F448164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 458 | 305 | 916 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10174770|Ga0075366_101747702 |
| Length | 248 |
| Sequence | MKKYLAKYLTIKVKLLSLPSLNGGIICLERSPTASMGTNNIKKMSGLIGKKVGMTSIFDDSGKNIPCTVIEAGPCVVTQVRSVDTDGYAAVQLAYGDKKEKNTSGPLKGHFLKAGTAPKRKLVEFKSFEDEKALGDTVTVDIFAEGDFVDVVGTSKGKGFQGVVKRHGFGGVGMQTHGQHNRLRAPGSLGASSWPSRVFKGMRMAGQMGNERVKVQNLEVLKVYTEQNLIVVKGSIPGAKGSFVIVDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 79 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 84 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 118 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 136 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 147 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 148 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 149 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 151 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 153 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 154 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 214 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 237 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 245 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 246 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 247 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 250 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 251 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 252 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 269 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 270 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 271 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 272 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 273 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 274 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 275 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 276 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 277 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 278 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 279 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 280 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 281 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 282 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 283 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 284 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 285 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 286 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 287 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 288 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 289 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 290 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 291 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 292 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 293 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 294 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 295 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 296 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 297 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 298 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 299 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 300 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 301 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 302 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 303 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 304 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 305 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.26 |
| Metatranscriptomes | 12.45 |
| Isolates | 8.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.33 |
| Nodule | 0 |
| Rhizoplane | 1.53 |
| Rhizosphere | 85.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075366_10174770 | 3300006195 | Bacteria | 1304 |
| 2 | MRS2a_Contig_1243 | 2124908027 | Bacteria | 1282 |
| 3 | SwRhRL2b_contig_843371 | 2162886007 | Bacteria | 4093 |
| 4 | JGI24740J21852_10008519 | 3300001979 | Bacteria | 4080 |
| 5 | JGI24737J22298_10001354 | 3300001990 | Bacteria | 8678 |
| 6 | JGI24737J22298_10027740 | 3300001990 | Bacteria | 1783 |
| 7 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 8 | JGI24735J21928_10039016 | 3300002067 | Bacteria | 1389 |
| 9 | JGI25150J39212_1000005 | 3300002774 | Bacteria | 311800 |
| 10 | JGI25151J46595_10000004 | 3300003187 | Bacteria | 494006 |
| 11 | JGI25153J46596_10000004 | 3300003215 | Bacteria | 494006 |
| 12 | Ga0007410J51695_1116531 | 3300003574 | Bacteria | 1306 |
| 13 | Ga0007416J51690_1093614 | 3300003577 | Bacteria | 947 |
| 14 | Ga0032354_1065046 | 3300003693 | Bacteria | 964 |
| 15 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 16 | Ga0055530_10000817 | 3300003791 | Bacteria | 25836 |
| 17 | Ga0058861_10042758 | 3300004800 | Bacteria | 1644 |
| 18 | Ga0058862_12875605 | 3300004803 | Bacteria | 1239 |
| 19 | Ga0065714_10231922 | 3300005288 | Bacteria | 815 |
| 20 | Ga0065704_10001893 | 3300005289 | Bacteria | 6314 |
| 21 | Ga0065704_10114480 | 3300005289 | Bacteria | 1890 |
| 22 | Ga0065715_10088958 | 3300005293 | Bacteria | 20336 |
| 23 | Ga0070677_10095535 | 3300005333 | Bacteria | 1301 |
| 24 | Ga0068869_100227367 | 3300005334 | Bacteria | 1481 |
| 25 | Ga0070680_100022246 | 3300005336 | Bacteria | 5046 |
| 26 | Ga0070689_100035813 | 3300005340 | Unclassified | 3793 |
| 27 | Ga0070675_100368516 | 3300005354 | Bacteria | 1277 |
| 28 | Ga0070674_100035773 | 3300005356 | Bacteria | 3328 |
| 29 | Ga0070673_100014202 | 3300005364 | Bacteria | 5536 |
| 30 | Ga0070688_100153700 | 3300005365 | Bacteria | 1575 |
| 31 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 32 | Ga0070701_10070312 | 3300005438 | Bacteria | 1870 |
| 33 | Ga0070681_10045491 | 3300005458 | Bacteria | 4391 |
| 34 | Ga0068867_100091048 | 3300005459 | Bacteria | 2315 |
| 35 | Ga0070707_100008779 | 3300005468 | Bacteria | 9374 |
| 36 | Ga0070707_100123542 | 3300005468 | Bacteria | 2514 |
| 37 | Ga0070698_100000139 | 3300005471 | Bacteria | 65079 |
| 38 | Ga0070697_100135804 | 3300005536 | Bacteria | 2065 |
| 39 | Ga0068853_100180041 | 3300005539 | Bacteria | 1916 |
| 40 | Ga0070693_100778808 | 3300005547 | Bacteria | 707 |
| 41 | Ga0068855_100062080 | 3300005563 | Bacteria | 4364 |
| 42 | Ga0068855_100287685 | 3300005563 | Bacteria | 1823 |
| 43 | Ga0068857_100236793 | 3300005577 | Bacteria | 1670 |
| 44 | Ga0068857_100244371 | 3300005577 | Bacteria | 1644 |
| 45 | Ga0068856_100001358 | 3300005614 | Bacteria | 25722 |
| 46 | Ga0068852_100027551 | 3300005616 | Bacteria | 4632 |
| 47 | Ga0068870_10245495 | 3300005840 | Bacteria | 1107 |
| 48 | Ga0081455_10294523 | 3300005937 | Bacteria | 1167 |
| 49 | Ga0081538_10058176 | 3300005981 | Bacteria | 2245 |
| 50 | Ga0075366_10063577 | 3300006195 | Bacteria | 2194 |
| 51 | Ga0097621_100416005 | 3300006237 | Bacteria | 1206 |
| 52 | Ga0075433_10006179 | 3300006852 | Bacteria | 9447 |
| 53 | Ga0075433_10154527 | 3300006852 | Bacteria | 2041 |
| 54 | Ga0075434_100003203 | 3300006871 | Bacteria | 14595 |
| 55 | Ga0105244_10013135 | 3300009036 | Bacteria | 4853 |
| 56 | Ga0105240_10082195 | 3300009093 | Bacteria | 3956 |
| 57 | Ga0105240_10224920 | 3300009093 | Bacteria | 2184 |
| 58 | Ga0105240_10250009 | 3300009093 | Bacteria | 2051 |
| 59 | Ga0105240_10477974 | 3300009093 | Bacteria | 1390 |
| 60 | Ga0105240_10842078 | 3300009093 | Bacteria | 991 |
| 61 | Ga0105240_11378122 | 3300009093 | Bacteria | 742 |
| 62 | Ga0111539_10655173 | 3300009094 | Bacteria | 1223 |
| 63 | Ga0105245_10284587 | 3300009098 | Bacteria | 1617 |
| 64 | Ga0105243_10000009 | 3300009148 | Bacteria | 354419 |
| 65 | Ga0105241_10005560 | 3300009174 | Bacteria | 9308 |
| 66 | Ga0105241_10071231 | 3300009174 | Bacteria | 2698 |
| 67 | Ga0105242_10019955 | 3300009176 | Bacteria | 5250 |
| 68 | Ga0105242_10848945 | 3300009176 | Bacteria | 908 |
| 69 | Ga0105237_10002553 | 3300009545 | Bacteria | 22488 |
| 70 | Ga0105237_10006561 | 3300009545 | Bacteria | 12869 |
| 71 | Ga0105237_10009296 | 3300009545 | Bacteria | 10532 |
| 72 | Ga0105237_10136819 | 3300009545 | Bacteria | 2444 |
| 73 | Ga0105237_10211780 | 3300009545 | Bacteria | 1938 |
| 74 | Ga0105237_10265013 | 3300009545 | Bacteria | 1721 |
| 75 | Ga0105238_10446044 | 3300009551 | Bacteria | 1291 |
| 76 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 77 | Ga0105239_10004149 | 3300010375 | Bacteria | 17397 |
| 78 | Ga0105239_10167733 | 3300010375 | Bacteria | 2455 |
| 79 | Ga0105239_11043212 | 3300010375 | Bacteria | 940 |
| 80 | Ga0105239_11843659 | 3300010375 | Bacteria | 701 |
| 81 | Ga0157373_10008448 | 3300013100 | Bacteria | 7646 |
| 82 | Ga0157373_10014264 | 3300013100 | Bacteria | 5829 |
| 83 | Ga0157373_10049369 | 3300013100 | Bacteria | 2999 |
| 84 | Ga0157373_10271928 | 3300013100 | Bacteria | 1199 |
| 85 | Ga0157371_10001664 | 3300013102 | Bacteria | 22687 |
| 86 | Ga0157371_10003367 | 3300013102 | Bacteria | 14536 |
| 87 | Ga0157371_10005650 | 3300013102 | Bacteria | 10499 |
| 88 | Ga0157371_10010104 | 3300013102 | Bacteria | 7378 |
| 89 | Ga0157371_10019660 | 3300013102 | Bacteria | 4976 |
| 90 | Ga0157371_10027271 | 3300013102 | Bacteria | 4144 |
| 91 | Ga0157370_10000084 | 3300013104 | Bacteria | 104159 |
| 92 | Ga0157370_10047165 | 3300013104 | Bacteria | 4130 |
| 93 | Ga0157370_10066433 | 3300013104 | Bacteria | 3411 |
| 94 | Ga0157370_10083652 | 3300013104 | Bacteria | 3000 |
| 95 | Ga0157370_10083711 | 3300013104 | Bacteria | 2999 |
| 96 | Ga0157370_10128866 | 3300013104 | Bacteria | 2361 |
| 97 | Ga0157370_10217174 | 3300013104 | Bacteria | 1772 |
| 98 | Ga0157370_10626293 | 3300013104 | Bacteria | 984 |
| 99 | Ga0157369_10000023 | 3300013105 | Bacteria | 226955 |
| 100 | Ga0157369_10004050 | 3300013105 | Bacteria | 17366 |
| 101 | Ga0157369_10007412 | 3300013105 | Bacteria | 12631 |
| 102 | Ga0157369_10011350 | 3300013105 | Bacteria | 10117 |
| 103 | Ga0157369_10117957 | 3300013105 | Bacteria | 2817 |
| 104 | Ga0157369_10304404 | 3300013105 | Bacteria | 1658 |
| 105 | Ga0157374_10027177 | 3300013296 | Bacteria | 5158 |
| 106 | Ga0157374_10075051 | 3300013296 | Bacteria | 3195 |
| 107 | Ga0157374_10255577 | 3300013296 | Bacteria | 1725 |
| 108 | Ga0157374_10514571 | 3300013296 | Bacteria | 1202 |
| 109 | Ga0157378_10009438 | 3300013297 | Bacteria | 8503 |
| 110 | Ga0157378_10041061 | 3300013297 | Bacteria | 4104 |
| 111 | Ga0157378_10069556 | 3300013297 | Bacteria | 3158 |
| 112 | Ga0163162_10001202 | 3300013306 | Bacteria | 24155 |
| 113 | Ga0163162_10002182 | 3300013306 | Bacteria | 18354 |
| 114 | Ga0163162_10049288 | 3300013306 | Bacteria | 4221 |
| 115 | Ga0157372_10000030 | 3300013307 | Bacteria | 179925 |
| 116 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 117 | Ga0157372_10028159 | 3300013307 | Bacteria | 6130 |
| 118 | Ga0157372_10052694 | 3300013307 | Bacteria | 4532 |
| 119 | Ga0157372_10067480 | 3300013307 | Bacteria | 4019 |
| 120 | Ga0157372_10096978 | 3300013307 | Bacteria | 3361 |
| 121 | Ga0157372_10202665 | 3300013307 | Bacteria | 2299 |
| 122 | Ga0157372_11284620 | 3300013307 | Bacteria | 845 |
| 123 | Ga0157375_10034701 | 3300013308 | Bacteria | 4808 |
| 124 | Ga0157375_10092834 | 3300013308 | Bacteria | 3083 |
| 125 | Ga0157375_10101632 | 3300013308 | Bacteria | 2958 |
| 126 | Ga0157375_10180919 | 3300013308 | Bacteria | 2259 |
| 127 | Ga0163163_10223642 | 3300014325 | Bacteria | 1931 |
| 128 | Ga0163163_11251937 | 3300014325 | Bacteria | 804 |
| 129 | Ga0182008_10000002 | 3300014497 | Bacteria | 480216 |
| 130 | Ga0182008_10000600 | 3300014497 | Bacteria | 26471 |
| 131 | Ga0182008_10005586 | 3300014497 | Bacteria | 7133 |
| 132 | Ga0182008_10465863 | 3300014497 | Bacteria | 689 |
| 133 | Ga0157377_10106714 | 3300014745 | Bacteria | 1678 |
| 134 | Ga0157377_10137918 | 3300014745 | Bacteria | 1496 |
| 135 | Ga0157379_10676461 | 3300014968 | Bacteria | 967 |
| 136 | Ga0157376_10387862 | 3300014969 | Bacteria | 1347 |
| 137 | Ga0182006_1000806 | 3300015261 | Bacteria | 21001 |
| 138 | Ga0182006_1024244 | 3300015261 | Bacteria | 2503 |
| 139 | Ga0182006_1038054 | 3300015261 | Bacteria | 1904 |
| 140 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 141 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 142 | Ga0163161_10002163 | 3300017792 | Bacteria | 14176 |
| 143 | Ga0163161_10284084 | 3300017792 | Bacteria | 1299 |
| 144 | Ga0163161_10777976 | 3300017792 | Bacteria | 803 |
| 145 | Ga0197907_10169535 | 3300020069 | Bacteria | 2472 |
| 146 | Ga0197907_10475699 | 3300020069 | Bacteria | 1783 |
| 147 | Ga0206356_11384705 | 3300020070 | Bacteria | 1041 |
| 148 | Ga0206349_1139351 | 3300020075 | Bacteria | 1786 |
| 149 | Ga0206355_1081006 | 3300020076 | Bacteria | 867 |
| 150 | Ga0206351_10170033 | 3300020077 | Bacteria | 10900 |
| 151 | Ga0206351_10512829 | 3300020077 | Bacteria | 15076 |
| 152 | Ga0206351_10535463 | 3300020077 | Bacteria | 891 |
| 153 | Ga0206350_10057460 | 3300020080 | Bacteria | 6432 |
| 154 | Ga0206350_10752456 | 3300020080 | Bacteria | 3060 |
| 155 | Ga0206354_11040595 | 3300020081 | Bacteria | 2110 |
| 156 | Ga0154015_1221621 | 3300020610 | Bacteria | 1743 |
| 157 | Ga0154015_1495562 | 3300020610 | Bacteria | 11881 |
| 158 | Ga0213874_10016241 | 3300021377 | Bacteria | 1978 |
| 159 | Ga0224712_10014571 | 3300022467 | Bacteria | 2536 |
| 160 | Ga0207425_1000008 | 3300025245 | Bacteria | 618024 |
| 161 | Ga0209129_1000040 | 3300025258 | Bacteria | 313043 |
| 162 | Ga0209233_1012915 | 3300025261 | Bacteria | 2404 |
| 163 | Ga0209455_1001523 | 3300025272 | Bacteria | 10351 |
| 164 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 165 | Ga0209025_1000020 | 3300025294 | Bacteria | 618024 |
| 166 | Ga0209758_1000022 | 3300025297 | Bacteria | 618024 |
| 167 | Ga0209050_1000048 | 3300025298 | Bacteria | 371553 |
| 168 | Ga0209051_1045041 | 3300025303 | Bacteria | 1531 |
| 169 | Ga0207655_1034177 | 3300025728 | Bacteria | 2289 |
| 170 | Ga0207647_10185681 | 3300025904 | Bacteria | 1206 |
| 171 | Ga0207654_10079744 | 3300025911 | Bacteria | 1967 |
| 172 | Ga0207654_10232303 | 3300025911 | Bacteria | 1229 |
| 173 | Ga0207654_10358612 | 3300025911 | Bacteria | 1005 |
| 174 | Ga0207707_10031720 | 3300025912 | Bacteria | 4625 |
| 175 | Ga0207695_10034063 | 3300025913 | Bacteria | 5546 |
| 176 | Ga0207695_10081967 | 3300025913 | Bacteria | 3263 |
| 177 | Ga0207695_11009569 | 3300025913 | Bacteria | 712 |
| 178 | Ga0207671_10005707 | 3300025914 | Bacteria | 11360 |
| 179 | Ga0207671_10016438 | 3300025914 | Bacteria | 5749 |
| 180 | Ga0207646_10043598 | 3300025922 | Bacteria | 4028 |
| 181 | Ga0207650_10685855 | 3300025925 | Bacteria | 865 |
| 182 | Ga0207659_10345408 | 3300025926 | Bacteria | 1233 |
| 183 | Ga0207687_10089938 | 3300025927 | Bacteria | 2236 |
| 184 | Ga0207687_10467095 | 3300025927 | Bacteria | 1049 |
| 185 | Ga0207690_10002170 | 3300025932 | Bacteria | 11970 |
| 186 | Ga0207706_10624386 | 3300025933 | Bacteria | 924 |
| 187 | Ga0207709_10000026 | 3300025935 | Bacteria | 354467 |
| 188 | Ga0207709_10046554 | 3300025935 | Bacteria | 2633 |
| 189 | Ga0207670_10574794 | 3300025936 | Bacteria | 923 |
| 190 | Ga0207669_10726307 | 3300025937 | Bacteria | 818 |
| 191 | Ga0207691_10065725 | 3300025940 | Bacteria | 3282 |
| 192 | Ga0207689_10351897 | 3300025942 | Bacteria | 1225 |
| 193 | Ga0207667_10106089 | 3300025949 | Bacteria | 2898 |
| 194 | Ga0207667_10189183 | 3300025949 | Bacteria | 2112 |
| 195 | Ga0207667_10945169 | 3300025949 | Bacteria | 852 |
| 196 | Ga0207678_10092160 | 3300026067 | Bacteria | 2590 |
| 197 | Ga0207702_10001407 | 3300026078 | Bacteria | 24021 |
| 198 | Ga0207674_10111233 | 3300026116 | Bacteria | 2713 |
| 199 | Ga0207674_10145777 | 3300026116 | Bacteria | 2326 |
| 200 | Ga0207674_10154132 | 3300026116 | Bacteria | 2253 |
| 201 | Ga0207683_10027584 | 3300026121 | Bacteria | 4906 |
| 202 | Ga0307515_10007084 | 3300028794 | Bacteria | 22272 |
| 203 | Ga0316176_1220529 | 3300030732 | Bacteria | 11720 |
| 204 | Ga0316183_1116825 | 3300030742 | Bacteria | 56435 |
| 205 | Ga0316181_1163475 | 3300030744 | Bacteria | 9442 |
| 206 | Ga0316181_1278947 | 3300030744 | Bacteria | 3255 |
| 207 | Ga0316182_1040405 | 3300030745 | Bacteria | 2152 |
| 208 | Ga0316182_1329782 | 3300030745 | Bacteria | 1154 |
| 209 | Ga0265316_10020371 | 3300031344 | Bacteria | 5646 |
| 210 | Ga0307509_10083314 | 3300031507 | Bacteria | 3297 |
| 211 | Ga0307408_100001588 | 3300031548 | Bacteria | 16776 |
| 212 | Ga0307408_100013046 | 3300031548 | Bacteria | 5512 |
| 213 | Ga0316576_10159181 | 3300031727 | Bacteria | 1703 |
| 214 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 215 | Ga0307405_10004590 | 3300031731 | Bacteria | 6553 |
| 216 | Ga0307407_10000003 | 3300031903 | Bacteria | 271723 |
| 217 | Ga0307412_10000085 | 3300031911 | Bacteria | 88692 |
| 218 | Ga0307412_10003826 | 3300031911 | Bacteria | 8370 |
| 219 | Ga0307412_10418719 | 3300031911 | Bacteria | 1095 |
| 220 | Ga0307409_100017984 | 3300031995 | Bacteria | 4732 |
| 221 | Ga0307409_100416635 | 3300031995 | Bacteria | 1287 |
| 222 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 223 | Ga0307414_10003085 | 3300032004 | Bacteria | 8845 |
| 224 | Ga0307414_10005613 | 3300032004 | Bacteria | 6919 |
| 225 | Ga0307414_10024602 | 3300032004 | Bacteria | 3843 |
| 226 | Ga0307414_10042461 | 3300032004 | Bacteria | 3090 |
| 227 | Ga0307414_10191471 | 3300032004 | Bacteria | 1655 |
| 228 | Ga0307411_10020538 | 3300032005 | Bacteria | 3844 |
| 229 | Ga0307411_10037313 | 3300032005 | Bacteria | 3055 |
| 230 | Ga0307415_100356188 | 3300032126 | Bacteria | 1234 |
| 231 | Ga0316587_1012842 | 3300033529 | Bacteria | 1366 |
| 232 | Ga0316596_1001212 | 3300033541 | Bacteria | 5086 |
| 233 | Ga0316574_0090687 | 3300035398 | Bacteria | 1948 |
| 234 | Ga0265778_020049 | 3300036457 | Bacteria | 821 |
| 235 | Ga0316582_0011844 | 3300036647 | Bacteria | 4840 |
| 236 | Ga0316582_0154988 | 3300036647 | Unclassified | 1550 |
| 237 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 238 | Ga0395899_0001602 | 3300037312 | Bacteria | 18978 |
| 239 | Ga0395899_0006152 | 3300037312 | Bacteria | 9303 |
| 240 | Ga0395900_0000346 | 3300037418 | Bacteria | 68020 |
| 241 | Ga0395900_0001482 | 3300037418 | Bacteria | 28015 |
| 242 | Ga0395900_0006693 | 3300037418 | Bacteria | 11974 |
| 243 | Ga0395900_0246964 | 3300037418 | Bacteria | 1788 |
| 244 | Ga0395900_0595500 | 3300037418 | Bacteria | 1046 |
| 245 | Ga0395898_0034336 | 3300037466 | Bacteria | 5056 |
| 246 | Ga0395898_0142638 | 3300037466 | Bacteria | 2293 |
| 247 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 248 | Ga0395905_0000528 | 3300037471 | Bacteria | 52404 |
| 249 | Ga0395905_0072091 | 3300037471 | Bacteria | 3238 |
| 250 | Ga0316581_0016800 | 3300037588 | Unclassified | 2105 |
| 251 | Ga0395901_0000351 | 3300038443 | Bacteria | 56004 |
| 252 | Ga0395901_0059478 | 3300038443 | Bacteria | 3975 |
| 253 | Ga0395901_0543057 | 3300038443 | Bacteria | 1179 |
| 254 | Ga0395901_1409034 | 3300038443 | Bacteria | 655 |
| 255 | Ga0436361_0986181 | 3300039447 | Bacteria | 4054 |
| 256 | Ga0436363_0295223 | 3300039450 | Bacteria | 2071 |
| 257 | Ga0451788_12913 | 3300041442 | Bacteria | 874 |
| 258 | Ga0451792_23573 | 3300041445 | Bacteria | 877 |
| 259 | Ga0451794_19467 | 3300041446 | Bacteria | 1641 |
| 260 | Ga0451795_0947176 | 3300041456 | Bacteria | 2993 |
| 261 | Ga0451805_112588 | 3300041461 | Bacteria | 648 |
| 262 | Ga0451807_0581933 | 3300041486 | Bacteria | 1559 |
| 263 | Ga0451855_1749242 | 3300041511 | Bacteria | 808 |
| 264 | Ga0439448_0046763 | 3300042005 | Bacteria | 1410 |
| 265 | Ga0439450_059290 | 3300042008 | Bacteria | 923 |
| 266 | Ga0451577_0140717 | 3300042876 | Bacteria | 2168 |
| 267 | Ga0466969_0035704 | 3300044656 | Bacteria | 2514 |
| 268 | Ga0466966_0001476 | 3300044684 | Bacteria | 15131 |
| 269 | Ga0466961_0045113 | 3300044693 | Bacteria | 2821 |
| 270 | Ga0453684_0023556 | 3300044712 | Bacteria | 9055 |
| 271 | Ga0453684_0806234 | 3300044712 | Unclassified | 1012 |
| 272 | Ga0466959_0127914 | 3300045049 | Bacteria | 1802 |
| 273 | Ga0466959_0145372 | 3300045049 | Bacteria | 1673 |
| 274 | Ga0451576_0019276 | 3300045051 | Bacteria | 7448 |
| 275 | Ga0451576_1129103 | 3300045051 | Bacteria | 820 |
| 276 | Ga0466958_0043675 | 3300045836 | Bacteria | 2700 |
| 277 | Ga0495627_009866 | 3300046453 | Bacteria | 3495 |
| 278 | Ga0495590_0072473 | 3300046457 | Bacteria | 1210 |
| 279 | Ga0495638_0089155 | 3300046460 | Bacteria | 1861 |
| 280 | Ga0495651_0068871 | 3300046462 | Bacteria | 2697 |
| 281 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 282 | Ga0495605_0148599 | 3300046474 | Bacteria | 1047 |
| 283 | Ga0495664_0419589 | 3300046477 | Bacteria | 803 |
| 284 | Ga0495585_0000476 | 3300046492 | Bacteria | 38316 |
| 285 | Ga0495585_0001907 | 3300046492 | Bacteria | 15677 |
| 286 | Ga0495585_0118280 | 3300046492 | Bacteria | 1404 |
| 287 | Ga0495596_0046855 | 3300046500 | Bacteria | 1697 |
| 288 | Ga0495596_0184096 | 3300046500 | Bacteria | 812 |
| 289 | Ga0495607_0080240 | 3300046501 | Bacteria | 1795 |
| 290 | Ga0495607_0113779 | 3300046501 | Bacteria | 1431 |
| 291 | Ga0495583_0085235 | 3300046506 | Bacteria | 1368 |
| 292 | Ga0495583_0190015 | 3300046506 | Bacteria | 838 |
| 293 | Ga0495606_0023436 | 3300046507 | Bacteria | 4472 |
| 294 | Ga0495606_0024036 | 3300046507 | Bacteria | 4403 |
| 295 | Ga0495606_0036258 | 3300046507 | Bacteria | 3361 |
| 296 | Ga0495606_0168585 | 3300046507 | Bacteria | 1272 |
| 297 | Ga0495610_0001849 | 3300046512 | Bacteria | 18351 |
| 298 | Ga0495616_0025587 | 3300046513 | Bacteria | 3151 |
| 299 | Ga0495618_0102321 | 3300046514 | Bacteria | 1834 |
| 300 | Ga0495618_0428721 | 3300046514 | Bacteria | 805 |
| 301 | Ga0495620_0056438 | 3300046515 | Bacteria | 1652 |
| 302 | Ga0495630_0542651 | 3300046517 | Bacteria | 892 |
| 303 | Ga0495631_0004390 | 3300046518 | Bacteria | 7515 |
| 304 | Ga0495631_0033241 | 3300046518 | Bacteria | 2318 |
| 305 | Ga0495632_0130057 | 3300046519 | Bacteria | 1172 |
| 306 | Ga0495637_0040010 | 3300046520 | Bacteria | 2020 |
| 307 | Ga0495637_0041918 | 3300046520 | Bacteria | 1961 |
| 308 | Ga0495637_0158018 | 3300046520 | Bacteria | 852 |
| 309 | Ga0495644_0079122 | 3300046523 | Bacteria | 1238 |
| 310 | Ga0495652_0473926 | 3300046529 | Bacteria | 872 |
| 311 | Ga0495652_0531369 | 3300046529 | Bacteria | 811 |
| 312 | Ga0495654_0091877 | 3300046530 | Bacteria | 1407 |
| 313 | Ga0495609_0017215 | 3300046538 | Bacteria | 3358 |
| 314 | Ga0495609_0022533 | 3300046538 | Bacteria | 2900 |
| 315 | Ga0495609_0027308 | 3300046538 | Bacteria | 2609 |
| 316 | Ga0495622_0111351 | 3300046557 | Bacteria | 1253 |
| 317 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 318 | Ga0495633_0115342 | 3300046558 | Bacteria | 1245 |
| 319 | Ga0495633_0119015 | 3300046558 | Bacteria | 1223 |
| 320 | Ga0495633_0256488 | 3300046558 | Bacteria | 797 |
| 321 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 322 | Ga0495611_0131612 | 3300046648 | Bacteria | 1167 |
| 323 | Ga0495625_0000308 | 3300046660 | Bacteria | 74661 |
| 324 | Ga0495625_0013495 | 3300046660 | Bacteria | 6562 |
| 325 | Ga0495625_0242905 | 3300046660 | Bacteria | 1171 |
| 326 | Ga0495635_0530275 | 3300046663 | Bacteria | 773 |
| 327 | Ga0495661_0065084 | 3300046665 | Bacteria | 2148 |
| 328 | Ga0495661_0323384 | 3300046665 | Bacteria | 766 |
| 329 | Ga0495646_0271356 | 3300046680 | Bacteria | 904 |
| 330 | Ga0495658_0076828 | 3300046683 | Bacteria | 1952 |
| 331 | Ga0495669_0053117 | 3300046684 | Bacteria | 1822 |
| 332 | Ga0495669_0246481 | 3300046684 | Bacteria | 858 |
| 333 | Ga0495670_0022047 | 3300046691 | Bacteria | 3145 |
| 334 | Ga0495670_0183300 | 3300046691 | Bacteria | 1106 |
| 335 | Ga0495671_0130335 | 3300046692 | Bacteria | 1226 |
| 336 | Ga0495649_0000105 | 3300046694 | Bacteria | 74750 |
| 337 | Ga0495589_0058652 | 3300046794 | Bacteria | 1893 |
| 338 | Ga0495660_0095929 | 3300046810 | Bacteria | 1533 |
| 339 | Ga0495660_0188987 | 3300046810 | Bacteria | 991 |
| 340 | Ga0495683_0073794 | 3300047323 | Bacteria | 1673 |
| 341 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 342 | Ga0495687_002320 | 3300047443 | Bacteria | 15506 |
| 343 | Ga0495677_0012602 | 3300047445 | Bacteria | 3081 |
| 344 | Ga0495679_021070 | 3300047446 | Bacteria | 2259 |
| 345 | Ga0495685_141527 | 3300047447 | Bacteria | 783 |
| 346 | Ga0495673_0060045 | 3300047469 | Bacteria | 1632 |
| 347 | Ga0495681_0060533 | 3300047470 | Bacteria | 1747 |
| 348 | Ga0495686_0004780 | 3300047472 | Bacteria | 10946 |
| 349 | Ga0495686_0009510 | 3300047472 | Bacteria | 6994 |
| 350 | Ga0495686_0042525 | 3300047472 | Bacteria | 2889 |
| 351 | Ga0495593_0188527 | 3300047673 | Bacteria | 1038 |
| 352 | Ga0496116_0019557 | 3300048919 | Bacteria | 5182 |
| 353 | Ga0496117_0001863 | 3300048920 | Bacteria | 28457 |
| 354 | Ga0496122_0000862 | 3300048925 | Bacteria | 57049 |
| 355 | Ga0496122_0008592 | 3300048925 | Bacteria | 10970 |
| 356 | Ga0496123_0014741 | 3300048926 | Bacteria | 6457 |
| 357 | Ga0496123_0020092 | 3300048926 | Bacteria | 5239 |
| 358 | Ga0496124_0052574 | 3300048927 | Bacteria | 3460 |
| 359 | Ga0496125_0075544 | 3300048928 | Bacteria | 2607 |
| 360 | Ga0496125_0348066 | 3300048928 | Bacteria | 886 |
| 361 | Ga0501343_004698 | 3300049132 | Bacteria | 1031 |
| 362 | Ga0501305_004136 | 3300049161 | Bacteria | 1689 |
| 363 | Ga0501305_034353 | 3300049161 | Bacteria | 803 |
| 364 | Ga0501307_018919 | 3300049162 | Bacteria | 879 |
| 365 | Ga0501307_036688 | 3300049162 | Bacteria | 699 |
| 366 | Ga0501312_027917 | 3300049528 | Bacteria | 873 |
| 367 | Ga0501316_021413 | 3300049532 | Bacteria | 817 |
| 368 | Ga0501317_029550 | 3300049533 | Bacteria | 788 |
| 369 | Ga0501318_005079 | 3300049534 | Bacteria | 1290 |
| 370 | Ga0501319_000490 | 3300049535 | Bacteria | 1906 |
| 371 | Ga0501323_004149 | 3300049539 | Bacteria | 1517 |
| 372 | Ga0501324_010908 | 3300049540 | Bacteria | 834 |
| 373 | Ga0501335_011303 | 3300049551 | Bacteria | 871 |
| 374 | Ga0501340_003372 | 3300049556 | Bacteria | 966 |
| 375 | Ga0501034_0017257 | 3300049571 | Bacteria | 7405 |
| 376 | Ga0501041_0056837 | 3300049577 | Bacteria | 2392 |
| 377 | Ga0501048_0051280 | 3300049582 | Bacteria | 2938 |
| 378 | Ga0501071_0070312 | 3300049587 | Bacteria | 2550 |
| 379 | Ga0501071_0268810 | 3300049587 | Bacteria | 1289 |
| 380 | Ga0501072_0344591 | 3300049588 | Bacteria | 1183 |
| 381 | Ga0501075_0555390 | 3300049591 | Bacteria | 876 |
| 382 | Ga0501076_0267173 | 3300049592 | Bacteria | 1401 |
| 383 | Ga0501076_0544252 | 3300049592 | Bacteria | 957 |
| 384 | Ga0501250_011545 | 3300049680 | Bacteria | 1031 |
| 385 | Ga0501252_011366 | 3300049682 | Bacteria | 1064 |
| 386 | Ga0501266_036556 | 3300049763 | Bacteria | 718 |
| 387 | Ga0501045_0477526 | 3300049824 | Bacteria | 926 |
| 388 | nmdc:mga0k408_10405_c1 | 3300050493 | Bacteria | 5030 |
| 389 | nmdc:mga0k408_349_c1 | 3300050493 | Bacteria | 23383 |
| 390 | nmdc:mga07m45_66618_c1 | 3300050496 | Bacteria | 2046 |
| 391 | nmdc:mga0n895_1534_c1 | 3300050512 | Bacteria | 17352 |
| 392 | nmdc:mga08x19_10642_c1 | 3300050514 | Bacteria | 5531 |
| 393 | Ga0500635_0004581 | 3300053080 | Bacteria | 3570 |
| 394 | Ga0500651_0000078 | 3300053093 | Bacteria | 62741 |
| 395 | Ga0500608_000343 | 3300053122 | Bacteria | 18061 |
| 396 | Ga0500608_004284 | 3300053122 | Bacteria | 5495 |
| 397 | Ga0500614_027799 | 3300053123 | Bacteria | 1362 |
| 398 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 399 | Ga0500622_0000385 | 3300053156 | Bacteria | 42685 |
| 400 | Ga0500624_000517 | 3300053157 | Bacteria | 11167 |
| 401 | Ga0500634_0069538 | 3300053161 | Bacteria | 1846 |
| 402 | Ga0500634_0129329 | 3300053161 | Bacteria | 1215 |
| 403 | Ga0587084_053289 | 3300059477 | Bacteria | 722 |
| 404 | Ga0587093_007268 | 3300059478 | Bacteria | 1230 |
| 405 | Ga0587066_009357 | 3300059490 | Bacteria | 1387 |
| 406 | Ga0587070_001969 | 3300059491 | Bacteria | 2243 |
| 407 | Ga0587070_019373 | 3300059491 | Bacteria | 1126 |
| 408 | Ga0587073_0030821 | 3300059492 | Bacteria | 1106 |
| 409 | Ga0587073_0054401 | 3300059492 | Bacteria | 918 |
| 410 | Ga0587077_008642 | 3300059493 | Bacteria | 1522 |
| 411 | Ga0587083_0002547 | 3300059505 | Bacteria | 2290 |
| 412 | Ga0587088_009558 | 3300059508 | Bacteria | 1399 |
| 413 | Ga0587092_037705 | 3300059512 | Bacteria | 829 |
| 414 | Ga0587094_004559 | 3300059513 | Bacteria | 1579 |
| 415 | Ga0587106_002077 | 3300059605 | Bacteria | 1911 |
| 416 | Ga0587062_004358 | 3300059639 | Bacteria | 1496 |
| 417 | Ga0587067_009616 | 3300059640 | Bacteria | 1446 |
| 418 | Ga0587076_073321 | 3300059645 | Bacteria | 715 |
| 419 | Ga0587107_029406 | 3300059652 | Bacteria | 827 |
| 420 | Ga0501082_0497085 | 3300060353 | Bacteria | 1066 |
| 421 | 2586210017 | 2585427687 | Bacteria | 5544917 |
| 422 | 2599479394 | 2599185184 | Bacteria | 6430550 |
| 423 | 2722726165 | 2721755487 | Bacteria | 6357185 |
| 424 | 2738755689 | 2738541283 | Bacteria | 7222293 |
| 425 | 2738762094 | 2738541284 | Bacteria | 5199923 |
| 426 | 2738854389 | 2738541302 | Bacteria | 5944758 |
| 427 | 2739301926 | 2738543023 | Bacteria | 6767879 |
| 428 | 2739614408 | 2739367656 | Bacteria | 5152243 |
| 429 | 2739646660 | 2739367663 | Bacteria | 5040914 |
| 430 | 2776615280 | 2775506987 | Bacteria | 5373360 |
| 431 | 2819545817 | 2818991437 | Bacteria | 5805520 |
| 432 | 2842724290 | 2842722452 | Bacteria | 6263924 |
| 433 | 2842908308 | 2842903701 | Bacteria | 6986368 |
| 434 | 2842913576 | 2842909656 | Bacteria | 6185908 |
| 435 | 2849282612 | 2849281842 | Bacteria | 6065644 |
| 436 | 2852625406 | 2852623160 | Bacteria | 4376875 |
| 437 | 2852629101 | 2852627209 | Bacteria | 5896285 |
| 438 | 2857631639 | 2857627736 | Bacteria | 5625397 |
| 439 | 2883072439 | 2883068021 | Bacteria | 6192739 |
| 440 | 2884934417 | 2884933994 | Bacteria | 4535041 |
| 441 | 2890807164 | 2890804823 | Bacteria | 3717572 |
| 442 | 2896346857 | 2896344016 | Bacteria | 3811746 |
| 443 | 2898716196 | 2898713307 | Bacteria | 4110805 |
| 444 | 2902051200 | 2902048731 | Bacteria | 4976191 |
| 445 | 2904449057 | 2904445276 | Bacteria | 5310396 |
| 446 | 2911143832 | 2911138879 | Bacteria | 5811561 |
| 447 | 2914763461 | 2914759650 | Bacteria | 4701441 |
| 448 | 2919189059 | 2919186247 | Bacteria | 6244071 |
| 449 | 2919438005 | 2919437846 | Bacteria | 6199444 |
| 450 | 2928082296 | 2928078545 | Bacteria | 6534839 |
| 451 | 2928149125 | 2928147474 | Bacteria | 6512076 |
| 452 | 2932085008 | 2932082852 | Bacteria | 6563563 |
| 453 | 2939666786 | 2939664404 | Bacteria | 6364494 |
| 454 | 2945998887 | 2945997725 | Bacteria | 6404843 |
| 455 | 2954021330 | 2954016120 | Bacteria | 6446024 |
| 456 | 2977235841 | 2977232053 | Bacteria | 5485925 |
| 457 | 3003236841 | 3003233435 | Bacteria | 4458031 |
| 458 | 8055591298 | 8055588893 | Bacteria | 3619545 |
| 459 | Ga0075366_10174770 | |||
| 460 | MRS2a_Contig_1243 | |||
| 461 | SwRhRL2b_contig_843371 | |||
| 462 | JGI24740J21852_10008519 | |||
| 463 | JGI24737J22298_10001354 | |||
| 464 | JGI24737J22298_10027740 | |||
| 465 | JGI24735J21928_10000003 | |||
| 466 | JGI24735J21928_10039016 | |||
| 467 | JGI25150J39212_1000005 | |||
| 468 | JGI25151J46595_10000004 | |||
| 469 | JGI25153J46596_10000004 | |||
| 470 | Ga0007410J51695_1116531 | |||
| 471 | Ga0007416J51690_1093614 | |||
| 472 | Ga0032354_1065046 | |||
| 473 | Ga0055536_1000004 | |||
| 474 | Ga0055530_10000817 | |||
| 475 | Ga0058861_10042758 | |||
| 476 | Ga0058862_12875605 | |||
| 477 | Ga0065714_10231922 | |||
| 478 | Ga0065704_10001893 | |||
| 479 | Ga0065704_10114480 | |||
| 480 | Ga0065715_10088958 | |||
| 481 | Ga0070677_10095535 | |||
| 482 | Ga0068869_100227367 | |||
| 483 | Ga0070680_100022246 | |||
| 484 | Ga0070689_100035813 | |||
| 485 | Ga0070675_100368516 | |||
| 486 | Ga0070674_100035773 | |||
| 487 | Ga0070673_100014202 | |||
| 488 | Ga0070688_100153700 | |||
| 489 | Ga0070659_100000375 | |||
| 490 | Ga0070701_10070312 | |||
| 491 | Ga0070681_10045491 | |||
| 492 | Ga0068867_100091048 | |||
| 493 | Ga0070707_100008779 | |||
| 494 | Ga0070707_100123542 | |||
| 495 | Ga0070698_100000139 | |||
| 496 | Ga0070697_100135804 | |||
| 497 | Ga0068853_100180041 | |||
| 498 | Ga0070693_100778808 | |||
| 499 | Ga0068855_100062080 | |||
| 500 | Ga0068855_100287685 | |||
| 501 | Ga0068857_100236793 | |||
| 502 | Ga0068857_100244371 | |||
| 503 | Ga0068856_100001358 | |||
| 504 | Ga0068852_100027551 | |||
| 505 | Ga0068870_10245495 | |||
| 506 | Ga0081455_10294523 | |||
| 507 | Ga0081538_10058176 | |||
| 508 | Ga0075366_10063577 | |||
| 509 | Ga0097621_100416005 | |||
| 510 | Ga0075433_10006179 | |||
| 511 | Ga0075433_10154527 | |||
| 512 | Ga0075434_100003203 | |||
| 513 | Ga0105244_10013135 | |||
| 514 | Ga0105240_10082195 | |||
| 515 | Ga0105240_10224920 | |||
| 516 | Ga0105240_10250009 | |||
| 517 | Ga0105240_10477974 | |||
| 518 | Ga0105240_10842078 | |||
| 519 | Ga0105240_11378122 | |||
| 520 | Ga0111539_10655173 | |||
| 521 | Ga0105245_10284587 | |||
| 522 | Ga0105243_10000009 | |||
| 523 | Ga0105241_10005560 | |||
| 524 | Ga0105241_10071231 | |||
| 525 | Ga0105242_10019955 | |||
| 526 | Ga0105242_10848945 | |||
| 527 | Ga0105237_10002553 | |||
| 528 | Ga0105237_10006561 | |||
| 529 | Ga0105237_10009296 | |||
| 530 | Ga0105237_10136819 | |||
| 531 | Ga0105237_10211780 | |||
| 532 | Ga0105237_10265013 | |||
| 533 | Ga0105238_10446044 | |||
| 534 | Ga0105239_10000011 | |||
| 535 | Ga0105239_10004149 | |||
| 536 | Ga0105239_10167733 | |||
| 537 | Ga0105239_11043212 | |||
| 538 | Ga0105239_11843659 | |||
| 539 | Ga0157373_10008448 | |||
| 540 | Ga0157373_10014264 | |||
| 541 | Ga0157373_10049369 | |||
| 542 | Ga0157373_10271928 | |||
| 543 | Ga0157371_10001664 | |||
| 544 | Ga0157371_10003367 | |||
| 545 | Ga0157371_10005650 | |||
| 546 | Ga0157371_10010104 | |||
| 547 | Ga0157371_10019660 | |||
| 548 | Ga0157371_10027271 | |||
| 549 | Ga0157370_10000084 | |||
| 550 | Ga0157370_10047165 | |||
| 551 | Ga0157370_10066433 | |||
| 552 | Ga0157370_10083652 | |||
| 553 | Ga0157370_10083711 | |||
| 554 | Ga0157370_10128866 | |||
| 555 | Ga0157370_10217174 | |||
| 556 | Ga0157370_10626293 | |||
| 557 | Ga0157369_10000023 | |||
| 558 | Ga0157369_10004050 | |||
| 559 | Ga0157369_10007412 | |||
| 560 | Ga0157369_10011350 | |||
| 561 | Ga0157369_10117957 | |||
| 562 | Ga0157369_10304404 | |||
| 563 | Ga0157374_10027177 | |||
| 564 | Ga0157374_10075051 | |||
| 565 | Ga0157374_10255577 | |||
| 566 | Ga0157374_10514571 | |||
| 567 | Ga0157378_10009438 | |||
| 568 | Ga0157378_10041061 | |||
| 569 | Ga0157378_10069556 | |||
| 570 | Ga0163162_10001202 | |||
| 571 | Ga0163162_10002182 | |||
| 572 | Ga0163162_10049288 | |||
| 573 | Ga0157372_10000030 | |||
| 574 | Ga0157372_10000332 | |||
| 575 | Ga0157372_10028159 | |||
| 576 | Ga0157372_10052694 | |||
| 577 | Ga0157372_10067480 | |||
| 578 | Ga0157372_10096978 | |||
| 579 | Ga0157372_10202665 | |||
| 580 | Ga0157372_11284620 | |||
| 581 | Ga0157375_10034701 | |||
| 582 | Ga0157375_10092834 | |||
| 583 | Ga0157375_10101632 | |||
| 584 | Ga0157375_10180919 | |||
| 585 | Ga0163163_10223642 | |||
| 586 | Ga0163163_11251937 | |||
| 587 | Ga0182008_10000002 | |||
| 588 | Ga0182008_10000600 | |||
| 589 | Ga0182008_10005586 | |||
| 590 | Ga0182008_10465863 | |||
| 591 | Ga0157377_10106714 | |||
| 592 | Ga0157377_10137918 | |||
| 593 | Ga0157379_10676461 | |||
| 594 | Ga0157376_10387862 | |||
| 595 | Ga0182006_1000806 | |||
| 596 | Ga0182006_1024244 | |||
| 597 | Ga0182006_1038054 | |||
| 598 | Ga0182007_10000002 | |||
| 599 | Ga0183373_1004 | |||
| 600 | Ga0163161_10002163 | |||
| 601 | Ga0163161_10284084 | |||
| 602 | Ga0163161_10777976 | |||
| 603 | Ga0197907_10169535 | |||
| 604 | Ga0197907_10475699 | |||
| 605 | Ga0206356_11384705 | |||
| 606 | Ga0206349_1139351 | |||
| 607 | Ga0206355_1081006 | |||
| 608 | Ga0206351_10170033 | |||
| 609 | Ga0206351_10512829 | |||
| 610 | Ga0206351_10535463 | |||
| 611 | Ga0206350_10057460 | |||
| 612 | Ga0206350_10752456 | |||
| 613 | Ga0206354_11040595 | |||
| 614 | Ga0154015_1221621 | |||
| 615 | Ga0154015_1495562 | |||
| 616 | Ga0213874_10016241 | |||
| 617 | Ga0224712_10014571 | |||
| 618 | Ga0207425_1000008 | |||
| 619 | Ga0209129_1000040 | |||
| 620 | Ga0209233_1012915 | |||
| 621 | Ga0209455_1001523 | |||
| 622 | Ga0209676_1000009 | |||
| 623 | Ga0209025_1000020 | |||
| 624 | Ga0209758_1000022 | |||
| 625 | Ga0209050_1000048 | |||
| 626 | Ga0209051_1045041 | |||
| 627 | Ga0207655_1034177 | |||
| 628 | Ga0207647_10185681 | |||
| 629 | Ga0207654_10079744 | |||
| 630 | Ga0207654_10232303 | |||
| 631 | Ga0207654_10358612 | |||
| 632 | Ga0207707_10031720 | |||
| 633 | Ga0207695_10034063 | |||
| 634 | Ga0207695_10081967 | |||
| 635 | Ga0207695_11009569 | |||
| 636 | Ga0207671_10005707 | |||
| 637 | Ga0207671_10016438 | |||
| 638 | Ga0207646_10043598 | |||
| 639 | Ga0207650_10685855 | |||
| 640 | Ga0207659_10345408 | |||
| 641 | Ga0207687_10089938 | |||
| 642 | Ga0207687_10467095 | |||
| 643 | Ga0207690_10002170 | |||
| 644 | Ga0207706_10624386 | |||
| 645 | Ga0207709_10000026 | |||
| 646 | Ga0207709_10046554 | |||
| 647 | Ga0207670_10574794 | |||
| 648 | Ga0207669_10726307 | |||
| 649 | Ga0207691_10065725 | |||
| 650 | Ga0207689_10351897 | |||
| 651 | Ga0207667_10106089 | |||
| 652 | Ga0207667_10189183 | |||
| 653 | Ga0207667_10945169 | |||
| 654 | Ga0207678_10092160 | |||
| 655 | Ga0207702_10001407 | |||
| 656 | Ga0207674_10111233 | |||
| 657 | Ga0207674_10145777 | |||
| 658 | Ga0207674_10154132 | |||
| 659 | Ga0207683_10027584 | |||
| 660 | Ga0307515_10007084 | |||
| 661 | Ga0316176_1220529 | |||
| 662 | Ga0316183_1116825 | |||
| 663 | Ga0316181_1163475 | |||
| 664 | Ga0316181_1278947 | |||
| 665 | Ga0316182_1040405 | |||
| 666 | Ga0316182_1329782 | |||
| 667 | Ga0265316_10020371 | |||
| 668 | Ga0307509_10083314 | |||
| 669 | Ga0307408_100001588 | |||
| 670 | Ga0307408_100013046 | |||
| 671 | Ga0316576_10159181 | |||
| 672 | Ga0307405_10000006 | |||
| 673 | Ga0307405_10004590 | |||
| 674 | Ga0307407_10000003 | |||
| 675 | Ga0307412_10000085 | |||
| 676 | Ga0307412_10003826 | |||
| 677 | Ga0307412_10418719 | |||
| 678 | Ga0307409_100017984 | |||
| 679 | Ga0307409_100416635 | |||
| 680 | Ga0307416_100000002 | |||
| 681 | Ga0307414_10003085 | |||
| 682 | Ga0307414_10005613 | |||
| 683 | Ga0307414_10024602 | |||
| 684 | Ga0307414_10042461 | |||
| 685 | Ga0307414_10191471 | |||
| 686 | Ga0307411_10020538 | |||
| 687 | Ga0307411_10037313 | |||
| 688 | Ga0307415_100356188 | |||
| 689 | Ga0316587_1012842 | |||
| 690 | Ga0316596_1001212 | |||
| 691 | Ga0316574_0090687 | |||
| 692 | Ga0265778_020049 | |||
| 693 | Ga0316582_0011844 | |||
| 694 | Ga0316582_0154988 | |||
| 695 | Ga0395899_0000034 | |||
| 696 | Ga0395899_0001602 | |||
| 697 | Ga0395899_0006152 | |||
| 698 | Ga0395900_0000346 | |||
| 699 | Ga0395900_0001482 | |||
| 700 | Ga0395900_0006693 | |||
| 701 | Ga0395900_0246964 | |||
| 702 | Ga0395900_0595500 | |||
| 703 | Ga0395898_0034336 | |||
| 704 | Ga0395898_0142638 | |||
| 705 | Ga0395905_0000001 | |||
| 706 | Ga0395905_0000528 | |||
| 707 | Ga0395905_0072091 | |||
| 708 | Ga0316581_0016800 | |||
| 709 | Ga0395901_0000351 | |||
| 710 | Ga0395901_0059478 | |||
| 711 | Ga0395901_0543057 | |||
| 712 | Ga0395901_1409034 | |||
| 713 | Ga0436361_0986181 | |||
| 714 | Ga0436363_0295223 | |||
| 715 | Ga0451788_12913 | |||
| 716 | Ga0451792_23573 | |||
| 717 | Ga0451794_19467 | |||
| 718 | Ga0451795_0947176 | |||
| 719 | Ga0451805_112588 | |||
| 720 | Ga0451807_0581933 | |||
| 721 | Ga0451855_1749242 | |||
| 722 | Ga0439448_0046763 | |||
| 723 | Ga0439450_059290 | |||
| 724 | Ga0451577_0140717 | |||
| 725 | Ga0466969_0035704 | |||
| 726 | Ga0466966_0001476 | |||
| 727 | Ga0466961_0045113 | |||
| 728 | Ga0453684_0023556 | |||
| 729 | Ga0453684_0806234 | |||
| 730 | Ga0466959_0127914 | |||
| 731 | Ga0466959_0145372 | |||
| 732 | Ga0451576_0019276 | |||
| 733 | Ga0451576_1129103 | |||
| 734 | Ga0466958_0043675 | |||
| 735 | Ga0495627_009866 | |||
| 736 | Ga0495590_0072473 | |||
| 737 | Ga0495638_0089155 | |||
| 738 | Ga0495651_0068871 | |||
| 739 | Ga0495650_0000023 | |||
| 740 | Ga0495605_0148599 | |||
| 741 | Ga0495664_0419589 | |||
| 742 | Ga0495585_0000476 | |||
| 743 | Ga0495585_0001907 | |||
| 744 | Ga0495585_0118280 | |||
| 745 | Ga0495596_0046855 | |||
| 746 | Ga0495596_0184096 | |||
| 747 | Ga0495607_0080240 | |||
| 748 | Ga0495607_0113779 | |||
| 749 | Ga0495583_0085235 | |||
| 750 | Ga0495583_0190015 | |||
| 751 | Ga0495606_0023436 | |||
| 752 | Ga0495606_0024036 | |||
| 753 | Ga0495606_0036258 | |||
| 754 | Ga0495606_0168585 | |||
| 755 | Ga0495610_0001849 | |||
| 756 | Ga0495616_0025587 | |||
| 757 | Ga0495618_0102321 | |||
| 758 | Ga0495618_0428721 | |||
| 759 | Ga0495620_0056438 | |||
| 760 | Ga0495630_0542651 | |||
| 761 | Ga0495631_0004390 | |||
| 762 | Ga0495631_0033241 | |||
| 763 | Ga0495632_0130057 | |||
| 764 | Ga0495637_0040010 | |||
| 765 | Ga0495637_0041918 | |||
| 766 | Ga0495637_0158018 | |||
| 767 | Ga0495644_0079122 | |||
| 768 | Ga0495652_0473926 | |||
| 769 | Ga0495652_0531369 | |||
| 770 | Ga0495654_0091877 | |||
| 771 | Ga0495609_0017215 | |||
| 772 | Ga0495609_0022533 | |||
| 773 | Ga0495609_0027308 | |||
| 774 | Ga0495622_0111351 | |||
| 775 | Ga0495633_0000072 | |||
| 776 | Ga0495633_0115342 | |||
| 777 | Ga0495633_0119015 | |||
| 778 | Ga0495633_0256488 | |||
| 779 | Ga0495668_0000165 | |||
| 780 | Ga0495611_0131612 | |||
| 781 | Ga0495625_0000308 | |||
| 782 | Ga0495625_0013495 | |||
| 783 | Ga0495625_0242905 | |||
| 784 | Ga0495635_0530275 | |||
| 785 | Ga0495661_0065084 | |||
| 786 | Ga0495661_0323384 | |||
| 787 | Ga0495646_0271356 | |||
| 788 | Ga0495658_0076828 | |||
| 789 | Ga0495669_0053117 | |||
| 790 | Ga0495669_0246481 | |||
| 791 | Ga0495670_0022047 | |||
| 792 | Ga0495670_0183300 | |||
| 793 | Ga0495671_0130335 | |||
| 794 | Ga0495649_0000105 | |||
| 795 | Ga0495589_0058652 | |||
| 796 | Ga0495660_0095929 | |||
| 797 | Ga0495660_0188987 | |||
| 798 | Ga0495683_0073794 | |||
| 799 | Ga0495687_000233 | |||
| 800 | Ga0495687_002320 | |||
| 801 | Ga0495677_0012602 | |||
| 802 | Ga0495679_021070 | |||
| 803 | Ga0495685_141527 | |||
| 804 | Ga0495673_0060045 | |||
| 805 | Ga0495681_0060533 | |||
| 806 | Ga0495686_0004780 | |||
| 807 | Ga0495686_0009510 | |||
| 808 | Ga0495686_0042525 | |||
| 809 | Ga0495593_0188527 | |||
| 810 | Ga0496116_0019557 | |||
| 811 | Ga0496117_0001863 | |||
| 812 | Ga0496122_0000862 | |||
| 813 | Ga0496122_0008592 | |||
| 814 | Ga0496123_0014741 | |||
| 815 | Ga0496123_0020092 | |||
| 816 | Ga0496124_0052574 | |||
| 817 | Ga0496125_0075544 | |||
| 818 | Ga0496125_0348066 | |||
| 819 | Ga0501343_004698 | |||
| 820 | Ga0501305_004136 | |||
| 821 | Ga0501305_034353 | |||
| 822 | Ga0501307_018919 | |||
| 823 | Ga0501307_036688 | |||
| 824 | Ga0501312_027917 | |||
| 825 | Ga0501316_021413 | |||
| 826 | Ga0501317_029550 | |||
| 827 | Ga0501318_005079 | |||
| 828 | Ga0501319_000490 | |||
| 829 | Ga0501323_004149 | |||
| 830 | Ga0501324_010908 | |||
| 831 | Ga0501335_011303 | |||
| 832 | Ga0501340_003372 | |||
| 833 | Ga0501034_0017257 | |||
| 834 | Ga0501041_0056837 | |||
| 835 | Ga0501048_0051280 | |||
| 836 | Ga0501071_0070312 | |||
| 837 | Ga0501071_0268810 | |||
| 838 | Ga0501072_0344591 | |||
| 839 | Ga0501075_0555390 | |||
| 840 | Ga0501076_0267173 | |||
| 841 | Ga0501076_0544252 | |||
| 842 | Ga0501250_011545 | |||
| 843 | Ga0501252_011366 | |||
| 844 | Ga0501266_036556 | |||
| 845 | Ga0501045_0477526 | |||
| 846 | nmdc:mga0k408_10405_c1 | |||
| 847 | nmdc:mga0k408_349_c1 | |||
| 848 | nmdc:mga07m45_66618_c1 | |||
| 849 | nmdc:mga0n895_1534_c1 | |||
| 850 | nmdc:mga08x19_10642_c1 | |||
| 851 | Ga0500635_0004581 | |||
| 852 | Ga0500651_0000078 | |||
| 853 | Ga0500608_000343 | |||
| 854 | Ga0500608_004284 | |||
| 855 | Ga0500614_027799 | |||
| 856 | Ga0500618_000005 | |||
| 857 | Ga0500622_0000385 | |||
| 858 | Ga0500624_000517 | |||
| 859 | Ga0500634_0069538 | |||
| 860 | Ga0500634_0129329 | |||
| 861 | Ga0587084_053289 | |||
| 862 | Ga0587093_007268 | |||
| 863 | Ga0587066_009357 | |||
| 864 | Ga0587070_001969 | |||
| 865 | Ga0587070_019373 | |||
| 866 | Ga0587073_0030821 | |||
| 867 | Ga0587073_0054401 | |||
| 868 | Ga0587077_008642 | |||
| 869 | Ga0587083_0002547 | |||
| 870 | Ga0587088_009558 | |||
| 871 | Ga0587092_037705 | |||
| 872 | Ga0587094_004559 | |||
| 873 | Ga0587106_002077 | |||
| 874 | Ga0587062_004358 | |||
| 875 | Ga0587067_009616 | |||
| 876 | Ga0587076_073321 | |||
| 877 | Ga0587107_029406 | |||
| 878 | Ga0501082_0497085 | |||
| 879 | 2586210017 | |||
| 880 | 2599479394 | |||
| 881 | 2722726165 | |||
| 882 | 2738755689 | |||
| 883 | 2738762094 | |||
| 884 | 2738854389 | |||
| 885 | 2739301926 | |||
| 886 | 2739614408 | |||
| 887 | 2739646660 | |||
| 888 | 2776615280 | |||
| 889 | 2819545817 | |||
| 890 | 2842724290 | |||
| 891 | 2842908308 | |||
| 892 | 2842913576 | |||
| 893 | 2849282612 | |||
| 894 | 2852625406 | |||
| 895 | 2852629101 | |||
| 896 | 2857631639 | |||
| 897 | 2883072439 | |||
| 898 | 2884934417 | |||
| 899 | 2890807164 | |||
| 900 | 2896346857 | |||
| 901 | 2898716196 | |||
| 902 | 2902051200 | |||
| 903 | 2904449057 | |||
| 904 | 2911143832 | |||
| 905 | 2914763461 | |||
| 906 | 2919189059 | |||
| 907 | 2919438005 | |||
| 908 | 2928082296 | |||
| 909 | 2928149125 | |||
| 910 | 2932085008 | |||
| 911 | 2939666786 | |||
| 912 | 2945998887 | |||
| 913 | 2954021330 | |||
| 914 | 2977235841 | |||
| 915 | 3003236841 | |||
| 916 | 8055591298 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9354 | 1 | 204 |
| 8c97-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.931 | 1 | 204 |
| 6pvk-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class a | 0.9184 | 2 | 205 |
| 6ppf-assembly1.cif.gz_D | bacterial 45srbga ribosomal particle class b | 0.9093 | 2 | 205 |
| 8c93-assembly1.cif.gz_D | cryo-em captures early ribosome assembly in action | 0.9078 | 1 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54I61_95_160_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9587 | 32 | 86 | 3.30.160.810 |
| 1vw3C01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors | 0.9359 | 1 | 205 | 2.40.30.10 |
| af_P60438_33_95_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.934 | 34 | 93 | 3.30.160.810 |
| af_Q2FW06_34_105_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9284 | 33 | 95 | 3.30.160.810 |
| af_Q9SKX4_88_148_3.30.160.810 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9187 | 33 | 91 | 3.30.160.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y1SZQ3-F1-model_v4 | 50S ribosomal protein L3 | 0.9684 | 1 | 119 |
GO:0003735
GO:0005840 GO:0006412 |
| AF-A0A7Y1SZQ3-F1-model_v4 | 50S ribosomal protein L3 | 0.9605 | 1 | 119 |
GO:0003735
GO:0005840 GO:0006412 |
| AF-A0A2V5X3H4-F1-model_v4 | 50S ribosomal protein L3 | 0.9577 | 1 | 117 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A2V5X3H4-F1-model_v4 | 50S ribosomal protein L3 | 0.9499 | 1 | 117 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A0G1QCC0-F1-model_v4 | Large ribosomal subunit protein uL3 (50S ribosomal protein L3) | 0.8735 | 2 | 205 |
GO:0003735
GO:0006412 GO:0022625 |