F448589

General Info

Members Datasets Scaffolds Average Seq Length
460 214 920 73

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0959821|Ga0451791_0959821_651_911
Length 86
Sequence MTCDLSVRASNGELTMNTTQANAAQWKKSSRSNGNGGNNCVEVALLDDGAAVRHSKDPAGPVLVFTNAEWAAFVDGTKDGEFDIDG

Samples

Sample ID Description Type Environment
1 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
2 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
108 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
109 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
110 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
114 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
115 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
116 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
117 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
132 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
140 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
143 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
144 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
153 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
156 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
157 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
158 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 43.48
Metatranscriptomes 56.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 2.83
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451791_0959821 3300041451 Bacteria 2490
2 Ga0006762J43184_115455 3300002872 Bacteria 545
3 Ga0006778J45830_1058624 3300003162 Bacteria 580
4 Ga0006759J45824_1052941 3300003163 Bacteria 550
5 Ga0006759J45824_1067122 3300003163 Bacteria 753
6 Ga0006759J45824_1093691 3300003163 Bacteria 512
7 Ga0006759J45824_1096016 3300003163 Unclassified 611
8 JGI25406J46586_10024327 3300003203 Bacteria 2375
9 JGI25406J46586_10049249 3300003203 Bacteria 1422
10 JGI25406J46586_10064063 3300003203 Bacteria 1176
11 Ga0006770J48903_1010105 3300003305 Bacteria 636
12 Ga0006777J48905_1015347 3300003308 Bacteria 568
13 Ga0006777J48905_1077437 3300003308 Unclassified 570
14 Ga0006777J48905_1114276 3300003308 Bacteria 564
15 Ga0007417J51691_1065434 3300003544 Bacteria 590
16 Ga0006781J51513_1070062 3300003568 Bacteria 550
17 Ga0007410J51695_1072665 3300003574 Bacteria 581
18 Ga0032354_1088937 3300003693 Bacteria 590
19 Ga0032354_1191492 3300003693 Unclassified 516
20 Ga0058859_11813653 3300004798 Bacteria 658
21 Ga0058861_10050320 3300004800 Bacteria 589
22 Ga0058861_11941432 3300004800 Bacteria 1440
23 Ga0058860_12219488 3300004801 Bacteria 838
24 Ga0058862_12666197 3300004803 Bacteria 549
25 Ga0058862_12810258 3300004803 Bacteria 710
26 Ga0070683_100000383 3300005329 Bacteria 30748
27 Ga0070670_101038138 3300005331 Bacteria 746
28 Ga0068869_101161509 3300005334 Bacteria 677
29 Ga0070682_100389078 3300005337 Bacteria 1051
30 Ga0068868_100144805 3300005338 Bacteria 1953
31 Ga0070661_100136331 3300005344 Bacteria 1847
32 Ga0070668_100002979 3300005347 Bacteria 12520
33 Ga0070674_100147815 3300005356 Bacteria 1770
34 Ga0070709_11377783 3300005434 Bacteria 570
35 Ga0070709_11382496 3300005434 Bacteria 569
36 Ga0070710_11424522 3300005437 Bacteria 519
37 Ga0070700_100694921 3300005441 Bacteria 808
38 Ga0070708_100103002 3300005445 Bacteria 2616
39 Ga0070708_100371223 3300005445 Bacteria 1349
40 Ga0070663_100222743 3300005455 Bacteria 1482
41 Ga0070678_100748287 3300005456 Bacteria 884
42 Ga0070707_101003768 3300005468 Unclassified 800
43 Ga0070699_100016631 3300005518 Bacteria 6314
44 Ga0070699_100181156 3300005518 Bacteria 1870
45 Ga0070679_100360374 3300005530 Bacteria 1401
46 Ga0070684_100038383 3300005535 Bacteria 4114
47 Ga0070672_100979118 3300005543 Bacteria 749
48 Ga0070665_101319961 3300005548 Bacteria 731
49 Ga0070665_101531468 3300005548 Bacteria 675
50 Ga0070664_100329872 3300005564 Bacteria 1384
51 Ga0068857_100607329 3300005577 Unclassified 1034
52 Ga0068856_101288690 3300005614 Bacteria 746
53 Ga0068856_101659292 3300005614 Bacteria 652
54 Ga0068861_100282380 3300005719 Bacteria 1430
55 Ga0068870_11063320 3300005840 Bacteria 580
56 Ga0068860_101423860 3300005843 Bacteria 714
57 Ga0068862_100007895 3300005844 Bacteria 8807
58 Ga0081539_10000348 3300005985 Bacteria 101459
59 Ga0081539_10000495 3300005985 Bacteria 82397
60 Ga0081539_10003165 3300005985 Bacteria 20864
61 Ga0081539_10029836 3300005985 Bacteria 3398
62 Ga0081539_10138762 3300005985 Bacteria 1184
63 Ga0070717_10145036 3300006028 Unclassified 2050
64 Ga0097621_100279627 3300006237 Bacteria 1469
65 Ga0075428_100360997 3300006844 Bacteria 1558
66 Ga0075434_102172679 3300006871 Bacteria 559
67 Ga0105245_10179409 3300009098 Bacteria 2022
68 Ga0114129_11924849 3300009147 Bacteria 716
69 Ga0157371_11218638 3300013102 Unclassified 580
70 Ga0157375_10580343 3300013308 Bacteria 1281
71 Ga0163163_11779757 3300014325 Bacteria 676
72 Ga0163163_12318844 3300014325 Bacteria 595
73 Ga0157380_10718976 3300014326 Bacteria 1006
74 Ga0157377_11089132 3300014745 Bacteria 611
75 Ga0206356_10183492 3300020070 Bacteria 596
76 Ga0206349_1240733 3300020075 Bacteria 580
77 Ga0206349_1675107 3300020075 Bacteria 545
78 Ga0206349_1783874 3300020075 Bacteria 779
79 Ga0206349_1983768 3300020075 Bacteria 506
80 Ga0206352_10126549 3300020078 Bacteria 607
81 Ga0206352_10156576 3300020078 Bacteria 522
82 Ga0206352_10180903 3300020078 Bacteria 952
83 Ga0206352_10896007 3300020078 Bacteria 566
84 Ga0206354_10313541 3300020081 Bacteria 553
85 Ga0206354_11339579 3300020081 Bacteria 625
86 Ga0206354_11380689 3300020081 Bacteria 752
87 Ga0206354_11541783 3300020081 Bacteria 713
88 Ga0206353_10716313 3300020082 Unclassified 535
89 Ga0206353_11057942 3300020082 Bacteria 508
90 Ga0206353_11893911 3300020082 Bacteria 578
91 Ga0224712_10154274 3300022467 Bacteria 1020
92 Ga0207688_10702770 3300025901 Bacteria 639
93 Ga0207660_11178161 3300025917 Bacteria 624
94 Ga0207649_10248997 3300025920 Unclassified 1279
95 Ga0207652_10475347 3300025921 Bacteria 1126
96 Ga0207646_10206762 3300025922 Bacteria 1773
97 Ga0207650_10784873 3300025925 Bacteria 807
98 Ga0207659_11576062 3300025926 Bacteria 561
99 Ga0207687_11383807 3300025927 Bacteria 605
100 Ga0207686_10999063 3300025934 Bacteria 679
101 Ga0207691_11586210 3300025940 Bacteria 533
102 Ga0207661_10004674 3300025944 Bacteria 9595
103 Ga0207679_10179345 3300025945 Bacteria 1751
104 Ga0207679_10690463 3300025945 Bacteria 926
105 Ga0207668_10002169 3300025972 Bacteria 11447
106 Ga0207668_10641365 3300025972 Bacteria 929
107 Ga0207677_10478014 3300026023 Bacteria 1073
108 Ga0207678_10384956 3300026067 Bacteria 1213
109 Ga0207708_11425930 3300026075 Bacteria 608
110 Ga0207702_11311545 3300026078 Bacteria 718
111 Ga0207674_10336383 3300026116 Bacteria 1460
112 Ga0207675_100346593 3300026118 Bacteria 1455
113 Ga0207675_101102488 3300026118 Bacteria 813
114 Ga0207683_11857005 3300026121 Bacteria 551
115 Ga0268266_11599188 3300028379 Bacteria 627
116 Ga0268265_10007445 3300028380 Bacteria 7395
117 Ga0268264_10504203 3300028381 Bacteria 1181
118 Ga0307517_10087803 3300028786 Bacteria 2579
119 Ga0307517_10342905 3300028786 Bacteria 815
120 Ga0307517_10648128 3300028786 Bacteria 514
121 Ga0307515_10000549 3300028794 Bacteria 88679
122 Ga0307515_10000647 3300028794 Bacteria 80499
123 Ga0307515_10015017 3300028794 Bacteria 14304
124 Ga0307515_10028759 3300028794 Bacteria 9429
125 Ga0307515_10030308 3300028794 Bacteria 9091
126 Ga0307515_10098334 3300028794 Bacteria 3565
127 Ga0307515_10217959 3300028794 Bacteria 1734
128 Ga0307512_10039520 3300030522 Bacteria 3951
129 Ga0307512_10084556 3300030522 Bacteria 2254
130 Ga0307512_10114590 3300030522 Bacteria 1759
131 Ga0307513_10021600 3300031456 Bacteria 7595
132 Ga0307513_10024948 3300031456 Bacteria 6943
133 Ga0307513_10217222 3300031456 Bacteria 1737
134 Ga0307513_10252759 3300031456 Bacteria 1558
135 Ga0307509_10149571 3300031507 Bacteria 2254
136 Ga0307408_100042881 3300031548 Bacteria 3217
137 Ga0307508_10002889 3300031616 Bacteria 17750
138 Ga0307508_10061720 3300031616 Bacteria 3311
139 Ga0307508_10278443 3300031616 Bacteria 1266
140 Ga0307508_10478315 3300031616 Bacteria 839
141 Ga0307508_10544910 3300031616 Bacteria 758
142 Ga0307508_10584409 3300031616 Bacteria 717
143 Ga0307514_10187460 3300031649 Bacteria 1323
144 Ga0307516_10000186 3300031730 Bacteria 80753
145 Ga0307516_10004494 3300031730 Bacteria 17166
146 Ga0307516_10017617 3300031730 Bacteria 7443
147 Ga0307516_10035400 3300031730 Bacteria 5010
148 Ga0307516_10045579 3300031730 Bacteria 4330
149 Ga0307516_10171296 3300031730 Bacteria 1911
150 Ga0307405_10039799 3300031731 Bacteria 2844
151 Ga0307405_10194899 3300031731 Bacteria 1466
152 Ga0307405_12052483 3300031731 Bacteria 512
153 Ga0307413_10065609 3300031824 Bacteria 2261
154 Ga0307413_10283259 3300031824 Bacteria 1248
155 Ga0307413_10507061 3300031824 Bacteria 970
156 Ga0307413_11752821 3300031824 Bacteria 555
157 Ga0307410_10139546 3300031852 Bacteria 1791
158 Ga0307410_10391227 3300031852 Bacteria 1121
159 Ga0307410_10943231 3300031852 Bacteria 741
160 Ga0326468_10000042 3300031889 Bacteria 9767
161 Ga0307406_10015400 3300031901 Bacteria 4424
162 Ga0307406_10189907 3300031901 Bacteria 1503
163 Ga0307406_10615487 3300031901 Bacteria 897
164 Ga0307406_11927734 3300031901 Bacteria 527
165 Ga0307407_10522224 3300031903 Bacteria 873
166 Ga0307407_10545298 3300031903 Bacteria 856
167 Ga0307407_11053794 3300031903 Bacteria 630
168 Ga0307412_10206962 3300031911 Bacteria 1494
169 Ga0307412_12241281 3300031911 Bacteria 509
170 Ga0307409_100004764 3300031995 Bacteria 7689
171 Ga0307409_100050417 3300031995 Bacteria 3179
172 Ga0307409_100079112 3300031995 Bacteria 2648
173 Ga0307416_100225914 3300032002 Bacteria 1800
174 Ga0307416_100347407 3300032002 Bacteria 1499
175 Ga0307416_101290894 3300032002 Bacteria 836
176 Ga0307414_10148791 3300032004 Bacteria 1844
177 Ga0307411_10516942 3300032005 Bacteria 1013
178 Ga0307411_10672943 3300032005 Bacteria 898
179 Ga0307415_100010124 3300032126 Bacteria 5324
180 Ga0307415_100338195 3300032126 Bacteria 1262
181 Ga0307415_100428444 3300032126 Bacteria 1137
182 Ga0307415_100571333 3300032126 Bacteria 1001
183 Ga0307415_101111050 3300032126 Bacteria 740
184 Ga0307415_101165872 3300032126 Bacteria 724
185 Ga0307510_10166004 3300033180 Bacteria 1796
186 Ga0307510_10229967 3300033180 Bacteria 1358
187 Ga0373932_0080636 3300035112 Bacteria 1027
188 Ga0451787_510269 3300041441 Bacteria 643
189 Ga0451788_23963 3300041442 Bacteria 589
190 Ga0451790_09773 3300041444 Bacteria 572
191 Ga0451794_17338 3300041446 Bacteria 627
192 Ga0451791_0155811 3300041451 Bacteria 1820
193 Ga0451793_0001464 3300041452 Bacteria 833
194 Ga0451797_0600456 3300041453 Bacteria 954
195 Ga0451799_28643 3300041454 Bacteria 503
196 Ga0451795_1080926 3300041456 Bacteria 666
197 Ga0451800_1321425 3300041459 Bacteria 659
198 Ga0451805_119048 3300041461 Bacteria 648
199 Ga0451808_15803 3300041464 Bacteria 520
200 Ga0451833_0219539 3300041491 Bacteria 501
201 Ga0451833_1284551 3300041491 Bacteria 667
202 Ga0451837_1375856 3300041494 Bacteria 610
203 Ga0451837_1523156 3300041494 Bacteria 881
204 Ga0451849_1564169 3300041505 Bacteria 517
205 Ga0451843_0425488 3300041509 Bacteria 1637
206 Ga0451853_0187102 3300041512 Bacteria 997
207 Ga0439463_119968 3300042016 Bacteria 680
208 Ga0439459_0084820 3300042438 Bacteria 753
209 Ga0439464_0238330 3300042439 Bacteria 586
210 Ga0466957_0445270 3300044842 Bacteria 892
211 Ga0466967_1931113 3300045976 Eukaryota 587
212 Ga0495638_0094528 3300046460 Bacteria 1797
213 Ga0495632_0035108 3300046519 Bacteria 2561
214 Ga0496124_0861559 3300048927 Bacteria 554
215 Ga0501299_051296 3300049522 Bacteria 853
216 Ga0501303_035894 3300049526 Bacteria 600
217 Ga0501249_118580 3300049679 Bacteria 644
218 Ga0501225_0136485 3300049705 Bacteria 739
219 nmdc:mga06z11_782190_c1 3300050494 Bacteria 581
220 nmdc:mga05p37_1382322_c1 3300050507 Bacteria 711
221 nmdc:mga05p37_1643776_c1 3300050507 Bacteria 630
222 Ga0500610_0427176 3300053079 Bacteria 528
223 Ga0500644_0041613 3300053088 Bacteria 1527
224 Ga0500646_0013194 3300053090 Bacteria 2139
225 Ga0500651_0057331 3300053093 Bacteria 2438
226 Ga0500641_0018702 3300053096 Bacteria 2610
227 Ga0500650_0115115 3300053098 Bacteria 1255
228 Ga0500650_0153273 3300053098 Bacteria 1065
229 Ga0500555_049268 3300053103 Bacteria 1155
230 Ga0500556_0091266 3300053104 Bacteria 1164
231 Ga0500562_139144 3300053108 Bacteria 662
232 Ga0500569_024460 3300053109 Bacteria 1634
233 Ga0500594_0077097 3300053118 Bacteria 990
234 Ga0500614_226287 3300053123 Bacteria 580
235 Ga0500652_019563 3300053131 Bacteria 2518
236 Ga0500658_0272501 3300053134 Bacteria 778
237 Ga0500577_0106205 3300053142 Unclassified 1154
238 Ga0500579_016503 3300053143 Bacteria 4769
239 Ga0500600_0054648 3300053149 Bacteria 2250
240 Ga0500600_0192958 3300053149 Bacteria 968
241 Ga0500622_0282090 3300053156 Bacteria 715
242 Ga0500624_101549 3300053157 Bacteria 591
243 Ga0500630_147272 3300053159 Bacteria 1003
244 Ga0500587_024214 3300053739 Bacteria 805
245 Ga0587084_061285 3300059477 Bacteria 690
246 Ga0587093_021902 3300059478 Bacteria 862
247 Ga0587093_066706 3300059478 Bacteria 598
248 Ga0587093_096751 3300059478 Bacteria 528
249 Ga0587066_021923 3300059490 Bacteria 1064
250 Ga0587066_034334 3300059490 Bacteria 923
251 Ga0587066_043695 3300059490 Bacteria 855
252 Ga0587066_064421 3300059490 Bacteria 756
253 Ga0587066_094879 3300059490 Bacteria 669
254 Ga0587066_160251 3300059490 Bacteria 565
255 Ga0587066_175528 3300059490 Bacteria 548
256 Ga0587066_191423 3300059490 Bacteria 533
257 Ga0587070_051531 3300059491 Bacteria 823
258 Ga0587070_066084 3300059491 Bacteria 760
259 Ga0587070_075507 3300059491 Bacteria 728
260 Ga0587070_087985 3300059491 Bacteria 694
261 Ga0587073_0037546 3300059492 Bacteria 1038
262 Ga0587073_0050442 3300059492 Bacteria 941
263 Ga0587073_0088945 3300059492 Bacteria 782
264 Ga0587073_0115765 3300059492 Bacteria 717
265 Ga0587073_0121651 3300059492 Bacteria 705
266 Ga0587073_0197903 3300059492 Bacteria 600
267 Ga0587073_0205942 3300059492 Bacteria 593
268 Ga0587073_0271825 3300059492 Bacteria 540
269 Ga0587077_057555 3300059493 Bacteria 833
270 Ga0587077_069448 3300059493 Unclassified 784
271 Ga0587077_077280 3300059493 Bacteria 756
272 Ga0587077_083089 3300059493 Bacteria 739
273 Ga0587077_156778 3300059493 Bacteria 599
274 Ga0587077_225536 3300059493 Unclassified 530
275 Ga0587080_021292 3300059503 Bacteria 1065
276 Ga0587080_026032 3300059503 Bacteria 991
277 Ga0587080_046736 3300059503 Bacteria 806
278 Ga0587080_064477 3300059503 Bacteria 720
279 Ga0587080_152044 3300059503 Bacteria 537
280 Ga0587082_035517 3300059504 Bacteria 890
281 Ga0587082_060519 3300059504 Bacteria 745
282 Ga0587082_118335 3300059504 Bacteria 596
283 Ga0587082_172357 3300059504 Unclassified 525
284 Ga0587082_177288 3300059504 Bacteria 520
285 Ga0587083_0048229 3300059505 Bacteria 919
286 Ga0587083_0066654 3300059505 Bacteria 826
287 Ga0587083_0100679 3300059505 Bacteria 719
288 Ga0587083_0101292 3300059505 Bacteria 718
289 Ga0587083_0196916 3300059505 Bacteria 573
290 Ga0587085_019427 3300059506 Bacteria 1018
291 Ga0587085_037533 3300059506 Bacteria 828
292 Ga0587085_049300 3300059506 Bacteria 762
293 Ga0587086_024703 3300059507 Bacteria 846
294 Ga0587086_033253 3300059507 Unclassified 768
295 Ga0587086_042413 3300059507 Bacteria 709
296 Ga0587086_074258 3300059507 Bacteria 589
297 Ga0587086_097098 3300059507 Bacteria 539
298 Ga0587088_044206 3300059508 Bacteria 850
299 Ga0587088_083597 3300059508 Bacteria 687
300 Ga0587088_098874 3300059508 Bacteria 649
301 Ga0587088_112921 3300059508 Unclassified 620
302 Ga0587088_127572 3300059508 Bacteria 595
303 Ga0587089_041686 3300059509 Bacteria 712
304 Ga0587089_056049 3300059509 Bacteria 643
305 Ga0587089_082170 3300059509 Bacteria 562
306 Ga0587089_100845 3300059509 Eukaryota 524
307 Ga0587090_025810 3300059510 Bacteria 951
308 Ga0587090_073751 3300059510 Bacteria 671
309 Ga0587091_034266 3300059511 Bacteria 970
310 Ga0587091_042310 3300059511 Bacteria 903
311 Ga0587091_044312 3300059511 Bacteria 890
312 Ga0587091_046307 3300059511 Bacteria 877
313 Ga0587091_115065 3300059511 Eukaryota 647
314 Ga0587091_150079 3300059511 Unclassified 591
315 Ga0587091_181009 3300059511 Bacteria 555
316 Ga0587091_198079 3300059511 Bacteria 538
317 Ga0587092_048139 3300059512 Bacteria 764
318 Ga0587092_077333 3300059512 Bacteria 652
319 Ga0587092_096219 3300059512 Bacteria 604
320 Ga0587094_030471 3300059513 Bacteria 834
321 Ga0587095_021557 3300059514 Bacteria 622
322 Ga0587097_07435 3300059603 Bacteria 550
323 Ga0587098_041582 3300059604 Bacteria 670
324 Ga0587098_058458 3300059604 Bacteria 601
325 Ga0587106_046625 3300059605 Bacteria 755
326 Ga0587106_063915 3300059605 Unclassified 682
327 Ga0587106_091266 3300059605 Unclassified 609
328 Ga0587106_108793 3300059605 Bacteria 575
329 Ga0587106_113321 3300059605 Unclassified 567
330 Ga0587106_165008 3300059605 Bacteria 502
331 Ga0587125_018845 3300059607 Bacteria 797
332 Ga0587125_043687 3300059607 Bacteria 613
333 Ga0587129_030297 3300059608 Unclassified 518
334 Ga0587099_030191 3300059622 Bacteria 655
335 Ga0587099_051053 3300059622 Unclassified 552
336 Ga0587101_058743 3300059623 Bacteria 681
337 Ga0587101_065889 3300059623 Bacteria 657
338 Ga0587101_081714 3300059623 Unclassified 613
339 Ga0587101_128365 3300059623 Bacteria 531
340 Ga0587109_061798 3300059624 Bacteria 791
341 Ga0587109_068673 3300059624 Bacteria 762
342 Ga0587109_119355 3300059624 Unclassified 625
343 Ga0587109_135809 3300059624 Bacteria 597
344 Ga0587113_012948 3300059625 Bacteria 800
345 Ga0587113_034556 3300059625 Bacteria 586
346 Ga0587113_037978 3300059625 Bacteria 569
347 Ga0587115_011227 3300059626 Bacteria 1127
348 Ga0587115_032514 3300059626 Bacteria 782
349 Ga0587115_032734 3300059626 Bacteria 780
350 Ga0587115_036596 3300059626 Bacteria 751
351 Ga0587115_058767 3300059626 Bacteria 640
352 Ga0587117_045273 3300059627 Unclassified 714
353 Ga0587117_049702 3300059627 Bacteria 692
354 Ga0587117_073989 3300059627 Bacteria 609
355 Ga0587117_079428 3300059627 Bacteria 595
356 Ga0587117_097162 3300059627 Bacteria 557
357 Ga0587122_054312 3300059628 Bacteria 526
358 Ga0587122_060785 3300059628 Bacteria 507
359 Ga0587127_022501 3300059629 Bacteria 566
360 Ga0587127_022723 3300059629 Bacteria 565
361 Ga0587127_024280 3300059629 Bacteria 553
362 Ga0587127_026776 3300059629 Bacteria 537
363 Ga0587128_041397 3300059630 Bacteria 807
364 Ga0587128_135140 3300059630 Bacteria 549
365 Ga0587130_022068 3300059631 Bacteria 694
366 Ga0587130_029911 3300059631 Bacteria 624
367 Ga0587130_054137 3300059631 Eukaryota 508
368 Ga0587062_042317 3300059639 Bacteria 743
369 Ga0587062_044437 3300059639 Bacteria 732
370 Ga0587062_065486 3300059639 Unclassified 647
371 Ga0587062_068180 3300059639 Bacteria 638
372 Ga0587062_102009 3300059639 Bacteria 560
373 Ga0587062_122168 3300059639 Bacteria 528
374 Ga0587062_124754 3300059639 Unclassified 524
375 Ga0587067_039408 3300059640 Bacteria 911
376 Ga0587067_081328 3300059640 Bacteria 718
377 Ga0587067_101390 3300059640 Bacteria 667
378 Ga0587067_125798 3300059640 Bacteria 620
379 Ga0587067_177106 3300059640 Bacteria 553
380 Ga0587067_195649 3300059640 Bacteria 535
381 Ga0587068_058006 3300059641 Bacteria 739
382 Ga0587068_077494 3300059641 Bacteria 666
383 Ga0587068_118781 3300059641 Bacteria 572
384 Ga0587068_127932 3300059641 Bacteria 557
385 Ga0587069_024452 3300059642 Bacteria 932
386 Ga0587069_040562 3300059642 Bacteria 792
387 Ga0587069_070107 3300059642 Bacteria 664
388 Ga0587069_146016 3300059642 Bacteria 522
389 Ga0587069_150944 3300059642 Bacteria 516
390 Ga0587072_063212 3300059643 Bacteria 767
391 Ga0587072_078587 3300059643 Bacteria 709
392 Ga0587072_098320 3300059643 Bacteria 654
393 Ga0587072_111051 3300059643 Bacteria 626
394 Ga0587072_123230 3300059643 Eukaryota 603
395 Ga0587072_182479 3300059643 Bacteria 524
396 Ga0587075_021260 3300059644 Bacteria 965
397 Ga0587075_031787 3300059644 Bacteria 844
398 Ga0587075_034186 3300059644 Bacteria 824
399 Ga0587075_035955 3300059644 Bacteria 810
400 Ga0587075_097958 3300059644 Unclassified 582
401 Ga0587075_114907 3300059644 Bacteria 551
402 Ga0587075_116747 3300059644 Unclassified 548
403 Ga0587076_050602 3300059645 Unclassified 808
404 Ga0587076_072035 3300059645 Bacteria 719
405 Ga0587076_108974 3300059645 Bacteria 628
406 Ga0587078_025702 3300059646 Bacteria 769
407 Ga0587078_038417 3300059646 Bacteria 669
408 Ga0587078_042073 3300059646 Unclassified 648
409 Ga0587078_055173 3300059646 Bacteria 590
410 Ga0587078_060980 3300059646 Unclassified 572
411 Ga0587079_022178 3300059647 Bacteria 1150
412 Ga0587079_029371 3300059647 Bacteria 1046
413 Ga0587079_047153 3300059647 Bacteria 892
414 Ga0587079_056539 3300059647 Bacteria 839
415 Ga0587079_065742 3300059647 Bacteria 797
416 Ga0587079_101350 3300059647 Bacteria 688
417 Ga0587079_152902 3300059647 Unclassified 598
418 Ga0587100_011387 3300059648 Unclassified 764
419 Ga0587100_034019 3300059648 Bacteria 552
420 Ga0587102_042943 3300059649 Bacteria 589
421 Ga0587102_043836 3300059649 Bacteria 585
422 Ga0587104_015795 3300059650 Bacteria 596
423 Ga0587104_016661 3300059650 Bacteria 586
424 Ga0587104_018689 3300059650 Unclassified 565
425 Ga0587105_012059 3300059651 Bacteria 674
426 Ga0587107_020552 3300059652 Bacteria 917
427 Ga0587107_035956 3300059652 Bacteria 778
428 Ga0587107_071494 3300059652 Bacteria 634
429 Ga0587108_030336 3300059653 Bacteria 550
430 Ga0587110_016464 3300059654 Bacteria 800
431 Ga0587110_059671 3300059654 Bacteria 525
432 Ga0587114_073614 3300059655 Bacteria 623
433 Ga0587114_074948 3300059655 Bacteria 620
434 Ga0587114_111304 3300059655 Bacteria 545
435 Ga0587118_08003 3300059657 Bacteria 781
436 Ga0587119_022385 3300059658 Bacteria 816
437 Ga0587119_042891 3300059658 Eukaryota 655
438 Ga0587119_047686 3300059658 Bacteria 632
439 Ga0587119_060472 3300059658 Unclassified 583
440 Ga0587119_064069 3300059658 Bacteria 572
441 Ga0587119_070198 3300059658 Bacteria 555
442 Ga0587119_078691 3300059658 Bacteria 534
443 Ga0587124_008059 3300059660 Bacteria 897
444 Ga0587060_015280 3300060243 Bacteria 695
445 Ga0587060_024500 3300060243 Unclassified 590
446 Ga0587096_05255 3300060247 Bacteria 566
447 Ga0587071_024879 3300060344 Bacteria 1120
448 Ga0587071_028741 3300060344 Bacteria 1060
449 Ga0587071_066707 3300060344 Bacteria 775
450 Ga0587071_068886 3300060344 Bacteria 766
451 Ga0587071_093947 3300060344 Bacteria 685
452 Ga0587071_139388 3300060344 Unclassified 594
453 Ga0587071_159199 3300060344 Bacteria 567
454 Ga0587071_189897 3300060344 Bacteria 532
455 Ga0587111_0020575 3300060346 Bacteria 1264
456 Ga0587111_0034400 3300060346 Bacteria 1052
457 Ga0587111_0048634 3300060346 Bacteria 929
458 Ga0587111_0079907 3300060346 Bacteria 780
459 Ga0587111_0090790 3300060346 Bacteria 746
460 Ga0587111_0114271 3300060346 Bacteria 688
461 Ga0451791_0959821
462 Ga0006762J43184_115455
463 Ga0006778J45830_1058624
464 Ga0006759J45824_1052941
465 Ga0006759J45824_1067122
466 Ga0006759J45824_1093691
467 Ga0006759J45824_1096016
468 JGI25406J46586_10024327
469 JGI25406J46586_10049249
470 JGI25406J46586_10064063
471 Ga0006770J48903_1010105
472 Ga0006777J48905_1015347
473 Ga0006777J48905_1077437
474 Ga0006777J48905_1114276
475 Ga0007417J51691_1065434
476 Ga0006781J51513_1070062
477 Ga0007410J51695_1072665
478 Ga0032354_1088937
479 Ga0032354_1191492
480 Ga0058859_11813653
481 Ga0058861_10050320
482 Ga0058861_11941432
483 Ga0058860_12219488
484 Ga0058862_12666197
485 Ga0058862_12810258
486 Ga0070683_100000383
487 Ga0070670_101038138
488 Ga0068869_101161509
489 Ga0070682_100389078
490 Ga0068868_100144805
491 Ga0070661_100136331
492 Ga0070668_100002979
493 Ga0070674_100147815
494 Ga0070709_11377783
495 Ga0070709_11382496
496 Ga0070710_11424522
497 Ga0070700_100694921
498 Ga0070708_100103002
499 Ga0070708_100371223
500 Ga0070663_100222743
501 Ga0070678_100748287
502 Ga0070707_101003768
503 Ga0070699_100016631
504 Ga0070699_100181156
505 Ga0070679_100360374
506 Ga0070684_100038383
507 Ga0070672_100979118
508 Ga0070665_101319961
509 Ga0070665_101531468
510 Ga0070664_100329872
511 Ga0068857_100607329
512 Ga0068856_101288690
513 Ga0068856_101659292
514 Ga0068861_100282380
515 Ga0068870_11063320
516 Ga0068860_101423860
517 Ga0068862_100007895
518 Ga0081539_10000348
519 Ga0081539_10000495
520 Ga0081539_10003165
521 Ga0081539_10029836
522 Ga0081539_10138762
523 Ga0070717_10145036
524 Ga0097621_100279627
525 Ga0075428_100360997
526 Ga0075434_102172679
527 Ga0105245_10179409
528 Ga0114129_11924849
529 Ga0157371_11218638
530 Ga0157375_10580343
531 Ga0163163_11779757
532 Ga0163163_12318844
533 Ga0157380_10718976
534 Ga0157377_11089132
535 Ga0206356_10183492
536 Ga0206349_1240733
537 Ga0206349_1675107
538 Ga0206349_1783874
539 Ga0206349_1983768
540 Ga0206352_10126549
541 Ga0206352_10156576
542 Ga0206352_10180903
543 Ga0206352_10896007
544 Ga0206354_10313541
545 Ga0206354_11339579
546 Ga0206354_11380689
547 Ga0206354_11541783
548 Ga0206353_10716313
549 Ga0206353_11057942
550 Ga0206353_11893911
551 Ga0224712_10154274
552 Ga0207688_10702770
553 Ga0207660_11178161
554 Ga0207649_10248997
555 Ga0207652_10475347
556 Ga0207646_10206762
557 Ga0207650_10784873
558 Ga0207659_11576062
559 Ga0207687_11383807
560 Ga0207686_10999063
561 Ga0207691_11586210
562 Ga0207661_10004674
563 Ga0207679_10179345
564 Ga0207679_10690463
565 Ga0207668_10002169
566 Ga0207668_10641365
567 Ga0207677_10478014
568 Ga0207678_10384956
569 Ga0207708_11425930
570 Ga0207702_11311545
571 Ga0207674_10336383
572 Ga0207675_100346593
573 Ga0207675_101102488
574 Ga0207683_11857005
575 Ga0268266_11599188
576 Ga0268265_10007445
577 Ga0268264_10504203
578 Ga0307517_10087803
579 Ga0307517_10342905
580 Ga0307517_10648128
581 Ga0307515_10000549
582 Ga0307515_10000647
583 Ga0307515_10015017
584 Ga0307515_10028759
585 Ga0307515_10030308
586 Ga0307515_10098334
587 Ga0307515_10217959
588 Ga0307512_10039520
589 Ga0307512_10084556
590 Ga0307512_10114590
591 Ga0307513_10021600
592 Ga0307513_10024948
593 Ga0307513_10217222
594 Ga0307513_10252759
595 Ga0307509_10149571
596 Ga0307408_100042881
597 Ga0307508_10002889
598 Ga0307508_10061720
599 Ga0307508_10278443
600 Ga0307508_10478315
601 Ga0307508_10544910
602 Ga0307508_10584409
603 Ga0307514_10187460
604 Ga0307516_10000186
605 Ga0307516_10004494
606 Ga0307516_10017617
607 Ga0307516_10035400
608 Ga0307516_10045579
609 Ga0307516_10171296
610 Ga0307405_10039799
611 Ga0307405_10194899
612 Ga0307405_12052483
613 Ga0307413_10065609
614 Ga0307413_10283259
615 Ga0307413_10507061
616 Ga0307413_11752821
617 Ga0307410_10139546
618 Ga0307410_10391227
619 Ga0307410_10943231
620 Ga0326468_10000042
621 Ga0307406_10015400
622 Ga0307406_10189907
623 Ga0307406_10615487
624 Ga0307406_11927734
625 Ga0307407_10522224
626 Ga0307407_10545298
627 Ga0307407_11053794
628 Ga0307412_10206962
629 Ga0307412_12241281
630 Ga0307409_100004764
631 Ga0307409_100050417
632 Ga0307409_100079112
633 Ga0307416_100225914
634 Ga0307416_100347407
635 Ga0307416_101290894
636 Ga0307414_10148791
637 Ga0307411_10516942
638 Ga0307411_10672943
639 Ga0307415_100010124
640 Ga0307415_100338195
641 Ga0307415_100428444
642 Ga0307415_100571333
643 Ga0307415_101111050
644 Ga0307415_101165872
645 Ga0307510_10166004
646 Ga0307510_10229967
647 Ga0373932_0080636
648 Ga0451787_510269
649 Ga0451788_23963
650 Ga0451790_09773
651 Ga0451794_17338
652 Ga0451791_0155811
653 Ga0451793_0001464
654 Ga0451797_0600456
655 Ga0451799_28643
656 Ga0451795_1080926
657 Ga0451800_1321425
658 Ga0451805_119048
659 Ga0451808_15803
660 Ga0451833_0219539
661 Ga0451833_1284551
662 Ga0451837_1375856
663 Ga0451837_1523156
664 Ga0451849_1564169
665 Ga0451843_0425488
666 Ga0451853_0187102
667 Ga0439463_119968
668 Ga0439459_0084820
669 Ga0439464_0238330
670 Ga0466957_0445270
671 Ga0466967_1931113
672 Ga0495638_0094528
673 Ga0495632_0035108
674 Ga0496124_0861559
675 Ga0501299_051296
676 Ga0501303_035894
677 Ga0501249_118580
678 Ga0501225_0136485
679 nmdc:mga06z11_782190_c1
680 nmdc:mga05p37_1382322_c1
681 nmdc:mga05p37_1643776_c1
682 Ga0500610_0427176
683 Ga0500644_0041613
684 Ga0500646_0013194
685 Ga0500651_0057331
686 Ga0500641_0018702
687 Ga0500650_0115115
688 Ga0500650_0153273
689 Ga0500555_049268
690 Ga0500556_0091266
691 Ga0500562_139144
692 Ga0500569_024460
693 Ga0500594_0077097
694 Ga0500614_226287
695 Ga0500652_019563
696 Ga0500658_0272501
697 Ga0500577_0106205
698 Ga0500579_016503
699 Ga0500600_0054648
700 Ga0500600_0192958
701 Ga0500622_0282090
702 Ga0500624_101549
703 Ga0500630_147272
704 Ga0500587_024214
705 Ga0587084_061285
706 Ga0587093_021902
707 Ga0587093_066706
708 Ga0587093_096751
709 Ga0587066_021923
710 Ga0587066_034334
711 Ga0587066_043695
712 Ga0587066_064421
713 Ga0587066_094879
714 Ga0587066_160251
715 Ga0587066_175528
716 Ga0587066_191423
717 Ga0587070_051531
718 Ga0587070_066084
719 Ga0587070_075507
720 Ga0587070_087985
721 Ga0587073_0037546
722 Ga0587073_0050442
723 Ga0587073_0088945
724 Ga0587073_0115765
725 Ga0587073_0121651
726 Ga0587073_0197903
727 Ga0587073_0205942
728 Ga0587073_0271825
729 Ga0587077_057555
730 Ga0587077_069448
731 Ga0587077_077280
732 Ga0587077_083089
733 Ga0587077_156778
734 Ga0587077_225536
735 Ga0587080_021292
736 Ga0587080_026032
737 Ga0587080_046736
738 Ga0587080_064477
739 Ga0587080_152044
740 Ga0587082_035517
741 Ga0587082_060519
742 Ga0587082_118335
743 Ga0587082_172357
744 Ga0587082_177288
745 Ga0587083_0048229
746 Ga0587083_0066654
747 Ga0587083_0100679
748 Ga0587083_0101292
749 Ga0587083_0196916
750 Ga0587085_019427
751 Ga0587085_037533
752 Ga0587085_049300
753 Ga0587086_024703
754 Ga0587086_033253
755 Ga0587086_042413
756 Ga0587086_074258
757 Ga0587086_097098
758 Ga0587088_044206
759 Ga0587088_083597
760 Ga0587088_098874
761 Ga0587088_112921
762 Ga0587088_127572
763 Ga0587089_041686
764 Ga0587089_056049
765 Ga0587089_082170
766 Ga0587089_100845
767 Ga0587090_025810
768 Ga0587090_073751
769 Ga0587091_034266
770 Ga0587091_042310
771 Ga0587091_044312
772 Ga0587091_046307
773 Ga0587091_115065
774 Ga0587091_150079
775 Ga0587091_181009
776 Ga0587091_198079
777 Ga0587092_048139
778 Ga0587092_077333
779 Ga0587092_096219
780 Ga0587094_030471
781 Ga0587095_021557
782 Ga0587097_07435
783 Ga0587098_041582
784 Ga0587098_058458
785 Ga0587106_046625
786 Ga0587106_063915
787 Ga0587106_091266
788 Ga0587106_108793
789 Ga0587106_113321
790 Ga0587106_165008
791 Ga0587125_018845
792 Ga0587125_043687
793 Ga0587129_030297
794 Ga0587099_030191
795 Ga0587099_051053
796 Ga0587101_058743
797 Ga0587101_065889
798 Ga0587101_081714
799 Ga0587101_128365
800 Ga0587109_061798
801 Ga0587109_068673
802 Ga0587109_119355
803 Ga0587109_135809
804 Ga0587113_012948
805 Ga0587113_034556
806 Ga0587113_037978
807 Ga0587115_011227
808 Ga0587115_032514
809 Ga0587115_032734
810 Ga0587115_036596
811 Ga0587115_058767
812 Ga0587117_045273
813 Ga0587117_049702
814 Ga0587117_073989
815 Ga0587117_079428
816 Ga0587117_097162
817 Ga0587122_054312
818 Ga0587122_060785
819 Ga0587127_022501
820 Ga0587127_022723
821 Ga0587127_024280
822 Ga0587127_026776
823 Ga0587128_041397
824 Ga0587128_135140
825 Ga0587130_022068
826 Ga0587130_029911
827 Ga0587130_054137
828 Ga0587062_042317
829 Ga0587062_044437
830 Ga0587062_065486
831 Ga0587062_068180
832 Ga0587062_102009
833 Ga0587062_122168
834 Ga0587062_124754
835 Ga0587067_039408
836 Ga0587067_081328
837 Ga0587067_101390
838 Ga0587067_125798
839 Ga0587067_177106
840 Ga0587067_195649
841 Ga0587068_058006
842 Ga0587068_077494
843 Ga0587068_118781
844 Ga0587068_127932
845 Ga0587069_024452
846 Ga0587069_040562
847 Ga0587069_070107
848 Ga0587069_146016
849 Ga0587069_150944
850 Ga0587072_063212
851 Ga0587072_078587
852 Ga0587072_098320
853 Ga0587072_111051
854 Ga0587072_123230
855 Ga0587072_182479
856 Ga0587075_021260
857 Ga0587075_031787
858 Ga0587075_034186
859 Ga0587075_035955
860 Ga0587075_097958
861 Ga0587075_114907
862 Ga0587075_116747
863 Ga0587076_050602
864 Ga0587076_072035
865 Ga0587076_108974
866 Ga0587078_025702
867 Ga0587078_038417
868 Ga0587078_042073
869 Ga0587078_055173
870 Ga0587078_060980
871 Ga0587079_022178
872 Ga0587079_029371
873 Ga0587079_047153
874 Ga0587079_056539
875 Ga0587079_065742
876 Ga0587079_101350
877 Ga0587079_152902
878 Ga0587100_011387
879 Ga0587100_034019
880 Ga0587102_042943
881 Ga0587102_043836
882 Ga0587104_015795
883 Ga0587104_016661
884 Ga0587104_018689
885 Ga0587105_012059
886 Ga0587107_020552
887 Ga0587107_035956
888 Ga0587107_071494
889 Ga0587108_030336
890 Ga0587110_016464
891 Ga0587110_059671
892 Ga0587114_073614
893 Ga0587114_074948
894 Ga0587114_111304
895 Ga0587118_08003
896 Ga0587119_022385
897 Ga0587119_042891
898 Ga0587119_047686
899 Ga0587119_060472
900 Ga0587119_064069
901 Ga0587119_070198
902 Ga0587119_078691
903 Ga0587124_008059
904 Ga0587060_015280
905 Ga0587060_024500
906 Ga0587096_05255
907 Ga0587071_024879
908 Ga0587071_028741
909 Ga0587071_066707
910 Ga0587071_068886
911 Ga0587071_093947
912 Ga0587071_139388
913 Ga0587071_159199
914 Ga0587071_189897
915 Ga0587111_0020575
916 Ga0587111_0034400
917 Ga0587111_0048634
918 Ga0587111_0079907
919 Ga0587111_0090790
920 Ga0587111_0114271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04149

DUF397

Domain of unknown function (DUF397)

24

78

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajo-assembly1.cif.gz_B negative-stain electron microscopy structure of ddb1-dcaf12-cct5 0.7726 24 51
8fgw-assembly1.cif.gz_B human ift-a complex structures provide molecular insights into ciliary transport 0.7602 22 50
3jb9-assembly1.cif.gz_U cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution 0.757 23 50
5oa1-assembly1.cif.gz_V rna polymerase i pre-initiation complex 0.7381 23 50
8ia0-assembly1.cif.gz_CC cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - state puf6 0.7339 24 50
ID Description Score Start End Superfamily
af_Q9VIG1_422_581_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8564 24 51 2.130.10.10
af_Q8H1R6_36_370_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8434 24 50 2.130.10.10
af_G5ECZ4_215_544_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8191 24 50 2.130.10.10
af_Q55CY0_160_539_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8113 24 50 2.130.10.10
af_X1WBQ1_2_178_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8038 22 48 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6I5F411-F1-model_v4 DUF397 domain-containing protein 0.9272 8 62
AF-A0A132NHL8-F1-model_v4 Putative DNA-binding protein 0.922 6 65 GO:0003677
AF-A0A3M2LQ41-F1-model_v4 DUF397 domain-containing protein 0.9214 7 63
AF-A0A7X6D4U2-F1-model_v4 DUF397 domain-containing protein 0.9162 6 66
AF-A0A7W8VG79-F1-model_v4 DUF397 domain-containing protein 0.9137 6 66

Map