 | 69 |
| 299 | 3300047472 | Ga0495686_0138549 | Ga0495686_0138549_675_884 | 69 |
| 300 | 3300047472 | Ga0495686_0177123 | Ga0495686_0177123_520_729 | 69 |
| 301 | 3300047472 | Ga0495686_0306569 | Ga0495686_0306569_626_835 | 69 |
| 302 | 3300047472 | Ga0495686_0366145 | Ga0495686_0366145_62_271 | 69 |
| 303 | 3300047472 | Ga0495686_0393412 | Ga0495686_0393412_176_385 | 69 |
| 304 | 3300047472 | Ga0495686_0456106 | Ga0495686_0456106_54_263 | 69 |
| 305 | 3300047472 | Ga0495686_0660918 | Ga0495686_0660918_178_390 | 69 |
| 306 | 3300048091 | Ga0495626_0223030 | Ga0495626_0223030_132_341 | 69 |
| 307 | 3300048903 | Ga0496100_0131602 | Ga0496100_0131602_1245_1454 | 69 |
| 308 | 3300048903 | Ga0496100_0149359 | Ga0496100_0149359_1395_1604 | 69 |
| 309 | 3300048903 | Ga0496100_0507851 | Ga0496100_0507851_400_609 | 69 |
| 310 | 3300048905 | Ga0496102_0200750 | Ga0496102_0200750_1040_1249 | 69 |
| 311 | 3300048905 | Ga0496102_1044327 | Ga0496102_1044327_377_586 | 69 |
| 312 | 3300048906 | Ga0496103_0681367 | Ga0496103_0681367_314_523 | 69 |
| 313 | 3300048907 | Ga0496104_1538263 | Ga0496104_1538263_139_348 | 69 |
| 314 | 3300048908 | Ga0496105_1089907 | Ga0496105_1089907_157_366 | 69 |
| 315 | 3300048909 | Ga0496106_0472933 | Ga0496106_0472933_130_339 | 69 |
| 316 | 3300048910 | Ga0496107_0862791 | Ga0496107_0862791_108_317 | 69 |
| 317 | 3300048911 | Ga0496108_0473908 | Ga0496108_0473908_155_364 | 69 |
| 318 | 3300048911 | Ga0496108_0841170 | Ga0496108_0841170_38_247 | 69 |
| 319 | 3300048912 | Ga0496109_0556628 | Ga0496109_0556628_598_807 | 69 |
| 320 | 3300048913 | Ga0496110_0023917 | Ga0496110_0023917_3185_3394 | 69 |
| 321 | 3300048914 | Ga0496111_1186162 | Ga0496111_1186162_105_314 | 69 |
| 322 | 3300048915 | Ga0496112_0090897 | Ga0496112_0090897_2134_2343 | 69 |
| 323 | 3300048915 | Ga0496112_0228214 | Ga0496112_0228214_540_749 | 69 |
| 324 | 3300048915 | Ga0496112_0571638 | Ga0496112_0571638_496_705 | 69 |
| 325 | 3300048916 | Ga0496113_0217892 | Ga0496113_0217892_201_410 | 69 |
| 326 | 3300048917 | Ga0496114_1681055 | Ga0496114_1681055_271_480 | 69 |
| 327 | 3300048918 | Ga0496115_1223373 | Ga0496115_1223373_308_517 | 69 |
| 328 | 3300048919 | Ga0496116_0002966 | Ga0496116_0002966_7798_8007 | 69 |
| 329 | 3300048919 | Ga0496116_0192452 | Ga0496116_0192452_800_1009 | 69 |
| 330 | 3300048920 | Ga0496117_0091572 | Ga0496117_0091572_1302_1511 | 69 |
| 331 | 3300048921 | Ga0496118_0070949 | Ga0496118_0070949_794_1003 | 69 |
| 332 | 3300048921 | Ga0496118_0151844 | Ga0496118_0151844_1073_1282 | 69 |
| 333 | 3300048922 | Ga0496119_0377553 | Ga0496119_0377553_264_473 | 69 |
| 334 | 3300048923 | Ga0496120_0012249 | Ga0496120_0012249_2663_2872 | 69 |
| 335 | 3300048924 | Ga0496121_0006360 | Ga0496121_0006360_12039_12248 | 69 |
| 336 | 3300048924 | Ga0496121_0012038 | Ga0496121_0012038_2900_3109 | 69 |
| 337 | 3300048925 | Ga0496122_0027335 | Ga0496122_0027335_1189_1398 | 69 |
| 338 | 3300048926 | Ga0496123_0012473 | Ga0496123_0012473_6161_6370 | 69 |
| 339 | 3300048926 | Ga0496123_0123285 | Ga0496123_0123285_378_587 | 69 |
| 340 | 3300048927 | Ga0496124_0022257 | Ga0496124_0022257_2406_2615 | 69 |
| 341 | 3300048927 | Ga0496124_0316771 | Ga0496124_0316771_19_228 | 69 |
| 342 | 3300048928 | Ga0496125_0045576 | Ga0496125_0045576_830_1039 | 69 |
| 343 | 3300048928 | Ga0496125_0072227 | Ga0496125_0072227_1701_1910 | 69 |
| 344 | 3300048928 | Ga0496125_0520966 | Ga0496125_0520966_145_354 | 69 |
| 345 | 3300048929 | Ga0496126_0023915 | Ga0496126_0023915_2786_2995 | 69 |
| 346 | 3300048929 | Ga0496126_0044792 | Ga0496126_0044792_450_659 | 69 |
| 347 | 3300048929 | Ga0496126_0428547 | Ga0496126_0428547_387_596 | 69 |
| 348 | 3300049127 | Ga0501306_045825 | Ga0501306_045825_129_338 | 69 |
| 349 | 3300049127 | Ga0501306_073932 | Ga0501306_073932_316_525 | 69 |
| 350 | 3300049132 | Ga0501343_024323 | Ga0501343_024323_137_346 | 69 |
| 351 | 3300049459 | Ga0495678_063370 | Ga0495678_063370_255_464 | 69 |
| 352 | 3300049532 | Ga0501316_081007 | Ga0501316_081007_102_311 | 69 |
| 353 | 3300049533 | Ga0501317_071148 | Ga0501317_071148_120_329 | 69 |
| 354 | 3300049535 | Ga0501319_023815 | Ga0501319_023815_165_374 | 69 |
| 355 | 3300049536 | Ga0501320_015656 | Ga0501320_015656_51_260 | 69 |
| 356 | 3300049536 | Ga0501320_041686 | Ga0501320_041686_165_374 | 69 |
| 357 | 3300049536 | Ga0501320_045908 | Ga0501320_045908_10_219 | 69 |
| 358 | 3300049537 | Ga0501321_031487 | Ga0501321_031487_402_611 | 69 |
| 359 | 3300049539 | Ga0501323_023887 | Ga0501323_023887_265_474 | 69 |
| 360 | 3300049539 | Ga0501323_050245 | Ga0501323_050245_135_344 | 69 |
| 361 | 3300049540 | Ga0501324_006409 | Ga0501324_006409_126_335 | 69 |
| 362 | 3300049540 | Ga0501324_025039 | Ga0501324_025039_256_465 | 69 |
| 363 | 3300049541 | Ga0501325_035543 | Ga0501325_035543_182_391 | 69 |
| 364 | 3300049541 | Ga0501325_053934 | Ga0501325_053934_22_231 | 69 |
| 365 | 3300049545 | Ga0501329_03055 | Ga0501329_03055_503_712 | 69 |
| 366 | 3300049581 | Ga0501047_1017092 | Ga0501047_1017092_303_512 | 69 |
| 367 | 3300049589 | Ga0501073_0734234 | Ga0501073_0734234_189_398 | 69 |
| 368 | 3300049590 | Ga0501074_0516773 | Ga0501074_0516773_592_807 | 69 |
| 369 | 3300049742 | Ga0501080_0188462 | Ga0501080_0188462_1629_1838 | 69 |
| 370 | 3300049758 | Ga0501241_098287 | Ga0501241_098287_127_336 | 69 |
| 371 | 3300049766 | Ga0501269_067686 | Ga0501269_067686_226_435 | 69 |
| 372 | 3300050489 | nmdc:mga03683_95265_c1 | nmdc:mga03683_95265_c1_475_684 | 69 |
| 373 | 3300050490 | nmdc:mga03n38_186224_c1 | nmdc:mga03n38_186224_c1_686_895 | 69 |
| 374 | 3300050490 | nmdc:mga03n38_764186_c1 | nmdc:mga03n38_764186_c1_46_258 | 69 |
| 375 | 3300050491 | nmdc:mga00v17_187603_c1 | nmdc:mga00v17_187603_c1_640_849 | 69 |
| 376 | 3300050492 | nmdc:mga0yw44_220863_c1 | nmdc:mga0yw44_220863_c1_410_619 | 69 |
| 377 | 3300050492 | nmdc:mga0yw44_4055_c1 | nmdc:mga0yw44_4055_c1_575_784 | 69 |
| 378 | 3300050492 | nmdc:mga0yw44_893201_c1 | nmdc:mga0yw44_893201_c1_356_565 | 69 |
| 379 | 3300050494 | nmdc:mga06z11_541356_c1 | nmdc:mga06z11_541356_c1_357_566 | 69 |
| 380 | 3300050496 | nmdc:mga07m45_40638_c1 | nmdc:mga07m45_40638_c1_1423_1632 | 69 |
| 381 | 3300050496 | nmdc:mga07m45_558820_c1 | nmdc:mga07m45_558820_c1_411_620 | 69 |
| 382 | 3300050496 | nmdc:mga07m45_614948_c1 | nmdc:mga07m45_614948_c1_117_326 | 69 |
| 383 | 3300050496 | nmdc:mga07m45_78543_c1 | nmdc:mga07m45_78543_c1_1085_1294 | 69 |
| 384 | 3300050512 | nmdc:mga0n895_1100334_c1 | nmdc:mga0n895_1100334_c1_360_569 | 69 |
| 385 | 3300050515 | nmdc:mga0a205_880589_c1 | nmdc:mga0a205_880589_c1_268_477 | 69 |
| 386 | 3300050516 | nmdc:mga0sz30_13911_c1 | nmdc:mga0sz30_13911_c1_945_1154 | 69 |
| 387 | 3300050516 | nmdc:mga0sz30_7935_c1 | nmdc:mga0sz30_7935_c1_3468_3677 | 69 |
| 388 | 3300053080 | Ga0500635_0110332 | Ga0500635_0110332_541_750 | 69 |
| 389 | 3300053087 | Ga0500643_041656 | Ga0500643_041656_525_734 | 69 |
| 390 | 3300053087 | Ga0500643_093981 | Ga0500643_093981_359_568 | 69 |
| 391 | 3300053088 | Ga0500644_0000187 | Ga0500644_0000187_11000_11209 | 69 |
| 392 | 3300053088 | Ga0500644_0168901 | Ga0500644_0168901_300_509 | 69 |
| 393 | 3300053089 | Ga0500581_083483 | Ga0500581_083483_1249_1458 | 69 |
| 394 | 3300053090 | Ga0500646_0049813 | Ga0500646_0049813_135_344 | 69 |
| 395 | 3300053093 | Ga0500651_0018719 | Ga0500651_0018719_26_235 | 69 |
| 396 | 3300053093 | Ga0500651_0075557 | Ga0500651_0075557_1252_1461 | 69 |
| 397 | 3300053093 | Ga0500651_0549756 | Ga0500651_0549756_216_425 | 69 |
| 398 | 3300053094 | Ga0500566_0000474 | Ga0500566_0000474_15377_15586 | 69 |
| 399 | 3300053094 | Ga0500566_0247505 | Ga0500566_0247505_620_829 | 69 |
| 400 | 3300053096 | Ga0500641_0226320 | Ga0500641_0226320_344_553 | 69 |
| 401 | 3300053098 | Ga0500650_0099254 | Ga0500650_0099254_176_385 | 69 |
| 402 | 3300053098 | Ga0500650_0493270 | Ga0500650_0493270_158_367 | 69 |
| 403 | 3300053099 | Ga0500654_196690 | Ga0500654_196690_373_582 | 69 |
| 404 | 3300053102 | Ga0500554_000457 | Ga0500554_000457_4057_4266 | 69 |
| 405 | 3300053102 | Ga0500554_104201 | Ga0500554_104201_70_279 | 69 |
| 406 | 3300053104 | Ga0500556_0000029 | Ga0500556_0000029_114810_115019 | 69 |
| 407 | 3300053108 | Ga0500562_069532 | Ga0500562_069532_588_797 | 69 |
| 408 | 3300053109 | Ga0500569_019245 | Ga0500569_019245_877_1086 | 69 |
| 409 | 3300053116 | Ga0500592_003760 | Ga0500592_003760_1128_1337 | 69 |
| 410 | 3300053117 | Ga0500593_224053 | Ga0500593_224053_374_583 | 69 |
| 411 | 3300053118 | Ga0500594_0009753 | Ga0500594_0009753_978_1187 | 69 |
| 412 | 3300053118 | Ga0500594_0021347 | Ga0500594_0021347_579_788 | 69 |
| 413 | 3300053119 | Ga0500595_001500 | Ga0500595_001500_1973_2182 | 69 |
| 414 | 3300053119 | Ga0500595_089940 | Ga0500595_089940_289_498 | 69 |
| 415 | 3300053121 | Ga0500607_053935 | Ga0500607_053935_145_354 | 69 |
| 416 | 3300053122 | Ga0500608_000022 | Ga0500608_000022_47115_47324 | 69 |
| 417 | 3300053122 | Ga0500608_002234 | Ga0500608_002234_4656_4865 | 69 |
| 418 | 3300053125 | Ga0500618_006496 | Ga0500618_006496_2727_2936 | 69 |
| 419 | 3300053130 | Ga0500642_0000020 | Ga0500642_0000020_117370_117579 | 69 |
| 420 | 3300053130 | Ga0500642_0013646 | Ga0500642_0013646_1040_1249 | 69 |
| 421 | 3300053131 | Ga0500652_007586 | Ga0500652_007586_741_950 | 69 |
| 422 | 3300053134 | Ga0500658_0217967 | Ga0500658_0217967_521_730 | 69 |
| 423 | 3300053136 | Ga0500559_0000593 | Ga0500559_0000593_2173_2382 | 69 |
| 424 | 3300053136 | Ga0500559_0004746 | Ga0500559_0004746_6050_6259 | 69 |
| 425 | 3300053138 | Ga0500564_000079 | Ga0500564_000079_13894_14103 | 69 |
| 426 | 3300053138 | Ga0500564_290234 | Ga0500564_290234_378_587 | 69 |
| 427 | 3300053139 | Ga0500568_0000521 | Ga0500568_0000521_14679_14888 | 69 |
| 428 | 3300053139 | Ga0500568_0001940 | Ga0500568_0001940_5373_5582 | 69 |
| 429 | 3300053139 | Ga0500568_0175801 | Ga0500568_0175801_223_432 | 69 |
| 430 | 3300053142 | Ga0500577_0166737 | Ga0500577_0166737_568_777 | 69 |
| 431 | 3300053145 | Ga0500586_114418 | Ga0500586_114418_106_315 | 69 |
| 432 | 3300053146 | Ga0500588_0120154 | Ga0500588_0120154_574_783 | 69 |
| 433 | 3300053148 | Ga0500590_004588 | Ga0500590_004588_2468_2677 | 69 |
| 434 | 3300053150 | Ga0500603_000474 | Ga0500603_000474_5776_5985 | 69 |
| 435 | 3300053151 | Ga0500604_0004356 | Ga0500604_0004356_830_1039 | 69 |
| 436 | 3300053153 | Ga0500616_0000112 | Ga0500616_0000112_118244_118453 | 69 |
| 437 | 3300053156 | Ga0500622_0000717 | Ga0500622_0000717_6867_7076 | 69 |
| 438 | 3300053156 | Ga0500622_0012486 | Ga0500622_0012486_4225_4434 | 69 |
| 439 | 3300053158 | Ga0500627_0131462 | Ga0500627_0131462_443_652 | 69 |
| 440 | 3300053160 | Ga0500633_0043783 | Ga0500633_0043783_267_476 | 69 |
| 441 | 3300053161 | Ga0500634_0044297 | Ga0500634_0044297_488_697 | 69 |
| 442 | 3300053161 | Ga0500634_0333752 | Ga0500634_0333752_121_330 | 69 |
| 443 | 3300053163 | Ga0500639_178119 | Ga0500639_178119_273_482 | 69 |
| 444 | 3300053177 | Ga0500636_0377057 | Ga0500636_0377057_398_607 | 69 |
| 445 | 3300053178 | Ga0500637_0077801 | Ga0500637_0077801_1372_1581 | 69 |
| 446 | 3300053723 | Ga0500567_057661 | Ga0500567_057661_1288_1497 | 69 |
| 447 | 3300053724 | Ga0500570_222923 | Ga0500570_222923_176_385 | 69 |
| 448 | 3300053727 | Ga0500611_099405 | Ga0500611_099405_394_603 | 69 |
| 449 | 3300053730 | Ga0500645_002004 | Ga0500645_002004_1710_1919 | 69 |
| 450 | 3300053730 | Ga0500645_048766 | Ga0500645_048766_941_1150 | 69 |
| 451 | 3300053731 | Ga0500609_003288 | Ga0500609_003288_1742_1951 | 69 |
| 452 | 3300053731 | Ga0500609_003661 | Ga0500609_003661_103_315 | 69 |
| 453 | 3300053739 | Ga0500587_034280 | Ga0500587_034280_40_297 | 69 |
| 454 | 3300059424 | Ga0590075_002461 | Ga0590075_002461_2264_2473 | 69 |
| 455 | 3300059426 | Ga0590077_020797 | Ga0590077_020797_188_397 | 69 |
| 456 | 3300059490 | Ga0587066_144466 | Ga0587066_144466_93_302 | 69 |
| 457 | 3300059503 | Ga0587080_154573 | Ga0587080_154573_125_334 | 69 |
| 458 | 3300060346 | Ga0587111_0016459 | Ga0587111_0016459_125_334 | 69 |
| 459 | 3300060353 | Ga0501082_0557152 | Ga0501082_0557152_529_738 | 69 |
| 460 | 3300061734 | Ga0530510_1279447 | Ga0530510_1279447_10_225 | 69 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mjc-assembly1.cif.gz_A | crystal structure of cspa, the major cold shock protein of escherichia coli | 0.9146 | 2 | 69 |
| 8h1i-assembly1.cif.gz_B | crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c | 0.9125 | 2 | 69 |
| 3aqq-assembly1.cif.gz_D | crystal structure of human crhsp-24 | 0.9069 | 2 | 68 |
| 2lss-assembly1.cif.gz_A | solution structure of the r. rickettsii cold shock-like protein | 0.9039 | 3 | 69 |
| 3aqq-assembly1.cif.gz_C | crystal structure of human crhsp-24 | 0.8987 | 2 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LPN7_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9229 | 2 | 68 | 2.40.50.140 |
| af_Q94C69_1_75_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9186 | 2 | 67 | 2.40.50.140 |
| af_P0A976_2_68_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9105 | 2 | 67 | 2.40.50.140 |
| 2lssA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9039 | 3 | 69 | 2.40.50.140 |
| af_Q9VRN5_36_116_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8987 | 2 | 69 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A371B4W4-F1-model_v4 | Cold-shock protein | 0.9922 | 1 | 69 |
GO:0003676
GO:0005829 |
| AF-A0A246E1Q0-F1-model_v4 | Cold-shock protein | 0.9911 | 1 | 69 |
GO:0003676
GO:0005829 |
| AF-A0A2E7RF98-F1-model_v4 | Cold-shock protein | 0.9911 | 1 | 69 |
GO:0003676
GO:0005829 |
| AF-A0A1I1HSF1-F1-model_v4 | Cold-shock DNA-binding protein family | 0.99 | 1 | 69 |
GO:0003677
GO:0005829 |
| AF-A0A7Y4H5I2-F1-model_v4 | Cold shock domain-containing protein | 0.99 | 1 | 67 |
GO:0003676
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar