F448637

General Info

Members Datasets Scaffolds Average Seq Length
460 304 460 69

Family's Representative Sequence

Representative Sequence 3300053739|Ga0500587_034280|Ga0500587_034280_40_297
Length 85
Sequence MSARLVHKRINARKAKMATGTVKFFNAQKGFGFIQPADGSKDVFVHISAVERAGLGSLNEGQKVSFEATVDSKRGKTSAENLRAM

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
241 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
255 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
260 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
261 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
262 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
279 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
280 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
283 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
287 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
290 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
291 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
292 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
293 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
294 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
295 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
296 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
297 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
298 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.57
Nodule 0
Rhizoplane 4.78
Rhizosphere 63.48
Stem 0
Stem Tuber 0
Unclassified 7.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10039473 3300003215 Bacteria 1475
2 Ga0055536_1008093 3300003781 Bacteria 4586
3 Ga0055530_10000337 3300003791 Bacteria 42372
4 Ga0055530_10015205 3300003791 Bacteria 2526
5 Ga0055531_10000915 3300003794 Bacteria 23931
6 Ga0055531_10012998 3300003794 Bacteria 3871
7 Ga0055531_10017100 3300003794 Bacteria 3081
8 Ga0055531_10057166 3300003794 Bacteria 979
9 Ga0065165_1017934 3300005262 Bacteria 2585
10 Ga0065165_1122586 3300005262 Bacteria 629
11 Ga0070658_10949209 3300005327 Bacteria 748
12 Ga0070683_101614217 3300005329 Bacteria 624
13 Ga0070683_102071723 3300005329 Bacteria 547
14 Ga0070670_101076986 3300005331 Bacteria 732
15 Ga0068869_100234594 3300005334 Bacteria 1459
16 Ga0070666_11358144 3300005335 Bacteria 531
17 Ga0070680_100670477 3300005336 Bacteria 892
18 Ga0070682_100879420 3300005337 Bacteria 734
19 Ga0070660_100026203 3300005339 Bacteria 4339
20 Ga0070689_100541909 3300005340 Bacteria 1002
21 Ga0070689_100584363 3300005340 Bacteria 966
22 Ga0070661_100546111 3300005344 Bacteria 932
23 Ga0070668_100080095 3300005347 Bacteria 2558
24 Ga0070668_100376961 3300005347 Bacteria 1206
25 Ga0070668_101448208 3300005347 Bacteria 627
26 Ga0070669_100317966 3300005353 Bacteria 1256
27 Ga0070669_100633028 3300005353 Bacteria 899
28 Ga0070675_101679735 3300005354 Bacteria 586
29 Ga0070667_100793782 3300005367 Bacteria 879
30 Ga0070714_100326147 3300005435 Bacteria 1437
31 Ga0070714_100378000 3300005435 Bacteria 1335
32 Ga0070663_100029850 3300005455 Bacteria 3730
33 Ga0070678_101483133 3300005456 Bacteria 635
34 Ga0070681_10199509 3300005458 Bacteria 1919
35 Ga0070681_11590773 3300005458 Bacteria 579
36 Ga0068867_101027515 3300005459 Bacteria 749
37 Ga0068867_101503387 3300005459 Bacteria 627
38 Ga0070698_101404935 3300005471 Bacteria 649
39 Ga0070684_101623619 3300005535 Bacteria 610
40 Ga0070672_100805281 3300005543 Bacteria 827
41 Ga0070686_101583762 3300005544 Bacteria 554
42 Ga0070695_100288233 3300005545 Bacteria 1209
43 Ga0070693_100738918 3300005547 Bacteria 724
44 Ga0070665_100005904 3300005548 Bacteria 12540
45 Ga0070665_100464623 3300005548 Bacteria 1276
46 Ga0068855_100060409 3300005563 Bacteria 4433
47 Ga0068855_100146673 3300005563 Bacteria 2686
48 Ga0068855_100540840 3300005563 Bacteria 1262
49 Ga0068855_100989877 3300005563 Bacteria 884
50 Ga0068857_101012417 3300005577 Bacteria 800
51 Ga0068854_100245352 3300005578 Bacteria 1428
52 Ga0068854_101382101 3300005578 Bacteria 636
53 Ga0068854_101581571 3300005578 Bacteria 597
54 Ga0068854_102232237 3300005578 Bacteria 507
55 Ga0068856_100011504 3300005614 Bacteria 8588
56 Ga0068856_100309582 3300005614 Bacteria 1597
57 Ga0068856_100673893 3300005614 Bacteria 1055
58 Ga0068856_102349778 3300005614 Bacteria 541
59 Ga0068852_100013033 3300005616 Bacteria 6346
60 Ga0068859_102417112 3300005617 Bacteria 579
61 Ga0068866_10594438 3300005718 Bacteria 746
62 Ga0068861_101524187 3300005719 Bacteria 656
63 Ga0068863_100917160 3300005841 Bacteria 877
64 Ga0068863_101326413 3300005841 Bacteria 727
65 Ga0068863_101417389 3300005841 Bacteria 703
66 Ga0068858_102156860 3300005842 Bacteria 551
67 Ga0068860_100000037 3300005843 Bacteria 234524
68 Ga0068862_100054756 3300005844 Bacteria 3415
69 Ga0068862_100260857 3300005844 Bacteria 1582
70 Ga0081455_10001951 3300005937 Bacteria 24782
71 Ga0070717_10118798 3300006028 Bacteria 2263
72 Ga0075365_10023371 3300006038 Bacteria 3887
73 Ga0075363_100039586 3300006048 Bacteria 2481
74 Ga0075364_10246667 3300006051 Bacteria 1213
75 Ga0075364_10279124 3300006051 Bacteria 1136
76 Ga0070712_100974651 3300006175 Bacteria 733
77 Ga0075367_10022115 3300006178 Bacteria 3563
78 Ga0075369_10195233 3300006186 Bacteria 933
79 Ga0075369_10384901 3300006186 Bacteria 660
80 Ga0075366_10509985 3300006195 Bacteria 744
81 Ga0097621_100344937 3300006237 Bacteria 1323
82 Ga0075370_10079587 3300006353 Bacteria 1882
83 Ga0075370_10108230 3300006353 Bacteria 1613
84 Ga0075370_10185246 3300006353 Bacteria 1226
85 Ga0068871_100300072 3300006358 Bacteria 1410
86 Ga0068871_100570836 3300006358 Bacteria 1026
87 Ga0068871_101128480 3300006358 Bacteria 734
88 Ga0075428_102574753 3300006844 Bacteria 520
89 Ga0075433_10450118 3300006852 Bacteria 1135
90 Ga0068865_100002490 3300006881 Bacteria 10907
91 Ga0068865_100509048 3300006881 Bacteria 1005
92 Ga0075436_101426886 3300006914 Bacteria 525
93 Ga0097620_102416754 3300006931 Bacteria 579
94 Ga0099795_10079903 3300007788 Bacteria 1249
95 Ga0105240_11682394 3300009093 Bacteria 663
96 Ga0105240_12069702 3300009093 Bacteria 591
97 Ga0111539_13443358 3300009094 Bacteria 508
98 Ga0105245_11376453 3300009098 Bacteria 755
99 Ga0105247_10360574 3300009101 Bacteria 1025
100 Ga0105248_10741995 3300009177 Bacteria 1108
101 Ga0105237_11530400 3300009545 Bacteria 674
102 Ga0105238_12162816 3300009551 Bacteria 591
103 Ga0105249_11204986 3300009553 Bacteria 828
104 Ga0099796_10014563 3300010159 Bacteria 2275
105 Ga0105246_10372721 3300011119 Bacteria 1177
106 Ga0105246_10709144 3300011119 Bacteria 883
107 Ga0157369_10064024 3300013105 Bacteria 3960
108 Ga0157369_10901797 3300013105 Bacteria 907
109 Ga0163162_10501172 3300013306 Bacteria 1345
110 Ga0163162_12874535 3300013306 Bacteria 554
111 Ga0157375_11466552 3300013308 Bacteria 805
112 Ga0163163_10542515 3300014325 Bacteria 1225
113 Ga0163163_12900816 3300014325 Bacteria 535
114 Ga0157380_10921799 3300014326 Bacteria 901
115 Ga0157380_11041165 3300014326 Bacteria 854
116 Ga0157380_11280522 3300014326 Bacteria 780
117 Ga0157380_11361511 3300014326 Bacteria 759
118 Ga0157380_11601540 3300014326 Bacteria 707
119 Ga0157380_11751543 3300014326 Bacteria 680
120 Ga0157380_12233478 3300014326 Bacteria 611
121 Ga0182008_10143737 3300014497 Bacteria 1194
122 Ga0157377_10613212 3300014745 Bacteria 778
123 Ga0157379_10654342 3300014968 Bacteria 984
124 Ga0157379_10766713 3300014968 Bacteria 909
125 Ga0157376_10461238 3300014969 Bacteria 1241
126 Ga0182007_10012367 3300015262 Bacteria 3284
127 Ga0163161_10375478 3300017792 Bacteria 1135
128 Ga0163161_11292726 3300017792 Bacteria 634
129 Ga0213872_10075297 3300021361 Bacteria 1519
130 Ga0213875_10037946 3300021388 Bacteria 2270
131 Ga0209026_1004463 3300025250 Bacteria 4132
132 Ga0209148_1020118 3300025254 Bacteria 1101
133 Ga0209233_1053394 3300025261 Bacteria 811
134 Ga0209455_1041381 3300025272 Bacteria 698
135 Ga0209676_1000282 3300025292 Bacteria 105777
136 Ga0209564_1010399 3300025295 Bacteria 4292
137 Ga0209758_1003525 3300025297 Bacteria 14108
138 Ga0209050_1000095 3300025298 Bacteria 242722
139 Ga0209050_1001911 3300025298 Bacteria 19933
140 Ga0209257_1000106 3300025304 Bacteria 242634
141 Ga0209257_1000332 3300025304 Bacteria 98632
142 Ga0209257_1000641 3300025304 Bacteria 55911
143 Ga0207688_10246264 3300025901 Bacteria 1082
144 Ga0207654_10222856 3300025911 Bacteria 1252
145 Ga0207707_10457787 3300025912 Bacteria 1091
146 Ga0207695_10383141 3300025913 Bacteria 1292
147 Ga0207695_11063388 3300025913 Bacteria 689
148 Ga0207695_11257804 3300025913 Bacteria 620
149 Ga0207671_10897630 3300025914 Bacteria 701
150 Ga0207657_10028470 3300025919 Bacteria 5096
151 Ga0207657_10995826 3300025919 Bacteria 643
152 Ga0207657_11027570 3300025919 Bacteria 632
153 Ga0207681_10322349 3300025923 Bacteria 1229
154 Ga0207681_10804391 3300025923 Bacteria 785
155 Ga0207694_10037753 3300025924 Bacteria 3712
156 Ga0207694_10320212 3300025924 Bacteria 1280
157 Ga0207650_10329371 3300025925 Bacteria 1252
158 Ga0207650_11022772 3300025925 Bacteria 703
159 Ga0207650_11644062 3300025925 Bacteria 545
160 Ga0207659_10795104 3300025926 Bacteria 812
161 Ga0207659_11443643 3300025926 Bacteria 589
162 Ga0207664_11009887 3300025929 Bacteria 745
163 Ga0207670_11053952 3300025936 Bacteria 685
164 Ga0207704_10023565 3300025938 Bacteria 3320
165 Ga0207704_10499026 3300025938 Bacteria 981
166 Ga0207691_11112307 3300025940 Bacteria 657
167 Ga0207661_11198285 3300025944 Bacteria 699
168 Ga0207661_11668391 3300025944 Bacteria 582
169 Ga0207667_10111987 3300025949 Bacteria 2815
170 Ga0207667_10228837 3300025949 Bacteria 1904
171 Ga0207667_10289251 3300025949 Bacteria 1674
172 Ga0207667_10820046 3300025949 Bacteria 926
173 Ga0207667_10829305 3300025949 Bacteria 920
174 Ga0207667_11587597 3300025949 Bacteria 623
175 Ga0207668_10130453 3300025972 Bacteria 1918
176 Ga0207668_11211633 3300025972 Bacteria 679
177 Ga0207668_11585544 3300025972 Bacteria 591
178 Ga0207640_10013118 3300025981 Bacteria 4740
179 Ga0207640_11570031 3300025981 Bacteria 592
180 Ga0207658_10411778 3300025986 Bacteria 1190
181 Ga0207678_10027553 3300026067 Bacteria 4958
182 Ga0207702_10034487 3300026078 Bacteria 4231
183 Ga0207702_10203336 3300026078 Bacteria 1837
184 Ga0207702_10316145 3300026078 Bacteria 1486
185 Ga0207702_10894247 3300026078 Bacteria 880
186 Ga0207702_10943505 3300026078 Bacteria 855
187 Ga0207641_10618680 3300026088 Bacteria 1062
188 Ga0207648_10532371 3300026089 Bacteria 1077
189 Ga0207648_11645839 3300026089 Bacteria 603
190 Ga0207674_11247145 3300026116 Bacteria 713
191 Ga0207674_11402948 3300026116 Bacteria 668
192 Ga0207675_102328974 3300026118 Bacteria 549
193 Ga0207683_10897424 3300026121 Bacteria 823
194 Ga0207698_10047667 3300026142 Bacteria 3248
195 Ga0207698_11001791 3300026142 Bacteria 846
196 Ga0209179_1026856 3300027512 Bacteria 1158
197 Ga0268266_10002702 3300028379 Bacteria 18611
198 Ga0268266_10130329 3300028379 Bacteria 2249
199 Ga0268265_10005623 3300028380 Bacteria 8562
200 Ga0268265_10128073 3300028380 Bacteria 2105
201 Ga0268265_10178342 3300028380 Bacteria 1823
202 Ga0268265_10494293 3300028380 Bacteria 1151
203 Ga0268264_10000002 3300028381 Bacteria 1153045
204 Ga0307515_10147271 3300028794 Bacteria 2486
205 Ga0307511_10009257 3300030521 Bacteria 9811
206 Ga0265330_10339156 3300031235 Bacteria 634
207 Ga0307513_10122822 3300031456 Bacteria 2560
208 Ga0307408_102529699 3300031548 Bacteria 500
209 Ga0316579_10040909 3300031691 Bacteria 2151
210 Ga0316579_10103418 3300031691 Bacteria 1365
211 Ga0265314_10144092 3300031711 Bacteria 1469
212 Ga0307405_10101846 3300031731 Bacteria 1928
213 Ga0307405_11467339 3300031731 Bacteria 598
214 Ga0307405_11908103 3300031731 Bacteria 530
215 Ga0307405_12048939 3300031731 Bacteria 513
216 Ga0307413_10155204 3300031824 Bacteria 1600
217 Ga0307413_10367673 3300031824 Bacteria 1116
218 Ga0307406_11387418 3300031901 Bacteria 615
219 Ga0307409_102054729 3300031995 Bacteria 601
220 Ga0307416_102888180 3300032002 Bacteria 575
221 Ga0307414_10218288 3300032004 Bacteria 1563
222 Ga0307411_10137932 3300032005 Bacteria 1794
223 Ga0307411_10236234 3300032005 Bacteria 1428
224 Ga0316583_10000048 3300032133 Bacteria 23093
225 Ga0316593_10037294 3300032168 Bacteria 1606
226 Ga0316593_10161695 3300032168 Bacteria 818
227 Ga0316593_10226330 3300032168 Bacteria 696
228 Ga0307510_10054322 3300033180 Bacteria 4197
229 Ga0307510_10149207 3300033180 Bacteria 1962
230 Ga0373934_0054909 3300035086 Bacteria 1582
231 Ga0373924_0582914 3300035410 Bacteria 504
232 Ga0373933_0631117 3300035724 Bacteria 704
233 Ga0373925_0113154 3300037068 Bacteria 2098
234 Ga0395898_0257306 3300037466 Bacteria 1665
235 Ga0395905_0279921 3300037471 Bacteria 1554
236 Ga0395905_0554713 3300037471 Bacteria 1050
237 Ga0395905_0872781 3300037471 Bacteria 803
238 Ga0395905_1581827 3300037471 Bacteria 560
239 Ga0316581_0153903 3300037588 Bacteria 709
240 Ga0436364_1205445 3300037853 Bacteria 4539
241 Ga0395901_1222831 3300038443 Bacteria 716
242 Ga0436365_0332337 3300039437 Bacteria 581
243 Ga0451793_1733260 3300041452 Bacteria 603
244 Ga0451841_0587899 3300041498 Bacteria 712
245 Ga0451855_1514446 3300041511 Bacteria 530
246 Ga0451853_0315559 3300041512 Bacteria 555
247 Ga0451853_2618744 3300041512 Bacteria 509
248 Ga0439431_0019146 3300041997 Bacteria 1624
249 Ga0453684_0457212 3300044712 Bacteria 1420
250 Ga0495603_0021713 3300046455 Bacteria 3888
251 Ga0495638_0084882 3300046460 Bacteria 1915
252 Ga0495638_0099278 3300046460 Bacteria 1743
253 Ga0495650_0060370 3300046471 Bacteria 1523
254 Ga0495639_0117027 3300046475 Bacteria 1269
255 Ga0495607_0211014 3300046501 Bacteria 955
256 Ga0495583_0054853 3300046506 Bacteria 1803
257 Ga0495606_0289302 3300046507 Bacteria 892
258 Ga0495606_0591326 3300046507 Bacteria 546
259 Ga0495610_0079773 3300046512 Bacteria 1506
260 Ga0495616_0033362 3300046513 Bacteria 2683
261 Ga0495620_0033380 3300046515 Bacteria 2337
262 Ga0495628_0213659 3300046516 Bacteria 1450
263 Ga0495630_0906438 3300046517 Bacteria 671
264 Ga0495631_0189527 3300046518 Bacteria 880
265 Ga0495632_0064449 3300046519 Bacteria 1772
266 Ga0495637_0148318 3300046520 Bacteria 886
267 Ga0495643_0130520 3300046522 Bacteria 1262
268 Ga0495643_0340730 3300046522 Bacteria 673
269 Ga0495648_0000580 3300046524 Bacteria 39129
270 Ga0495648_0240396 3300046524 Bacteria 880
271 Ga0495666_0303304 3300046526 Bacteria 722
272 Ga0495654_0023909 3300046530 Bacteria 3161
273 Ga0495609_0090384 3300046538 Bacteria 1332
274 Ga0495621_0154455 3300046539 Bacteria 904
275 Ga0495597_0063998 3300046542 Bacteria 1598
276 Ga0495645_0061511 3300046543 Bacteria 2720
277 Ga0495668_0000037 3300046616 Bacteria 233981
278 Ga0495668_0044827 3300046616 Bacteria 2458
279 Ga0495668_0134058 3300046616 Bacteria 1355
280 Ga0495668_0184923 3300046616 Bacteria 1141
281 Ga0495668_0546499 3300046616 Bacteria 639
282 Ga0495611_0083825 3300046648 Bacteria 1469
283 Ga0495625_0205883 3300046660 Bacteria 1296
284 Ga0495625_0209604 3300046660 Bacteria 1281
285 Ga0495659_0293472 3300046664 Bacteria 686
286 Ga0495661_0167295 3300046665 Bacteria 1175
287 Ga0495588_0182761 3300046674 Bacteria 1108
288 Ga0495658_0476425 3300046683 Bacteria 798
289 Ga0495670_0063486 3300046691 Bacteria 1859
290 Ga0495670_0370750 3300046691 Bacteria 772
291 Ga0495671_0069471 3300046692 Bacteria 1731
292 Ga0495660_0089247 3300046810 Bacteria 1605
293 Ga0495674_1248187 3300047319 Bacteria 560
294 Ga0495672_0517392 3300047320 Bacteria 528
295 Ga0495673_0000191 3300047469 Bacteria 96817
296 Ga0495681_0117065 3300047470 Bacteria 1147
297 Ga0495686_0138549 3300047472 Bacteria 1437
298 Ga0495686_0177123 3300047472 Bacteria 1237
299 Ga0495686_0306569 3300047472 Bacteria 874
300 Ga0495686_0366145 3300047472 Bacteria 780
301 Ga0495686_0393412 3300047472 Bacteria 745
302 Ga0495686_0456106 3300047472 Bacteria 678
303 Ga0495686_0660918 3300047472 Bacteria 536
304 Ga0495626_0223030 3300048091 Bacteria 765
305 Ga0496100_0131602 3300048903 Bacteria 1763
306 Ga0496100_0149359 3300048903 Bacteria 1665
307 Ga0496100_0507851 3300048903 Bacteria 929
308 Ga0496102_0200750 3300048905 Bacteria 1880
309 Ga0496102_1044327 3300048905 Bacteria 737
310 Ga0496103_0681367 3300048906 Bacteria 652
311 Ga0496104_1538263 3300048907 Bacteria 568
312 Ga0496105_1089907 3300048908 Bacteria 593
313 Ga0496106_0472933 3300048909 Bacteria 1007
314 Ga0496107_0862791 3300048910 Bacteria 661
315 Ga0496108_0473908 3300048911 Bacteria 1094
316 Ga0496108_0841170 3300048911 Bacteria 790
317 Ga0496109_0556628 3300048912 Bacteria 1082
318 Ga0496110_0023917 3300048913 Bacteria 5202
319 Ga0496111_1186162 3300048914 Bacteria 541
320 Ga0496112_0090897 3300048915 Bacteria 3022
321 Ga0496112_0228214 3300048915 Bacteria 1817
322 Ga0496112_0571638 3300048915 Bacteria 1063
323 Ga0496113_0217892 3300048916 Bacteria 1521
324 Ga0496114_1681055 3300048917 Bacteria 523
325 Ga0496115_1223373 3300048918 Bacteria 563
326 Ga0496116_0002966 3300048919 Bacteria 17265
327 Ga0496116_0192452 3300048919 Bacteria 1078
328 Ga0496117_0091572 3300048920 Bacteria 1955
329 Ga0496118_0070949 3300048921 Bacteria 2511
330 Ga0496118_0151844 3300048921 Bacteria 1448
331 Ga0496119_0377553 3300048922 Bacteria 680
332 Ga0496120_0012249 3300048923 Bacteria 5845
333 Ga0496121_0006360 3300048924 Bacteria 14719
334 Ga0496121_0012038 3300048924 Bacteria 9504
335 Ga0496122_0027335 3300048925 Bacteria 4882
336 Ga0496123_0012473 3300048926 Bacteria 7244
337 Ga0496123_0123285 3300048926 Bacteria 1452
338 Ga0496124_0022257 3300048927 Bacteria 5817
339 Ga0496124_0316771 3300048927 Bacteria 1119
340 Ga0496125_0045576 3300048928 Bacteria 3688
341 Ga0496125_0072227 3300048928 Bacteria 2690
342 Ga0496125_0520966 3300048928 Bacteria 664
343 Ga0496126_0023915 3300048929 Bacteria 5908
344 Ga0496126_0044792 3300048929 Bacteria 4071
345 Ga0496126_0428547 3300048929 Bacteria 1068
346 Ga0501306_045825 3300049127 Bacteria 690
347 Ga0501306_073932 3300049127 Bacteria 579
348 Ga0501343_024323 3300049132 Bacteria 544
349 Ga0495678_063370 3300049459 Bacteria 1381
350 Ga0501316_081007 3300049532 Bacteria 502
351 Ga0501317_071148 3300049533 Bacteria 587
352 Ga0501319_023815 3300049535 Bacteria 562
353 Ga0501320_015656 3300049536 Bacteria 831
354 Ga0501320_041686 3300049536 Bacteria 603
355 Ga0501320_045908 3300049536 Bacteria 584
356 Ga0501321_031487 3300049537 Bacteria 711
357 Ga0501323_023887 3300049539 Bacteria 823
358 Ga0501323_050245 3300049539 Bacteria 631
359 Ga0501324_006409 3300049540 Bacteria 991
360 Ga0501324_025039 3300049540 Bacteria 628
361 Ga0501325_035543 3300049541 Bacteria 588
362 Ga0501325_053934 3300049541 Bacteria 517
363 Ga0501329_03055 3300049545 Bacteria 833
364 Ga0501047_1017092 3300049581 Bacteria 642
365 Ga0501070_0696324 3300049586 Bacteria 804
366 Ga0501073_0734234 3300049589 Bacteria 681
367 Ga0501074_0516773 3300049590 Bacteria 846
368 Ga0501080_0188462 3300049742 Bacteria 1896
369 Ga0501241_098287 3300049758 Bacteria 628
370 Ga0501269_067686 3300049766 Bacteria 514
371 nmdc:mga03683_95265_c1 3300050489 Bacteria 1303
372 nmdc:mga03n38_186224_c1 3300050490 Bacteria 1067
373 nmdc:mga03n38_764186_c1 3300050490 Bacteria 561
374 nmdc:mga00v17_187603_c1 3300050491 Bacteria 1335
375 nmdc:mga0yw44_220863_c1 3300050492 Bacteria 1256
376 nmdc:mga0yw44_4055_c1 3300050492 Bacteria 6630
377 nmdc:mga0yw44_893201_c1 3300050492 Bacteria 603
378 nmdc:mga06z11_541356_c1 3300050494 Bacteria 707
379 nmdc:mga07m45_40638_c1 3300050496 Bacteria 2602
380 nmdc:mga07m45_558820_c1 3300050496 Bacteria 662
381 nmdc:mga07m45_614948_c1 3300050496 Bacteria 627
382 nmdc:mga07m45_78543_c1 3300050496 Bacteria 1883
383 nmdc:mga0n895_1100334_c1 3300050512 Bacteria 772
384 nmdc:mga0a205_880589_c1 3300050515 Bacteria 742
385 nmdc:mga0sz30_13911_c1 3300050516 Bacteria 3159
386 nmdc:mga0sz30_7935_c1 3300050516 Bacteria 3995
387 Ga0500635_0110332 3300053080 Bacteria 1021
388 Ga0500643_041656 3300053087 Bacteria 1347
389 Ga0500643_093981 3300053087 Bacteria 816
390 Ga0500644_0000187 3300053088 Bacteria 39159
391 Ga0500644_0168901 3300053088 Bacteria 888
392 Ga0500581_083483 3300053089 Bacteria 1591
393 Ga0500646_0049813 3300053090 Bacteria 1205
394 Ga0500651_0018719 3300053093 Bacteria 4289
395 Ga0500651_0075557 3300053093 Bacteria 2093
396 Ga0500651_0549756 3300053093 Bacteria 631
397 Ga0500566_0000474 3300053094 Bacteria 22351
398 Ga0500566_0247505 3300053094 Bacteria 869
399 Ga0500641_0226320 3300053096 Bacteria 791
400 Ga0500650_0099254 3300053098 Bacteria 1362
401 Ga0500650_0493270 3300053098 Bacteria 521
402 Ga0500654_196690 3300053099 Bacteria 615
403 Ga0500554_000457 3300053102 Bacteria 8572
404 Ga0500554_104201 3300053102 Bacteria 951
405 Ga0500556_0000029 3300053104 Bacteria 165326
406 Ga0500562_069532 3300053108 Bacteria 949
407 Ga0500569_019245 3300053109 Bacteria 1774
408 Ga0500592_003760 3300053116 Bacteria 2420
409 Ga0500593_224053 3300053117 Bacteria 658
410 Ga0500594_0009753 3300053118 Bacteria 2217
411 Ga0500594_0021347 3300053118 Bacteria 1623
412 Ga0500595_001500 3300053119 Bacteria 12403
413 Ga0500595_089940 3300053119 Bacteria 889
414 Ga0500607_053935 3300053121 Bacteria 2130
415 Ga0500608_000022 3300053122 Bacteria 72979
416 Ga0500608_002234 3300053122 Bacteria 6992
417 Ga0500618_006496 3300053125 Bacteria 3426
418 Ga0500642_0000020 3300053130 Bacteria 159498
419 Ga0500642_0007119 3300053130 Bacteria 3739
420 Ga0500642_0013646 3300053130 Bacteria 2995
421 Ga0500652_007586 3300053131 Bacteria 3561
422 Ga0500658_0217967 3300053134 Bacteria 874
423 Ga0500559_0000593 3300053136 Bacteria 24618
424 Ga0500559_0004746 3300053136 Bacteria 6378
425 Ga0500564_000079 3300053138 Bacteria 25002
426 Ga0500564_290234 3300053138 Bacteria 632
427 Ga0500568_0000521 3300053139 Bacteria 28398
428 Ga0500568_0001940 3300053139 Bacteria 12677
429 Ga0500568_0175801 3300053139 Bacteria 788
430 Ga0500577_0166737 3300053142 Bacteria 940
431 Ga0500586_114418 3300053145 Bacteria 941
432 Ga0500588_0120154 3300053146 Bacteria 926
433 Ga0500590_004588 3300053148 Bacteria 6537
434 Ga0500603_000474 3300053150 Bacteria 10282
435 Ga0500604_0004356 3300053151 Bacteria 3761
436 Ga0500616_0000112 3300053153 Bacteria 151210
437 Ga0500622_0000717 3300053156 Bacteria 28993
438 Ga0500622_0012486 3300053156 Bacteria 4598
439 Ga0500627_0131462 3300053158 Bacteria 1130
440 Ga0500633_0043783 3300053160 Bacteria 1516
441 Ga0500634_0044297 3300053161 Bacteria 2409
442 Ga0500634_0333752 3300053161 Bacteria 586
443 Ga0500639_178119 3300053163 Bacteria 944
444 Ga0500636_0377057 3300053177 Bacteria 666
445 Ga0500637_0077801 3300053178 Bacteria 1913
446 Ga0500567_057661 3300053723 Bacteria 1751
447 Ga0500570_222923 3300053724 Bacteria 537
448 Ga0500611_099405 3300053727 Bacteria 751
449 Ga0500645_002004 3300053730 Bacteria 9558
450 Ga0500645_048766 3300053730 Bacteria 1239
451 Ga0500609_003288 3300053731 Bacteria 2281
452 Ga0500609_003661 3300053731 Bacteria 2144
453 Ga0500587_034280 3300053739 Bacteria 708
454 Ga0590075_002461 3300059424 Bacteria 4428
455 Ga0590077_020797 3300059426 Bacteria 1395
456 Ga0587066_144466 3300059490 Bacteria 584
457 Ga0587080_154573 3300059503 Bacteria 534
458 Ga0587111_0016459 3300060346 Bacteria 1365
459 Ga0501082_0557152 3300060353 Bacteria 1003
460 Ga0530510_1279447 3300061734 Bacteria 562

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_11027570 Ga0207657_110275701 63
2 3300005545 Ga0070695_100288233 Ga0070695_1002882332 67
3 3300005547 Ga0070693_100738918 Ga0070693_1007389182 67
4 3300005937 Ga0081455_10001951 Ga0081455_1000195118 67
5 3300009551 Ga0105238_12162816 Ga0105238_121628161 67
6 3300005337 Ga0070682_100879420 Ga0070682_1008794202 68
7 3300005340 Ga0070689_100541909 Ga0070689_1005419091 68
8 3300005347 Ga0070668_100376961 Ga0070668_1003769612 68
9 3300005458 Ga0070681_11590773 Ga0070681_115907732 68
10 3300005563 Ga0068855_100989877 Ga0068855_1009898772 68
11 3300005614 Ga0068856_102349778 Ga0068856_1023497781 68
12 3300006175 Ga0070712_100974651 Ga0070712_1009746511 68
13 3300006358 Ga0068871_100570836 Ga0068871_1005708363 68
14 3300013105 Ga0157369_10901797 Ga0157369_109017972 68
15 3300014326 Ga0157380_11041165 Ga0157380_110411651 68
16 3300017792 Ga0163161_10375478 Ga0163161_103754781 68
17 3300021361 Ga0213872_10075297 Ga0213872_100752972 68
18 3300021388 Ga0213875_10037946 Ga0213875_100379462 68
19 3300025901 Ga0207688_10246264 Ga0207688_102462642 68
20 3300025949 Ga0207667_10829305 Ga0207667_108293052 68
21 3300026078 Ga0207702_10943505 Ga0207702_109435052 68
22 3300028380 Ga0268265_10178342 Ga0268265_101783421 68
23 3300035086 Ga0373934_0054909 Ga0373934_0054909_213_419 68
24 3300035410 Ga0373924_0582914 Ga0373924_0582914_215_421 68
25 3300037466 Ga0395898_0257306 Ga0395898_0257306_799_1005 68
26 3300037853 Ga0436364_1205445 Ga0436364_1205445_1200_1406 68
27 3300039437 Ga0436365_0332337 Ga0436365_0332337_40_249 68
28 3300049586 Ga0501070_0696324 Ga0501070_0696324_495_701 68
29 3300053130 Ga0500642_0007119 Ga0500642_0007119_1610_1816 68
30 3300003215 JGI25153J46596_10039473 JGI25153J46596_100394732 69
31 3300003781 Ga0055536_1008093 Ga0055536_10080935 69
32 3300003791 Ga0055530_10000337 Ga0055530_100003375 69
33 3300003791 Ga0055530_10015205 Ga0055530_100152054 69
34 3300003794 Ga0055531_10000915 Ga0055531_1000091523 69
35 3300003794 Ga0055531_10012998 Ga0055531_100129986 69
36 3300003794 Ga0055531_10017100 Ga0055531_100171007 69
37 3300003794 Ga0055531_10057166 Ga0055531_100571663 69
38 3300005262 Ga0065165_1017934 Ga0065165_10179342 69
39 3300005262 Ga0065165_1122586 Ga0065165_11225861 69
40 3300005327 Ga0070658_10949209 Ga0070658_109492091 69
41 3300005329 Ga0070683_101614217 Ga0070683_1016142171 69
42 3300005329 Ga0070683_102071723 Ga0070683_1020717231 69
43 3300005331 Ga0070670_101076986 Ga0070670_1010769863 69
44 3300005334 Ga0068869_100234594 Ga0068869_1002345943 69
45 3300005335 Ga0070666_11358144 Ga0070666_113581441 69
46 3300005336 Ga0070680_100670477 Ga0070680_1006704771 69
47 3300005339 Ga0070660_100026203 Ga0070660_1000262034 69
48 3300005340 Ga0070689_100584363 Ga0070689_1005843632 69
49 3300005344 Ga0070661_100546111 Ga0070661_1005461113 69
50 3300005347 Ga0070668_100080095 Ga0070668_1000800955 69
51 3300005347 Ga0070668_101448208 Ga0070668_1014482082 69
52 3300005353 Ga0070669_100317966 Ga0070669_1003179662 69
53 3300005353 Ga0070669_100633028 Ga0070669_1006330282 69
54 3300005354 Ga0070675_101679735 Ga0070675_1016797351 69
55 3300005367 Ga0070667_100793782 Ga0070667_1007937822 69
56 3300005435 Ga0070714_100326147 Ga0070714_1003261471 69
57 3300005435 Ga0070714_100378000 Ga0070714_1003780001 69
58 3300005455 Ga0070663_100029850 Ga0070663_1000298505 69
59 3300005456 Ga0070678_101483133 Ga0070678_1014831331 69
60 3300005458 Ga0070681_10199509 Ga0070681_101995093 69
61 3300005459 Ga0068867_101027515 Ga0068867_1010275152 69
62 3300005459 Ga0068867_101503387 Ga0068867_1015033871 69
63 3300005471 Ga0070698_101404935 Ga0070698_1014049351 69
64 3300005535 Ga0070684_101623619 Ga0070684_1016236192 69
65 3300005543 Ga0070672_100805281 Ga0070672_1008052812 69
66 3300005544 Ga0070686_101583762 Ga0070686_1015837622 69
67 3300005548 Ga0070665_100005904 Ga0070665_1000059043 69
68 3300005548 Ga0070665_100464623 Ga0070665_1004646232 69
69 3300005563 Ga0068855_100060409 Ga0068855_1000604096 69
70 3300005563 Ga0068855_100146673 Ga0068855_1001466733 69
71 3300005563 Ga0068855_100540840 Ga0068855_1005408403 69
72 3300005577 Ga0068857_101012417 Ga0068857_1010124172 69
73 3300005578 Ga0068854_100245352 Ga0068854_1002453522 69
74 3300005578 Ga0068854_101382101 Ga0068854_1013821012 69
75 3300005578 Ga0068854_101581571 Ga0068854_1015815712 69
76 3300005578 Ga0068854_102232237 Ga0068854_1022322371 69
77 3300005614 Ga0068856_100011504 Ga0068856_1000115047 69
78 3300005614 Ga0068856_100309582 Ga0068856_1003095822 69
79 3300005614 Ga0068856_100673893 Ga0068856_1006738931 69
80 3300005616 Ga0068852_100013033 Ga0068852_1000130333 69
81 3300005617 Ga0068859_102417112 Ga0068859_1024171121 69
82 3300005718 Ga0068866_10594438 Ga0068866_105944382 69
83 3300005719 Ga0068861_101524187 Ga0068861_1015241871 69
84 3300005841 Ga0068863_100917160 Ga0068863_1009171603 69
85 3300005841 Ga0068863_101326413 Ga0068863_1013264132 69
86 3300005841 Ga0068863_101417389 Ga0068863_1014173893 69
87 3300005842 Ga0068858_102156860 Ga0068858_1021568602 69
88 3300005843 Ga0068860_100000037 Ga0068860_100000037131 69
89 3300005844 Ga0068862_100054756 Ga0068862_1000547562 69
90 3300005844 Ga0068862_100260857 Ga0068862_1002608572 69
91 3300006028 Ga0070717_10118798 Ga0070717_101187982 69
92 3300006038 Ga0075365_10023371 Ga0075365_100233714 69
93 3300006048 Ga0075363_100039586 Ga0075363_1000395863 69
94 3300006051 Ga0075364_10246667 Ga0075364_102466673 69
95 3300006051 Ga0075364_10279124 Ga0075364_102791242 69
96 3300006178 Ga0075367_10022115 Ga0075367_100221152 69
97 3300006186 Ga0075369_10195233 Ga0075369_101952332 69
98 3300006186 Ga0075369_10384901 Ga0075369_103849012 69
99 3300006195 Ga0075366_10509985 Ga0075366_105099851 69
100 3300006237 Ga0097621_100344937 Ga0097621_1003449375 69
101 3300006353 Ga0075370_10079587 Ga0075370_100795871 69
102 3300006353 Ga0075370_10108230 Ga0075370_101082303 69
103 3300006353 Ga0075370_10185246 Ga0075370_101852463 69
104 3300006358 Ga0068871_100300072 Ga0068871_1003000724 69
105 3300006358 Ga0068871_101128480 Ga0068871_1011284802 69
106 3300006844 Ga0075428_102574753 Ga0075428_1025747531 69
107 3300006852 Ga0075433_10450118 Ga0075433_104501181 69
108 3300006881 Ga0068865_100002490 Ga0068865_1000024906 69
109 3300006881 Ga0068865_100509048 Ga0068865_1005090481 69
110 3300006914 Ga0075436_101426886 Ga0075436_1014268861 69
111 3300006931 Ga0097620_102416754 Ga0097620_1024167541 69
112 3300007788 Ga0099795_10079903 Ga0099795_100799032 69
113 3300009093 Ga0105240_11682394 Ga0105240_116823941 69
114 3300009093 Ga0105240_12069702 Ga0105240_120697022 69
115 3300009094 Ga0111539_13443358 Ga0111539_134433581 69
116 3300009098 Ga0105245_11376453 Ga0105245_113764531 69
117 3300009101 Ga0105247_10360574 Ga0105247_103605742 69
118 3300009177 Ga0105248_10741995 Ga0105248_107419952 69
119 3300009545 Ga0105237_11530400 Ga0105237_115304001 69
120 3300009553 Ga0105249_11204986 Ga0105249_112049862 69
121 3300010159 Ga0099796_10014563 Ga0099796_100145633 69
122 3300011119 Ga0105246_10372721 Ga0105246_103727212 69
123 3300011119 Ga0105246_10709144 Ga0105246_107091441 69
124 3300013105 Ga0157369_10064024 Ga0157369_100640244 69
125 3300013306 Ga0163162_10501172 Ga0163162_105011724 69
126 3300013306 Ga0163162_12874535 Ga0163162_128745351 69
127 3300013308 Ga0157375_11466552 Ga0157375_114665522 69
128 3300014325 Ga0163163_10542515 Ga0163163_105425152 69
129 3300014325 Ga0163163_12900816 Ga0163163_129008161 69
130 3300014326 Ga0157380_10921799 Ga0157380_109217992 69
131 3300014326 Ga0157380_11280522 Ga0157380_112805221 69
132 3300014326 Ga0157380_11361511 Ga0157380_113615112 69
133 3300014326 Ga0157380_11601540 Ga0157380_116015402 69
134 3300014326 Ga0157380_11751543 Ga0157380_117515431 69
135 3300014326 Ga0157380_12233478 Ga0157380_122334781 69
136 3300014497 Ga0182008_10143737 Ga0182008_101437373 69
137 3300014745 Ga0157377_10613212 Ga0157377_106132121 69
138 3300014968 Ga0157379_10654342 Ga0157379_106543422 69
139 3300014968 Ga0157379_10766713 Ga0157379_107667131 69
140 3300014969 Ga0157376_10461238 Ga0157376_104612382 69
141 3300015262 Ga0182007_10012367 Ga0182007_100123675 69
142 3300017792 Ga0163161_11292726 Ga0163161_112927261 69
143 3300025250 Ga0209026_1004463 Ga0209026_10044638 69
144 3300025254 Ga0209148_1020118 Ga0209148_10201182 69
145 3300025261 Ga0209233_1053394 Ga0209233_10533942 69
146 3300025272 Ga0209455_1041381 Ga0209455_10413812 69
147 3300025292 Ga0209676_1000282 Ga0209676_100028281 69
148 3300025295 Ga0209564_1010399 Ga0209564_10103992 69
149 3300025297 Ga0209758_1003525 Ga0209758_10035259 69
150 3300025298 Ga0209050_1000095 Ga0209050_1000095191 69
151 3300025298 Ga0209050_1001911 Ga0209050_10019114 69
152 3300025304 Ga0209257_1000106 Ga0209257_100010662 69
153 3300025304 Ga0209257_1000332 Ga0209257_100033275 69
154 3300025304 Ga0209257_1000641 Ga0209257_100064157 69
155 3300025911 Ga0207654_10222856 Ga0207654_102228562 69
156 3300025912 Ga0207707_10457787 Ga0207707_104577873 69
157 3300025913 Ga0207695_10383141 Ga0207695_103831412 69
158 3300025913 Ga0207695_11063388 Ga0207695_110633882 69
159 3300025913 Ga0207695_11257804 Ga0207695_112578041 69
160 3300025914 Ga0207671_10897630 Ga0207671_108976302 69
161 3300025919 Ga0207657_10028470 Ga0207657_100284703 69
162 3300025919 Ga0207657_10995826 Ga0207657_109958262 69
163 3300025923 Ga0207681_10322349 Ga0207681_103223491 69
164 3300025923 Ga0207681_10804391 Ga0207681_108043912 69
165 3300025924 Ga0207694_10037753 Ga0207694_100377537 69
166 3300025924 Ga0207694_10320212 Ga0207694_103202122 69
167 3300025925 Ga0207650_10329371 Ga0207650_103293715 69
168 3300025925 Ga0207650_11022772 Ga0207650_110227721 69
169 3300025925 Ga0207650_11644062 Ga0207650_116440622 69
170 3300025926 Ga0207659_10795104 Ga0207659_107951044 69
171 3300025926 Ga0207659_11443643 Ga0207659_114436431 69
172 3300025929 Ga0207664_11009887 Ga0207664_110098871 69
173 3300025936 Ga0207670_11053952 Ga0207670_110539523 69
174 3300025938 Ga0207704_10023565 Ga0207704_100235656 69
175 3300025938 Ga0207704_10499026 Ga0207704_104990261 69
176 3300025940 Ga0207691_11112307 Ga0207691_111123072 69
177 3300025944 Ga0207661_11198285 Ga0207661_111982851 69
178 3300025944 Ga0207661_11668391 Ga0207661_116683911 69
179 3300025949 Ga0207667_10111987 Ga0207667_101119876 69
180 3300025949 Ga0207667_10228837 Ga0207667_102288372 69
181 3300025949 Ga0207667_10289251 Ga0207667_102892513 69
182 3300025949 Ga0207667_10820046 Ga0207667_108200463 69
183 3300025949 Ga0207667_11587597 Ga0207667_115875972 69
184 3300025972 Ga0207668_10130453 Ga0207668_101304534 69
185 3300025972 Ga0207668_11211633 Ga0207668_112116331 69
186 3300025972 Ga0207668_11585544 Ga0207668_115855441 69
187 3300025981 Ga0207640_10013118 Ga0207640_100131186 69
188 3300025981 Ga0207640_11570031 Ga0207640_115700311 69
189 3300025986 Ga0207658_10411778 Ga0207658_104117782 69
190 3300026067 Ga0207678_10027553 Ga0207678_100275534 69
191 3300026078 Ga0207702_10034487 Ga0207702_100344873 69
192 3300026078 Ga0207702_10203336 Ga0207702_102033365 69
193 3300026078 Ga0207702_10316145 Ga0207702_103161453 69
194 3300026078 Ga0207702_10894247 Ga0207702_108942471 69
195 3300026088 Ga0207641_10618680 Ga0207641_106186802 69
196 3300026089 Ga0207648_10532371 Ga0207648_105323712 69
197 3300026089 Ga0207648_11645839 Ga0207648_116458392 69
198 3300026116 Ga0207674_11247145 Ga0207674_112471452 69
199 3300026116 Ga0207674_11402948 Ga0207674_114029481 69
200 3300026118 Ga0207675_102328974 Ga0207675_1023289742 69
201 3300026121 Ga0207683_10897424 Ga0207683_108974243 69
202 3300026142 Ga0207698_10047667 Ga0207698_100476674 69
203 3300026142 Ga0207698_11001791 Ga0207698_110017911 69
204 3300027512 Ga0209179_1026856 Ga0209179_10268562 69
205 3300028379 Ga0268266_10002702 Ga0268266_100027024 69
206 3300028379 Ga0268266_10130329 Ga0268266_101303294 69
207 3300028380 Ga0268265_10005623 Ga0268265_100056239 69
208 3300028380 Ga0268265_10128073 Ga0268265_101280731 69
209 3300028380 Ga0268265_10494293 Ga0268265_104942934 69
210 3300028381 Ga0268264_10000002 Ga0268264_10000002209 69
211 3300028794 Ga0307515_10147271 Ga0307515_101472712 69
212 3300030521 Ga0307511_10009257 Ga0307511_100092577 69
213 3300031235 Ga0265330_10339156 Ga0265330_103391562 69
214 3300031456 Ga0307513_10122822 Ga0307513_101228221 69
215 3300031548 Ga0307408_102529699 Ga0307408_1025296992 69
216 3300031691 Ga0316579_10040909 Ga0316579_100409092 69
217 3300031691 Ga0316579_10103418 Ga0316579_101034182 69
218 3300031711 Ga0265314_10144092 Ga0265314_101440921 69
219 3300031731 Ga0307405_10101846 Ga0307405_101018464 69
220 3300031731 Ga0307405_11467339 Ga0307405_114673391 69
221 3300031731 Ga0307405_11908103 Ga0307405_119081031 69
222 3300031731 Ga0307405_12048939 Ga0307405_120489391 69
223 3300031824 Ga0307413_10155204 Ga0307413_101552044 69
224 3300031824 Ga0307413_10367673 Ga0307413_103676731 69
225 3300031901 Ga0307406_11387418 Ga0307406_113874182 69
226 3300031995 Ga0307409_102054729 Ga0307409_1020547292 69
227 3300032002 Ga0307416_102888180 Ga0307416_1028881802 69
228 3300032004 Ga0307414_10218288 Ga0307414_102182884 69
229 3300032005 Ga0307411_10137932 Ga0307411_101379321 69
230 3300032005 Ga0307411_10236234 Ga0307411_102362344 69
231 3300032133 Ga0316583_10000048 Ga0316583_1000004814 69
232 3300032168 Ga0316593_10037294 Ga0316593_100372944 69
233 3300032168 Ga0316593_10161695 Ga0316593_101616952 69
234 3300032168 Ga0316593_10226330 Ga0316593_102263301 69
235 3300033180 Ga0307510_10054322 Ga0307510_100543224 69
236 3300033180 Ga0307510_10149207 Ga0307510_101492072 69
237 3300035724 Ga0373933_0631117 Ga0373933_0631117_481_690 69
238 3300037068 Ga0373925_0113154 Ga0373925_0113154_1449_1658 69
239 3300037471 Ga0395905_0279921 Ga0395905_0279921_405_614 69
240 3300037471 Ga0395905_0554713 Ga0395905_0554713_716_925 69
241 3300037471 Ga0395905_0872781 Ga0395905_0872781_446_655 69
242 3300037471 Ga0395905_1581827 Ga0395905_1581827_161_370 69
243 3300037588 Ga0316581_0153903 Ga0316581_0153903_189_398 69
244 3300038443 Ga0395901_1222831 Ga0395901_1222831_419_628 69
245 3300041452 Ga0451793_1733260 Ga0451793_1733260_20_229 69
246 3300041498 Ga0451841_0587899 Ga0451841_0587899_389_598 69
247 3300041511 Ga0451855_1514446 Ga0451855_1514446_193_450 69
248 3300041512 Ga0451853_0315559 Ga0451853_0315559_164_373 69
249 3300041512 Ga0451853_2618744 Ga0451853_2618744_151_360 69
250 3300041997 Ga0439431_0019146 Ga0439431_0019146_1113_1322 69
251 3300044712 Ga0453684_0457212 Ga0453684_0457212_141_350 69
252 3300046455 Ga0495603_0021713 Ga0495603_0021713_301_510 69
253 3300046460 Ga0495638_0084882 Ga0495638_0084882_190_399 69
254 3300046460 Ga0495638_0099278 Ga0495638_0099278_1238_1447 69
255 3300046471 Ga0495650_0060370 Ga0495650_0060370_509_718 69
256 3300046475 Ga0495639_0117027 Ga0495639_0117027_127_336 69
257 3300046501 Ga0495607_0211014 Ga0495607_0211014_200_409 69
258 3300046506 Ga0495583_0054853 Ga0495583_0054853_1502_1711 69
259 3300046507 Ga0495606_0289302 Ga0495606_0289302_334_543 69
260 3300046507 Ga0495606_0591326 Ga0495606_0591326_145_354 69
261 3300046512 Ga0495610_0079773 Ga0495610_0079773_975_1184 69
262 3300046513 Ga0495616_0033362 Ga0495616_0033362_1416_1625 69
263 3300046515 Ga0495620_0033380 Ga0495620_0033380_1410_1619 69
264 3300046516 Ga0495628_0213659 Ga0495628_0213659_889_1098 69
265 3300046517 Ga0495630_0906438 Ga0495630_0906438_417_626 69
266 3300046518 Ga0495631_0189527 Ga0495631_0189527_452_661 69
267 3300046519 Ga0495632_0064449 Ga0495632_0064449_547_756 69
268 3300046520 Ga0495637_0148318 Ga0495637_0148318_517_726 69
269 3300046522 Ga0495643_0130520 Ga0495643_0130520_531_740 69
270 3300046522 Ga0495643_0340730 Ga0495643_0340730_289_498 69
271 3300046524 Ga0495648_0000580 Ga0495648_0000580_27960_28169 69
272 3300046524 Ga0495648_0240396 Ga0495648_0240396_486_695 69
273 3300046526 Ga0495666_0303304 Ga0495666_0303304_309_518 69
274 3300046530 Ga0495654_0023909 Ga0495654_0023909_649_858 69
275 3300046538 Ga0495609_0090384 Ga0495609_0090384_20_229 69
276 3300046539 Ga0495621_0154455 Ga0495621_0154455_127_336 69
277 3300046542 Ga0495597_0063998 Ga0495597_0063998_397_606 69
278 3300046543 Ga0495645_0061511 Ga0495645_0061511_1376_1585 69
279 3300046616 Ga0495668_0000037 Ga0495668_0000037_162673_162882 69
280 3300046616 Ga0495668_0044827 Ga0495668_0044827_1555_1764 69
281 3300046616 Ga0495668_0134058 Ga0495668_0134058_905_1114 69
282 3300046616 Ga0495668_0184923 Ga0495668_0184923_474_683 69
283 3300046616 Ga0495668_0546499 Ga0495668_0546499_171_380 69
284 3300046648 Ga0495611_0083825 Ga0495611_0083825_829_1038 69
285 3300046660 Ga0495625_0205883 Ga0495625_0205883_194_403 69
286 3300046660 Ga0495625_0209604 Ga0495625_0209604_391_600 69
287 3300046664 Ga0495659_0293472 Ga0495659_0293472_39_251 69
288 3300046665 Ga0495661_0167295 Ga0495661_0167295_532_741 69
289 3300046674 Ga0495588_0182761 Ga0495588_0182761_243_452 69
290 3300046683 Ga0495658_0476425 Ga0495658_0476425_79_288 69
291 3300046691 Ga0495670_0063486 Ga0495670_0063486_1308_1517 69
292 3300046691 Ga0495670_0370750 Ga0495670_0370750_39_248 69
293 3300046692 Ga0495671_0069471 Ga0495671_0069471_840_1049 69
294 3300046810 Ga0495660_0089247 Ga0495660_0089247_549_758 69
295 3300047319 Ga0495674_1248187 Ga0495674_1248187_20_229 69
296 3300047320 Ga0495672_0517392 Ga0495672_0517392_184_393 69
297 3300047469 Ga0495673_0000191 Ga0495673_0000191_10702_10911 69
298 3300047470 Ga0495681_0117065 Ga0495681_0117065_566_775 69
299 3300047472 Ga0495686_0138549 Ga0495686_0138549_675_884 69
300 3300047472 Ga0495686_0177123 Ga0495686_0177123_520_729 69
301 3300047472 Ga0495686_0306569 Ga0495686_0306569_626_835 69
302 3300047472 Ga0495686_0366145 Ga0495686_0366145_62_271 69
303 3300047472 Ga0495686_0393412 Ga0495686_0393412_176_385 69
304 3300047472 Ga0495686_0456106 Ga0495686_0456106_54_263 69
305 3300047472 Ga0495686_0660918 Ga0495686_0660918_178_390 69
306 3300048091 Ga0495626_0223030 Ga0495626_0223030_132_341 69
307 3300048903 Ga0496100_0131602 Ga0496100_0131602_1245_1454 69
308 3300048903 Ga0496100_0149359 Ga0496100_0149359_1395_1604 69
309 3300048903 Ga0496100_0507851 Ga0496100_0507851_400_609 69
310 3300048905 Ga0496102_0200750 Ga0496102_0200750_1040_1249 69
311 3300048905 Ga0496102_1044327 Ga0496102_1044327_377_586 69
312 3300048906 Ga0496103_0681367 Ga0496103_0681367_314_523 69
313 3300048907 Ga0496104_1538263 Ga0496104_1538263_139_348 69
314 3300048908 Ga0496105_1089907 Ga0496105_1089907_157_366 69
315 3300048909 Ga0496106_0472933 Ga0496106_0472933_130_339 69
316 3300048910 Ga0496107_0862791 Ga0496107_0862791_108_317 69
317 3300048911 Ga0496108_0473908 Ga0496108_0473908_155_364 69
318 3300048911 Ga0496108_0841170 Ga0496108_0841170_38_247 69
319 3300048912 Ga0496109_0556628 Ga0496109_0556628_598_807 69
320 3300048913 Ga0496110_0023917 Ga0496110_0023917_3185_3394 69
321 3300048914 Ga0496111_1186162 Ga0496111_1186162_105_314 69
322 3300048915 Ga0496112_0090897 Ga0496112_0090897_2134_2343 69
323 3300048915 Ga0496112_0228214 Ga0496112_0228214_540_749 69
324 3300048915 Ga0496112_0571638 Ga0496112_0571638_496_705 69
325 3300048916 Ga0496113_0217892 Ga0496113_0217892_201_410 69
326 3300048917 Ga0496114_1681055 Ga0496114_1681055_271_480 69
327 3300048918 Ga0496115_1223373 Ga0496115_1223373_308_517 69
328 3300048919 Ga0496116_0002966 Ga0496116_0002966_7798_8007 69
329 3300048919 Ga0496116_0192452 Ga0496116_0192452_800_1009 69
330 3300048920 Ga0496117_0091572 Ga0496117_0091572_1302_1511 69
331 3300048921 Ga0496118_0070949 Ga0496118_0070949_794_1003 69
332 3300048921 Ga0496118_0151844 Ga0496118_0151844_1073_1282 69
333 3300048922 Ga0496119_0377553 Ga0496119_0377553_264_473 69
334 3300048923 Ga0496120_0012249 Ga0496120_0012249_2663_2872 69
335 3300048924 Ga0496121_0006360 Ga0496121_0006360_12039_12248 69
336 3300048924 Ga0496121_0012038 Ga0496121_0012038_2900_3109 69
337 3300048925 Ga0496122_0027335 Ga0496122_0027335_1189_1398 69
338 3300048926 Ga0496123_0012473 Ga0496123_0012473_6161_6370 69
339 3300048926 Ga0496123_0123285 Ga0496123_0123285_378_587 69
340 3300048927 Ga0496124_0022257 Ga0496124_0022257_2406_2615 69
341 3300048927 Ga0496124_0316771 Ga0496124_0316771_19_228 69
342 3300048928 Ga0496125_0045576 Ga0496125_0045576_830_1039 69
343 3300048928 Ga0496125_0072227 Ga0496125_0072227_1701_1910 69
344 3300048928 Ga0496125_0520966 Ga0496125_0520966_145_354 69
345 3300048929 Ga0496126_0023915 Ga0496126_0023915_2786_2995 69
346 3300048929 Ga0496126_0044792 Ga0496126_0044792_450_659 69
347 3300048929 Ga0496126_0428547 Ga0496126_0428547_387_596 69
348 3300049127 Ga0501306_045825 Ga0501306_045825_129_338 69
349 3300049127 Ga0501306_073932 Ga0501306_073932_316_525 69
350 3300049132 Ga0501343_024323 Ga0501343_024323_137_346 69
351 3300049459 Ga0495678_063370 Ga0495678_063370_255_464 69
352 3300049532 Ga0501316_081007 Ga0501316_081007_102_311 69
353 3300049533 Ga0501317_071148 Ga0501317_071148_120_329 69
354 3300049535 Ga0501319_023815 Ga0501319_023815_165_374 69
355 3300049536 Ga0501320_015656 Ga0501320_015656_51_260 69
356 3300049536 Ga0501320_041686 Ga0501320_041686_165_374 69
357 3300049536 Ga0501320_045908 Ga0501320_045908_10_219 69
358 3300049537 Ga0501321_031487 Ga0501321_031487_402_611 69
359 3300049539 Ga0501323_023887 Ga0501323_023887_265_474 69
360 3300049539 Ga0501323_050245 Ga0501323_050245_135_344 69
361 3300049540 Ga0501324_006409 Ga0501324_006409_126_335 69
362 3300049540 Ga0501324_025039 Ga0501324_025039_256_465 69
363 3300049541 Ga0501325_035543 Ga0501325_035543_182_391 69
364 3300049541 Ga0501325_053934 Ga0501325_053934_22_231 69
365 3300049545 Ga0501329_03055 Ga0501329_03055_503_712 69
366 3300049581 Ga0501047_1017092 Ga0501047_1017092_303_512 69
367 3300049589 Ga0501073_0734234 Ga0501073_0734234_189_398 69
368 3300049590 Ga0501074_0516773 Ga0501074_0516773_592_807 69
369 3300049742 Ga0501080_0188462 Ga0501080_0188462_1629_1838 69
370 3300049758 Ga0501241_098287 Ga0501241_098287_127_336 69
371 3300049766 Ga0501269_067686 Ga0501269_067686_226_435 69
372 3300050489 nmdc:mga03683_95265_c1 nmdc:mga03683_95265_c1_475_684 69
373 3300050490 nmdc:mga03n38_186224_c1 nmdc:mga03n38_186224_c1_686_895 69
374 3300050490 nmdc:mga03n38_764186_c1 nmdc:mga03n38_764186_c1_46_258 69
375 3300050491 nmdc:mga00v17_187603_c1 nmdc:mga00v17_187603_c1_640_849 69
376 3300050492 nmdc:mga0yw44_220863_c1 nmdc:mga0yw44_220863_c1_410_619 69
377 3300050492 nmdc:mga0yw44_4055_c1 nmdc:mga0yw44_4055_c1_575_784 69
378 3300050492 nmdc:mga0yw44_893201_c1 nmdc:mga0yw44_893201_c1_356_565 69
379 3300050494 nmdc:mga06z11_541356_c1 nmdc:mga06z11_541356_c1_357_566 69
380 3300050496 nmdc:mga07m45_40638_c1 nmdc:mga07m45_40638_c1_1423_1632 69
381 3300050496 nmdc:mga07m45_558820_c1 nmdc:mga07m45_558820_c1_411_620 69
382 3300050496 nmdc:mga07m45_614948_c1 nmdc:mga07m45_614948_c1_117_326 69
383 3300050496 nmdc:mga07m45_78543_c1 nmdc:mga07m45_78543_c1_1085_1294 69
384 3300050512 nmdc:mga0n895_1100334_c1 nmdc:mga0n895_1100334_c1_360_569 69
385 3300050515 nmdc:mga0a205_880589_c1 nmdc:mga0a205_880589_c1_268_477 69
386 3300050516 nmdc:mga0sz30_13911_c1 nmdc:mga0sz30_13911_c1_945_1154 69
387 3300050516 nmdc:mga0sz30_7935_c1 nmdc:mga0sz30_7935_c1_3468_3677 69
388 3300053080 Ga0500635_0110332 Ga0500635_0110332_541_750 69
389 3300053087 Ga0500643_041656 Ga0500643_041656_525_734 69
390 3300053087 Ga0500643_093981 Ga0500643_093981_359_568 69
391 3300053088 Ga0500644_0000187 Ga0500644_0000187_11000_11209 69
392 3300053088 Ga0500644_0168901 Ga0500644_0168901_300_509 69
393 3300053089 Ga0500581_083483 Ga0500581_083483_1249_1458 69
394 3300053090 Ga0500646_0049813 Ga0500646_0049813_135_344 69
395 3300053093 Ga0500651_0018719 Ga0500651_0018719_26_235 69
396 3300053093 Ga0500651_0075557 Ga0500651_0075557_1252_1461 69
397 3300053093 Ga0500651_0549756 Ga0500651_0549756_216_425 69
398 3300053094 Ga0500566_0000474 Ga0500566_0000474_15377_15586 69
399 3300053094 Ga0500566_0247505 Ga0500566_0247505_620_829 69
400 3300053096 Ga0500641_0226320 Ga0500641_0226320_344_553 69
401 3300053098 Ga0500650_0099254 Ga0500650_0099254_176_385 69
402 3300053098 Ga0500650_0493270 Ga0500650_0493270_158_367 69
403 3300053099 Ga0500654_196690 Ga0500654_196690_373_582 69
404 3300053102 Ga0500554_000457 Ga0500554_000457_4057_4266 69
405 3300053102 Ga0500554_104201 Ga0500554_104201_70_279 69
406 3300053104 Ga0500556_0000029 Ga0500556_0000029_114810_115019 69
407 3300053108 Ga0500562_069532 Ga0500562_069532_588_797 69
408 3300053109 Ga0500569_019245 Ga0500569_019245_877_1086 69
409 3300053116 Ga0500592_003760 Ga0500592_003760_1128_1337 69
410 3300053117 Ga0500593_224053 Ga0500593_224053_374_583 69
411 3300053118 Ga0500594_0009753 Ga0500594_0009753_978_1187 69
412 3300053118 Ga0500594_0021347 Ga0500594_0021347_579_788 69
413 3300053119 Ga0500595_001500 Ga0500595_001500_1973_2182 69
414 3300053119 Ga0500595_089940 Ga0500595_089940_289_498 69
415 3300053121 Ga0500607_053935 Ga0500607_053935_145_354 69
416 3300053122 Ga0500608_000022 Ga0500608_000022_47115_47324 69
417 3300053122 Ga0500608_002234 Ga0500608_002234_4656_4865 69
418 3300053125 Ga0500618_006496 Ga0500618_006496_2727_2936 69
419 3300053130 Ga0500642_0000020 Ga0500642_0000020_117370_117579 69
420 3300053130 Ga0500642_0013646 Ga0500642_0013646_1040_1249 69
421 3300053131 Ga0500652_007586 Ga0500652_007586_741_950 69
422 3300053134 Ga0500658_0217967 Ga0500658_0217967_521_730 69
423 3300053136 Ga0500559_0000593 Ga0500559_0000593_2173_2382 69
424 3300053136 Ga0500559_0004746 Ga0500559_0004746_6050_6259 69
425 3300053138 Ga0500564_000079 Ga0500564_000079_13894_14103 69
426 3300053138 Ga0500564_290234 Ga0500564_290234_378_587 69
427 3300053139 Ga0500568_0000521 Ga0500568_0000521_14679_14888 69
428 3300053139 Ga0500568_0001940 Ga0500568_0001940_5373_5582 69
429 3300053139 Ga0500568_0175801 Ga0500568_0175801_223_432 69
430 3300053142 Ga0500577_0166737 Ga0500577_0166737_568_777 69
431 3300053145 Ga0500586_114418 Ga0500586_114418_106_315 69
432 3300053146 Ga0500588_0120154 Ga0500588_0120154_574_783 69
433 3300053148 Ga0500590_004588 Ga0500590_004588_2468_2677 69
434 3300053150 Ga0500603_000474 Ga0500603_000474_5776_5985 69
435 3300053151 Ga0500604_0004356 Ga0500604_0004356_830_1039 69
436 3300053153 Ga0500616_0000112 Ga0500616_0000112_118244_118453 69
437 3300053156 Ga0500622_0000717 Ga0500622_0000717_6867_7076 69
438 3300053156 Ga0500622_0012486 Ga0500622_0012486_4225_4434 69
439 3300053158 Ga0500627_0131462 Ga0500627_0131462_443_652 69
440 3300053160 Ga0500633_0043783 Ga0500633_0043783_267_476 69
441 3300053161 Ga0500634_0044297 Ga0500634_0044297_488_697 69
442 3300053161 Ga0500634_0333752 Ga0500634_0333752_121_330 69
443 3300053163 Ga0500639_178119 Ga0500639_178119_273_482 69
444 3300053177 Ga0500636_0377057 Ga0500636_0377057_398_607 69
445 3300053178 Ga0500637_0077801 Ga0500637_0077801_1372_1581 69
446 3300053723 Ga0500567_057661 Ga0500567_057661_1288_1497 69
447 3300053724 Ga0500570_222923 Ga0500570_222923_176_385 69
448 3300053727 Ga0500611_099405 Ga0500611_099405_394_603 69
449 3300053730 Ga0500645_002004 Ga0500645_002004_1710_1919 69
450 3300053730 Ga0500645_048766 Ga0500645_048766_941_1150 69
451 3300053731 Ga0500609_003288 Ga0500609_003288_1742_1951 69
452 3300053731 Ga0500609_003661 Ga0500609_003661_103_315 69
453 3300053739 Ga0500587_034280 Ga0500587_034280_40_297 69
454 3300059424 Ga0590075_002461 Ga0590075_002461_2264_2473 69
455 3300059426 Ga0590077_020797 Ga0590077_020797_188_397 69
456 3300059490 Ga0587066_144466 Ga0587066_144466_93_302 69
457 3300059503 Ga0587080_154573 Ga0587080_154573_125_334 69
458 3300060346 Ga0587111_0016459 Ga0587111_0016459_125_334 69
459 3300060353 Ga0501082_0557152 Ga0501082_0557152_529_738 69
460 3300061734 Ga0530510_1279447 Ga0530510_1279447_10_225 69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

18

85

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9146 2 69
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.9125 2 69
3aqq-assembly1.cif.gz_D crystal structure of human crhsp-24 0.9069 2 68
2lss-assembly1.cif.gz_A solution structure of the r. rickettsii cold shock-like protein 0.9039 3 69
3aqq-assembly1.cif.gz_C crystal structure of human crhsp-24 0.8987 2 69
ID Description Score Start End Superfamily
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9229 2 68 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9186 2 67 2.40.50.140
af_P0A976_2_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9105 2 67 2.40.50.140
2lssA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9039 3 69 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8987 2 69 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A371B4W4-F1-model_v4 Cold-shock protein 0.9922 1 69 GO:0003676
GO:0005829
AF-A0A246E1Q0-F1-model_v4 Cold-shock protein 0.9911 1 69 GO:0003676
GO:0005829
AF-A0A2E7RF98-F1-model_v4 Cold-shock protein 0.9911 1 69 GO:0003676
GO:0005829
AF-A0A1I1HSF1-F1-model_v4 Cold-shock DNA-binding protein family 0.99 1 69 GO:0003677
GO:0005829
AF-A0A7Y4H5I2-F1-model_v4 Cold shock domain-containing protein 0.99 1 67 GO:0003676
GO:0005829

Feature Viewer

pLDDT pTM Quality
90.44 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map