F448164

General Info

Members Datasets Scaffolds Average Seq Length
458 305 916 206

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10174770|Ga0075366_101747702
Length 248
Sequence MKKYLAKYLTIKVKLLSLPSLNGGIICLERSPTASMGTNNIKKMSGLIGKKVGMTSIFDDSGKNIPCTVIEAGPCVVTQVRSVDTDGYAAVQLAYGDKKEKNTSGPLKGHFLKAGTAPKRKLVEFKSFEDEKALGDTVTVDIFAEGDFVDVVGTSKGKGFQGVVKRHGFGGVGMQTHGQHNRLRAPGSLGASSWPSRVFKGMRMAGQMGNERVKVQNLEVLKVYTEQNLIVVKGSIPGAKGSFVIVDK

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
118 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
147 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
148 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
164 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
205 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
206 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
237 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
238 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
245 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
246 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
247 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
269 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
270 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
271 2738541283 Pedobacter sp. OK701 Isolate Unclassified
272 2738541284 Pedobacter sp. YR016 Isolate Unclassified
273 2738541302 Pedobacter sp. CF074 Isolate Unclassified
274 2738543023 Pedobacter sp. OK628 Isolate Unclassified
275 2739367656 Pedobacter sp. CF523 Isolate Unclassified
276 2739367663 Pedobacter sp. YR510 Isolate Unclassified
277 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
278 2818991437 Pedobacter terrae 518 Isolate Unclassified
279 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
280 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
281 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
282 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
283 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
284 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
285 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
286 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
287 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
288 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
289 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
290 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
291 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
292 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
293 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
294 2914759650 Rhizosphaericola mali Isolate Rhizosphere
295 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
296 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
297 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
298 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
299 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
300 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
301 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
302 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
303 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
304 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
305 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.26
Metatranscriptomes 12.45
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0
Rhizoplane 1.53
Rhizosphere 85.59
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10174770 3300006195 Bacteria 1304
2 MRS2a_Contig_1243 2124908027 Bacteria 1282
3 SwRhRL2b_contig_843371 2162886007 Bacteria 4093
4 JGI24740J21852_10008519 3300001979 Bacteria 4080
5 JGI24737J22298_10001354 3300001990 Bacteria 8678
6 JGI24737J22298_10027740 3300001990 Bacteria 1783
7 JGI24735J21928_10000003 3300002067 Bacteria 385983
8 JGI24735J21928_10039016 3300002067 Bacteria 1389
9 JGI25150J39212_1000005 3300002774 Bacteria 311800
10 JGI25151J46595_10000004 3300003187 Bacteria 494006
11 JGI25153J46596_10000004 3300003215 Bacteria 494006
12 Ga0007410J51695_1116531 3300003574 Bacteria 1306
13 Ga0007416J51690_1093614 3300003577 Bacteria 947
14 Ga0032354_1065046 3300003693 Bacteria 964
15 Ga0055536_1000004 3300003781 Bacteria 411108
16 Ga0055530_10000817 3300003791 Bacteria 25836
17 Ga0058861_10042758 3300004800 Bacteria 1644
18 Ga0058862_12875605 3300004803 Bacteria 1239
19 Ga0065714_10231922 3300005288 Bacteria 815
20 Ga0065704_10001893 3300005289 Bacteria 6314
21 Ga0065704_10114480 3300005289 Bacteria 1890
22 Ga0065715_10088958 3300005293 Bacteria 20336
23 Ga0070677_10095535 3300005333 Bacteria 1301
24 Ga0068869_100227367 3300005334 Bacteria 1481
25 Ga0070680_100022246 3300005336 Bacteria 5046
26 Ga0070689_100035813 3300005340 Unclassified 3793
27 Ga0070675_100368516 3300005354 Bacteria 1277
28 Ga0070674_100035773 3300005356 Bacteria 3328
29 Ga0070673_100014202 3300005364 Bacteria 5536
30 Ga0070688_100153700 3300005365 Bacteria 1575
31 Ga0070659_100000375 3300005366 Bacteria 33764
32 Ga0070701_10070312 3300005438 Bacteria 1870
33 Ga0070681_10045491 3300005458 Bacteria 4391
34 Ga0068867_100091048 3300005459 Bacteria 2315
35 Ga0070707_100008779 3300005468 Bacteria 9374
36 Ga0070707_100123542 3300005468 Bacteria 2514
37 Ga0070698_100000139 3300005471 Bacteria 65079
38 Ga0070697_100135804 3300005536 Bacteria 2065
39 Ga0068853_100180041 3300005539 Bacteria 1916
40 Ga0070693_100778808 3300005547 Bacteria 707
41 Ga0068855_100062080 3300005563 Bacteria 4364
42 Ga0068855_100287685 3300005563 Bacteria 1823
43 Ga0068857_100236793 3300005577 Bacteria 1670
44 Ga0068857_100244371 3300005577 Bacteria 1644
45 Ga0068856_100001358 3300005614 Bacteria 25722
46 Ga0068852_100027551 3300005616 Bacteria 4632
47 Ga0068870_10245495 3300005840 Bacteria 1107
48 Ga0081455_10294523 3300005937 Bacteria 1167
49 Ga0081538_10058176 3300005981 Bacteria 2245
50 Ga0075366_10063577 3300006195 Bacteria 2194
51 Ga0097621_100416005 3300006237 Bacteria 1206
52 Ga0075433_10006179 3300006852 Bacteria 9447
53 Ga0075433_10154527 3300006852 Bacteria 2041
54 Ga0075434_100003203 3300006871 Bacteria 14595
55 Ga0105244_10013135 3300009036 Bacteria 4853
56 Ga0105240_10082195 3300009093 Bacteria 3956
57 Ga0105240_10224920 3300009093 Bacteria 2184
58 Ga0105240_10250009 3300009093 Bacteria 2051
59 Ga0105240_10477974 3300009093 Bacteria 1390
60 Ga0105240_10842078 3300009093 Bacteria 991
61 Ga0105240_11378122 3300009093 Bacteria 742
62 Ga0111539_10655173 3300009094 Bacteria 1223
63 Ga0105245_10284587 3300009098 Bacteria 1617
64 Ga0105243_10000009 3300009148 Bacteria 354419
65 Ga0105241_10005560 3300009174 Bacteria 9308
66 Ga0105241_10071231 3300009174 Bacteria 2698
67 Ga0105242_10019955 3300009176 Bacteria 5250
68 Ga0105242_10848945 3300009176 Bacteria 908
69 Ga0105237_10002553 3300009545 Bacteria 22488
70 Ga0105237_10006561 3300009545 Bacteria 12869
71 Ga0105237_10009296 3300009545 Bacteria 10532
72 Ga0105237_10136819 3300009545 Bacteria 2444
73 Ga0105237_10211780 3300009545 Bacteria 1938
74 Ga0105237_10265013 3300009545 Bacteria 1721
75 Ga0105238_10446044 3300009551 Bacteria 1291
76 Ga0105239_10000011 3300010375 Bacteria 337500
77 Ga0105239_10004149 3300010375 Bacteria 17397
78 Ga0105239_10167733 3300010375 Bacteria 2455
79 Ga0105239_11043212 3300010375 Bacteria 940
80 Ga0105239_11843659 3300010375 Bacteria 701
81 Ga0157373_10008448 3300013100 Bacteria 7646
82 Ga0157373_10014264 3300013100 Bacteria 5829
83 Ga0157373_10049369 3300013100 Bacteria 2999
84 Ga0157373_10271928 3300013100 Bacteria 1199
85 Ga0157371_10001664 3300013102 Bacteria 22687
86 Ga0157371_10003367 3300013102 Bacteria 14536
87 Ga0157371_10005650 3300013102 Bacteria 10499
88 Ga0157371_10010104 3300013102 Bacteria 7378
89 Ga0157371_10019660 3300013102 Bacteria 4976
90 Ga0157371_10027271 3300013102 Bacteria 4144
91 Ga0157370_10000084 3300013104 Bacteria 104159
92 Ga0157370_10047165 3300013104 Bacteria 4130
93 Ga0157370_10066433 3300013104 Bacteria 3411
94 Ga0157370_10083652 3300013104 Bacteria 3000
95 Ga0157370_10083711 3300013104 Bacteria 2999
96 Ga0157370_10128866 3300013104 Bacteria 2361
97 Ga0157370_10217174 3300013104 Bacteria 1772
98 Ga0157370_10626293 3300013104 Bacteria 984
99 Ga0157369_10000023 3300013105 Bacteria 226955
100 Ga0157369_10004050 3300013105 Bacteria 17366
101 Ga0157369_10007412 3300013105 Bacteria 12631
102 Ga0157369_10011350 3300013105 Bacteria 10117
103 Ga0157369_10117957 3300013105 Bacteria 2817
104 Ga0157369_10304404 3300013105 Bacteria 1658
105 Ga0157374_10027177 3300013296 Bacteria 5158
106 Ga0157374_10075051 3300013296 Bacteria 3195
107 Ga0157374_10255577 3300013296 Bacteria 1725
108 Ga0157374_10514571 3300013296 Bacteria 1202
109 Ga0157378_10009438 3300013297 Bacteria 8503
110 Ga0157378_10041061 3300013297 Bacteria 4104
111 Ga0157378_10069556 3300013297 Bacteria 3158
112 Ga0163162_10001202 3300013306 Bacteria 24155
113 Ga0163162_10002182 3300013306 Bacteria 18354
114 Ga0163162_10049288 3300013306 Bacteria 4221
115 Ga0157372_10000030 3300013307 Bacteria 179925
116 Ga0157372_10000332 3300013307 Bacteria 51907
117 Ga0157372_10028159 3300013307 Bacteria 6130
118 Ga0157372_10052694 3300013307 Bacteria 4532
119 Ga0157372_10067480 3300013307 Bacteria 4019
120 Ga0157372_10096978 3300013307 Bacteria 3361
121 Ga0157372_10202665 3300013307 Bacteria 2299
122 Ga0157372_11284620 3300013307 Bacteria 845
123 Ga0157375_10034701 3300013308 Bacteria 4808
124 Ga0157375_10092834 3300013308 Bacteria 3083
125 Ga0157375_10101632 3300013308 Bacteria 2958
126 Ga0157375_10180919 3300013308 Bacteria 2259
127 Ga0163163_10223642 3300014325 Bacteria 1931
128 Ga0163163_11251937 3300014325 Bacteria 804
129 Ga0182008_10000002 3300014497 Bacteria 480216
130 Ga0182008_10000600 3300014497 Bacteria 26471
131 Ga0182008_10005586 3300014497 Bacteria 7133
132 Ga0182008_10465863 3300014497 Bacteria 689
133 Ga0157377_10106714 3300014745 Bacteria 1678
134 Ga0157377_10137918 3300014745 Bacteria 1496
135 Ga0157379_10676461 3300014968 Bacteria 967
136 Ga0157376_10387862 3300014969 Bacteria 1347
137 Ga0182006_1000806 3300015261 Bacteria 21001
138 Ga0182006_1024244 3300015261 Bacteria 2503
139 Ga0182006_1038054 3300015261 Bacteria 1904
140 Ga0182007_10000002 3300015262 Bacteria 564661
141 Ga0183373_1004 3300015682 Bacteria 537398
142 Ga0163161_10002163 3300017792 Bacteria 14176
143 Ga0163161_10284084 3300017792 Bacteria 1299
144 Ga0163161_10777976 3300017792 Bacteria 803
145 Ga0197907_10169535 3300020069 Bacteria 2472
146 Ga0197907_10475699 3300020069 Bacteria 1783
147 Ga0206356_11384705 3300020070 Bacteria 1041
148 Ga0206349_1139351 3300020075 Bacteria 1786
149 Ga0206355_1081006 3300020076 Bacteria 867
150 Ga0206351_10170033 3300020077 Bacteria 10900
151 Ga0206351_10512829 3300020077 Bacteria 15076
152 Ga0206351_10535463 3300020077 Bacteria 891
153 Ga0206350_10057460 3300020080 Bacteria 6432
154 Ga0206350_10752456 3300020080 Bacteria 3060
155 Ga0206354_11040595 3300020081 Bacteria 2110
156 Ga0154015_1221621 3300020610 Bacteria 1743
157 Ga0154015_1495562 3300020610 Bacteria 11881
158 Ga0213874_10016241 3300021377 Bacteria 1978
159 Ga0224712_10014571 3300022467 Bacteria 2536
160 Ga0207425_1000008 3300025245 Bacteria 618024
161 Ga0209129_1000040 3300025258 Bacteria 313043
162 Ga0209233_1012915 3300025261 Bacteria 2404
163 Ga0209455_1001523 3300025272 Bacteria 10351
164 Ga0209676_1000009 3300025292 Bacteria 981719
165 Ga0209025_1000020 3300025294 Bacteria 618024
166 Ga0209758_1000022 3300025297 Bacteria 618024
167 Ga0209050_1000048 3300025298 Bacteria 371553
168 Ga0209051_1045041 3300025303 Bacteria 1531
169 Ga0207655_1034177 3300025728 Bacteria 2289
170 Ga0207647_10185681 3300025904 Bacteria 1206
171 Ga0207654_10079744 3300025911 Bacteria 1967
172 Ga0207654_10232303 3300025911 Bacteria 1229
173 Ga0207654_10358612 3300025911 Bacteria 1005
174 Ga0207707_10031720 3300025912 Bacteria 4625
175 Ga0207695_10034063 3300025913 Bacteria 5546
176 Ga0207695_10081967 3300025913 Bacteria 3263
177 Ga0207695_11009569 3300025913 Bacteria 712
178 Ga0207671_10005707 3300025914 Bacteria 11360
179 Ga0207671_10016438 3300025914 Bacteria 5749
180 Ga0207646_10043598 3300025922 Bacteria 4028
181 Ga0207650_10685855 3300025925 Bacteria 865
182 Ga0207659_10345408 3300025926 Bacteria 1233
183 Ga0207687_10089938 3300025927 Bacteria 2236
184 Ga0207687_10467095 3300025927 Bacteria 1049
185 Ga0207690_10002170 3300025932 Bacteria 11970
186 Ga0207706_10624386 3300025933 Bacteria 924
187 Ga0207709_10000026 3300025935 Bacteria 354467
188 Ga0207709_10046554 3300025935 Bacteria 2633
189 Ga0207670_10574794 3300025936 Bacteria 923
190 Ga0207669_10726307 3300025937 Bacteria 818
191 Ga0207691_10065725 3300025940 Bacteria 3282
192 Ga0207689_10351897 3300025942 Bacteria 1225
193 Ga0207667_10106089 3300025949 Bacteria 2898
194 Ga0207667_10189183 3300025949 Bacteria 2112
195 Ga0207667_10945169 3300025949 Bacteria 852
196 Ga0207678_10092160 3300026067 Bacteria 2590
197 Ga0207702_10001407 3300026078 Bacteria 24021
198 Ga0207674_10111233 3300026116 Bacteria 2713
199 Ga0207674_10145777 3300026116 Bacteria 2326
200 Ga0207674_10154132 3300026116 Bacteria 2253
201 Ga0207683_10027584 3300026121 Bacteria 4906
202 Ga0307515_10007084 3300028794 Bacteria 22272
203 Ga0316176_1220529 3300030732 Bacteria 11720
204 Ga0316183_1116825 3300030742 Bacteria 56435
205 Ga0316181_1163475 3300030744 Bacteria 9442
206 Ga0316181_1278947 3300030744 Bacteria 3255
207 Ga0316182_1040405 3300030745 Bacteria 2152
208 Ga0316182_1329782 3300030745 Bacteria 1154
209 Ga0265316_10020371 3300031344 Bacteria 5646
210 Ga0307509_10083314 3300031507 Bacteria 3297
211 Ga0307408_100001588 3300031548 Bacteria 16776
212 Ga0307408_100013046 3300031548 Bacteria 5512
213 Ga0316576_10159181 3300031727 Bacteria 1703
214 Ga0307405_10000006 3300031731 Bacteria 361477
215 Ga0307405_10004590 3300031731 Bacteria 6553
216 Ga0307407_10000003 3300031903 Bacteria 271723
217 Ga0307412_10000085 3300031911 Bacteria 88692
218 Ga0307412_10003826 3300031911 Bacteria 8370
219 Ga0307412_10418719 3300031911 Bacteria 1095
220 Ga0307409_100017984 3300031995 Bacteria 4732
221 Ga0307409_100416635 3300031995 Bacteria 1287
222 Ga0307416_100000002 3300032002 Bacteria 509907
223 Ga0307414_10003085 3300032004 Bacteria 8845
224 Ga0307414_10005613 3300032004 Bacteria 6919
225 Ga0307414_10024602 3300032004 Bacteria 3843
226 Ga0307414_10042461 3300032004 Bacteria 3090
227 Ga0307414_10191471 3300032004 Bacteria 1655
228 Ga0307411_10020538 3300032005 Bacteria 3844
229 Ga0307411_10037313 3300032005 Bacteria 3055
230 Ga0307415_100356188 3300032126 Bacteria 1234
231 Ga0316587_1012842 3300033529 Bacteria 1366
232 Ga0316596_1001212 3300033541 Bacteria 5086
233 Ga0316574_0090687 3300035398 Bacteria 1948
234 Ga0265778_020049 3300036457 Bacteria 821
235 Ga0316582_0011844 3300036647 Bacteria 4840
236 Ga0316582_0154988 3300036647 Unclassified 1550
237 Ga0395899_0000034 3300037312 Bacteria 302623
238 Ga0395899_0001602 3300037312 Bacteria 18978
239 Ga0395899_0006152 3300037312 Bacteria 9303
240 Ga0395900_0000346 3300037418 Bacteria 68020
241 Ga0395900_0001482 3300037418 Bacteria 28015
242 Ga0395900_0006693 3300037418 Bacteria 11974
243 Ga0395900_0246964 3300037418 Bacteria 1788
244 Ga0395900_0595500 3300037418 Bacteria 1046
245 Ga0395898_0034336 3300037466 Bacteria 5056
246 Ga0395898_0142638 3300037466 Bacteria 2293
247 Ga0395905_0000001 3300037471 Bacteria 2037079
248 Ga0395905_0000528 3300037471 Bacteria 52404
249 Ga0395905_0072091 3300037471 Bacteria 3238
250 Ga0316581_0016800 3300037588 Unclassified 2105
251 Ga0395901_0000351 3300038443 Bacteria 56004
252 Ga0395901_0059478 3300038443 Bacteria 3975
253 Ga0395901_0543057 3300038443 Bacteria 1179
254 Ga0395901_1409034 3300038443 Bacteria 655
255 Ga0436361_0986181 3300039447 Bacteria 4054
256 Ga0436363_0295223 3300039450 Bacteria 2071
257 Ga0451788_12913 3300041442 Bacteria 874
258 Ga0451792_23573 3300041445 Bacteria 877
259 Ga0451794_19467 3300041446 Bacteria 1641
260 Ga0451795_0947176 3300041456 Bacteria 2993
261 Ga0451805_112588 3300041461 Bacteria 648
262 Ga0451807_0581933 3300041486 Bacteria 1559
263 Ga0451855_1749242 3300041511 Bacteria 808
264 Ga0439448_0046763 3300042005 Bacteria 1410
265 Ga0439450_059290 3300042008 Bacteria 923
266 Ga0451577_0140717 3300042876 Bacteria 2168
267 Ga0466969_0035704 3300044656 Bacteria 2514
268 Ga0466966_0001476 3300044684 Bacteria 15131
269 Ga0466961_0045113 3300044693 Bacteria 2821
270 Ga0453684_0023556 3300044712 Bacteria 9055
271 Ga0453684_0806234 3300044712 Unclassified 1012
272 Ga0466959_0127914 3300045049 Bacteria 1802
273 Ga0466959_0145372 3300045049 Bacteria 1673
274 Ga0451576_0019276 3300045051 Bacteria 7448
275 Ga0451576_1129103 3300045051 Bacteria 820
276 Ga0466958_0043675 3300045836 Bacteria 2700
277 Ga0495627_009866 3300046453 Bacteria 3495
278 Ga0495590_0072473 3300046457 Bacteria 1210
279 Ga0495638_0089155 3300046460 Bacteria 1861
280 Ga0495651_0068871 3300046462 Bacteria 2697
281 Ga0495650_0000023 3300046471 Bacteria 527763
282 Ga0495605_0148599 3300046474 Bacteria 1047
283 Ga0495664_0419589 3300046477 Bacteria 803
284 Ga0495585_0000476 3300046492 Bacteria 38316
285 Ga0495585_0001907 3300046492 Bacteria 15677
286 Ga0495585_0118280 3300046492 Bacteria 1404
287 Ga0495596_0046855 3300046500 Bacteria 1697
288 Ga0495596_0184096 3300046500 Bacteria 812
289 Ga0495607_0080240 3300046501 Bacteria 1795
290 Ga0495607_0113779 3300046501 Bacteria 1431
291 Ga0495583_0085235 3300046506 Bacteria 1368
292 Ga0495583_0190015 3300046506 Bacteria 838
293 Ga0495606_0023436 3300046507 Bacteria 4472
294 Ga0495606_0024036 3300046507 Bacteria 4403
295 Ga0495606_0036258 3300046507 Bacteria 3361
296 Ga0495606_0168585 3300046507 Bacteria 1272
297 Ga0495610_0001849 3300046512 Bacteria 18351
298 Ga0495616_0025587 3300046513 Bacteria 3151
299 Ga0495618_0102321 3300046514 Bacteria 1834
300 Ga0495618_0428721 3300046514 Bacteria 805
301 Ga0495620_0056438 3300046515 Bacteria 1652
302 Ga0495630_0542651 3300046517 Bacteria 892
303 Ga0495631_0004390 3300046518 Bacteria 7515
304 Ga0495631_0033241 3300046518 Bacteria 2318
305 Ga0495632_0130057 3300046519 Bacteria 1172
306 Ga0495637_0040010 3300046520 Bacteria 2020
307 Ga0495637_0041918 3300046520 Bacteria 1961
308 Ga0495637_0158018 3300046520 Bacteria 852
309 Ga0495644_0079122 3300046523 Bacteria 1238
310 Ga0495652_0473926 3300046529 Bacteria 872
311 Ga0495652_0531369 3300046529 Bacteria 811
312 Ga0495654_0091877 3300046530 Bacteria 1407
313 Ga0495609_0017215 3300046538 Bacteria 3358
314 Ga0495609_0022533 3300046538 Bacteria 2900
315 Ga0495609_0027308 3300046538 Bacteria 2609
316 Ga0495622_0111351 3300046557 Bacteria 1253
317 Ga0495633_0000072 3300046558 Bacteria 131197
318 Ga0495633_0115342 3300046558 Bacteria 1245
319 Ga0495633_0119015 3300046558 Bacteria 1223
320 Ga0495633_0256488 3300046558 Bacteria 797
321 Ga0495668_0000165 3300046616 Bacteria 98016
322 Ga0495611_0131612 3300046648 Bacteria 1167
323 Ga0495625_0000308 3300046660 Bacteria 74661
324 Ga0495625_0013495 3300046660 Bacteria 6562
325 Ga0495625_0242905 3300046660 Bacteria 1171
326 Ga0495635_0530275 3300046663 Bacteria 773
327 Ga0495661_0065084 3300046665 Bacteria 2148
328 Ga0495661_0323384 3300046665 Bacteria 766
329 Ga0495646_0271356 3300046680 Bacteria 904
330 Ga0495658_0076828 3300046683 Bacteria 1952
331 Ga0495669_0053117 3300046684 Bacteria 1822
332 Ga0495669_0246481 3300046684 Bacteria 858
333 Ga0495670_0022047 3300046691 Bacteria 3145
334 Ga0495670_0183300 3300046691 Bacteria 1106
335 Ga0495671_0130335 3300046692 Bacteria 1226
336 Ga0495649_0000105 3300046694 Bacteria 74750
337 Ga0495589_0058652 3300046794 Bacteria 1893
338 Ga0495660_0095929 3300046810 Bacteria 1533
339 Ga0495660_0188987 3300046810 Bacteria 991
340 Ga0495683_0073794 3300047323 Bacteria 1673
341 Ga0495687_000233 3300047443 Bacteria 77056
342 Ga0495687_002320 3300047443 Bacteria 15506
343 Ga0495677_0012602 3300047445 Bacteria 3081
344 Ga0495679_021070 3300047446 Bacteria 2259
345 Ga0495685_141527 3300047447 Bacteria 783
346 Ga0495673_0060045 3300047469 Bacteria 1632
347 Ga0495681_0060533 3300047470 Bacteria 1747
348 Ga0495686_0004780 3300047472 Bacteria 10946
349 Ga0495686_0009510 3300047472 Bacteria 6994
350 Ga0495686_0042525 3300047472 Bacteria 2889
351 Ga0495593_0188527 3300047673 Bacteria 1038
352 Ga0496116_0019557 3300048919 Bacteria 5182
353 Ga0496117_0001863 3300048920 Bacteria 28457
354 Ga0496122_0000862 3300048925 Bacteria 57049
355 Ga0496122_0008592 3300048925 Bacteria 10970
356 Ga0496123_0014741 3300048926 Bacteria 6457
357 Ga0496123_0020092 3300048926 Bacteria 5239
358 Ga0496124_0052574 3300048927 Bacteria 3460
359 Ga0496125_0075544 3300048928 Bacteria 2607
360 Ga0496125_0348066 3300048928 Bacteria 886
361 Ga0501343_004698 3300049132 Bacteria 1031
362 Ga0501305_004136 3300049161 Bacteria 1689
363 Ga0501305_034353 3300049161 Bacteria 803
364 Ga0501307_018919 3300049162 Bacteria 879
365 Ga0501307_036688 3300049162 Bacteria 699
366 Ga0501312_027917 3300049528 Bacteria 873
367 Ga0501316_021413 3300049532 Bacteria 817
368 Ga0501317_029550 3300049533 Bacteria 788
369 Ga0501318_005079 3300049534 Bacteria 1290
370 Ga0501319_000490 3300049535 Bacteria 1906
371 Ga0501323_004149 3300049539 Bacteria 1517
372 Ga0501324_010908 3300049540 Bacteria 834
373 Ga0501335_011303 3300049551 Bacteria 871
374 Ga0501340_003372 3300049556 Bacteria 966
375 Ga0501034_0017257 3300049571 Bacteria 7405
376 Ga0501041_0056837 3300049577 Bacteria 2392
377 Ga0501048_0051280 3300049582 Bacteria 2938
378 Ga0501071_0070312 3300049587 Bacteria 2550
379 Ga0501071_0268810 3300049587 Bacteria 1289
380 Ga0501072_0344591 3300049588 Bacteria 1183
381 Ga0501075_0555390 3300049591 Bacteria 876
382 Ga0501076_0267173 3300049592 Bacteria 1401
383 Ga0501076_0544252 3300049592 Bacteria 957
384 Ga0501250_011545 3300049680 Bacteria 1031
385 Ga0501252_011366 3300049682 Bacteria 1064
386 Ga0501266_036556 3300049763 Bacteria 718
387 Ga0501045_0477526 3300049824 Bacteria 926
388 nmdc:mga0k408_10405_c1 3300050493 Bacteria 5030
389 nmdc:mga0k408_349_c1 3300050493 Bacteria 23383
390 nmdc:mga07m45_66618_c1 3300050496 Bacteria 2046
391 nmdc:mga0n895_1534_c1 3300050512 Bacteria 17352
392 nmdc:mga08x19_10642_c1 3300050514 Bacteria 5531
393 Ga0500635_0004581 3300053080 Bacteria 3570
394 Ga0500651_0000078 3300053093 Bacteria 62741
395 Ga0500608_000343 3300053122 Bacteria 18061
396 Ga0500608_004284 3300053122 Bacteria 5495
397 Ga0500614_027799 3300053123 Bacteria 1362
398 Ga0500618_000005 3300053125 Bacteria 253092
399 Ga0500622_0000385 3300053156 Bacteria 42685
400 Ga0500624_000517 3300053157 Bacteria 11167
401 Ga0500634_0069538 3300053161 Bacteria 1846
402 Ga0500634_0129329 3300053161 Bacteria 1215
403 Ga0587084_053289 3300059477 Bacteria 722
404 Ga0587093_007268 3300059478 Bacteria 1230
405 Ga0587066_009357 3300059490 Bacteria 1387
406 Ga0587070_001969 3300059491 Bacteria 2243
407 Ga0587070_019373 3300059491 Bacteria 1126
408 Ga0587073_0030821 3300059492 Bacteria 1106
409 Ga0587073_0054401 3300059492 Bacteria 918
410 Ga0587077_008642 3300059493 Bacteria 1522
411 Ga0587083_0002547 3300059505 Bacteria 2290
412 Ga0587088_009558 3300059508 Bacteria 1399
413 Ga0587092_037705 3300059512 Bacteria 829
414 Ga0587094_004559 3300059513 Bacteria 1579
415 Ga0587106_002077 3300059605 Bacteria 1911
416 Ga0587062_004358 3300059639 Bacteria 1496
417 Ga0587067_009616 3300059640 Bacteria 1446
418 Ga0587076_073321 3300059645 Bacteria 715
419 Ga0587107_029406 3300059652 Bacteria 827
420 Ga0501082_0497085 3300060353 Bacteria 1066
421 2586210017 2585427687 Bacteria 5544917
422 2599479394 2599185184 Bacteria 6430550
423 2722726165 2721755487 Bacteria 6357185
424 2738755689 2738541283 Bacteria 7222293
425 2738762094 2738541284 Bacteria 5199923
426 2738854389 2738541302 Bacteria 5944758
427 2739301926 2738543023 Bacteria 6767879
428 2739614408 2739367656 Bacteria 5152243
429 2739646660 2739367663 Bacteria 5040914
430 2776615280 2775506987 Bacteria 5373360
431 2819545817 2818991437 Bacteria 5805520
432 2842724290 2842722452 Bacteria 6263924
433 2842908308 2842903701 Bacteria 6986368
434 2842913576 2842909656 Bacteria 6185908
435 2849282612 2849281842 Bacteria 6065644
436 2852625406 2852623160 Bacteria 4376875
437 2852629101 2852627209 Bacteria 5896285
438 2857631639 2857627736 Bacteria 5625397
439 2883072439 2883068021 Bacteria 6192739
440 2884934417 2884933994 Bacteria 4535041
441 2890807164 2890804823 Bacteria 3717572
442 2896346857 2896344016 Bacteria 3811746
443 2898716196 2898713307 Bacteria 4110805
444 2902051200 2902048731 Bacteria 4976191
445 2904449057 2904445276 Bacteria 5310396
446 2911143832 2911138879 Bacteria 5811561
447 2914763461 2914759650 Bacteria 4701441
448 2919189059 2919186247 Bacteria 6244071
449 2919438005 2919437846 Bacteria 6199444
450 2928082296 2928078545 Bacteria 6534839
451 2928149125 2928147474 Bacteria 6512076
452 2932085008 2932082852 Bacteria 6563563
453 2939666786 2939664404 Bacteria 6364494
454 2945998887 2945997725 Bacteria 6404843
455 2954021330 2954016120 Bacteria 6446024
456 2977235841 2977232053 Bacteria 5485925
457 3003236841 3003233435 Bacteria 4458031
458 8055591298 8055588893 Bacteria 3619545
459 Ga0075366_10174770
460 MRS2a_Contig_1243
461 SwRhRL2b_contig_843371
462 JGI24740J21852_10008519
463 JGI24737J22298_10001354
464 JGI24737J22298_10027740
465 JGI24735J21928_10000003
466 JGI24735J21928_10039016
467 JGI25150J39212_1000005
468 JGI25151J46595_10000004
469 JGI25153J46596_10000004
470 Ga0007410J51695_1116531
471 Ga0007416J51690_1093614
472 Ga0032354_1065046
473 Ga0055536_1000004
474 Ga0055530_10000817
475 Ga0058861_10042758
476 Ga0058862_12875605
477 Ga0065714_10231922
478 Ga0065704_10001893
479 Ga0065704_10114480
480 Ga0065715_10088958
481 Ga0070677_10095535
482 Ga0068869_100227367
483 Ga0070680_100022246
484 Ga0070689_100035813
485 Ga0070675_100368516
486 Ga0070674_100035773
487 Ga0070673_100014202
488 Ga0070688_100153700
489 Ga0070659_100000375
490 Ga0070701_10070312
491 Ga0070681_10045491
492 Ga0068867_100091048
493 Ga0070707_100008779
494 Ga0070707_100123542
495 Ga0070698_100000139
496 Ga0070697_100135804
497 Ga0068853_100180041
498 Ga0070693_100778808
499 Ga0068855_100062080
500 Ga0068855_100287685
501 Ga0068857_100236793
502 Ga0068857_100244371
503 Ga0068856_100001358
504 Ga0068852_100027551
505 Ga0068870_10245495
506 Ga0081455_10294523
507 Ga0081538_10058176
508 Ga0075366_10063577
509 Ga0097621_100416005
510 Ga0075433_10006179
511 Ga0075433_10154527
512 Ga0075434_100003203
513 Ga0105244_10013135
514 Ga0105240_10082195
515 Ga0105240_10224920
516 Ga0105240_10250009
517 Ga0105240_10477974
518 Ga0105240_10842078
519 Ga0105240_11378122
520 Ga0111539_10655173
521 Ga0105245_10284587
522 Ga0105243_10000009
523 Ga0105241_10005560
524 Ga0105241_10071231
525 Ga0105242_10019955
526 Ga0105242_10848945
527 Ga0105237_10002553
528 Ga0105237_10006561
529 Ga0105237_10009296
530 Ga0105237_10136819
531 Ga0105237_10211780
532 Ga0105237_10265013
533 Ga0105238_10446044
534 Ga0105239_10000011
535 Ga0105239_10004149
536 Ga0105239_10167733
537 Ga0105239_11043212
538 Ga0105239_11843659
539 Ga0157373_10008448
540 Ga0157373_10014264
541 Ga0157373_10049369
542 Ga0157373_10271928
543 Ga0157371_10001664
544 Ga0157371_10003367
545 Ga0157371_10005650
546 Ga0157371_10010104
547 Ga0157371_10019660
548 Ga0157371_10027271
549 Ga0157370_10000084
550 Ga0157370_10047165
551 Ga0157370_10066433
552 Ga0157370_10083652
553 Ga0157370_10083711
554 Ga0157370_10128866
555 Ga0157370_10217174
556 Ga0157370_10626293
557 Ga0157369_10000023
558 Ga0157369_10004050
559 Ga0157369_10007412
560 Ga0157369_10011350
561 Ga0157369_10117957
562 Ga0157369_10304404
563 Ga0157374_10027177
564 Ga0157374_10075051
565 Ga0157374_10255577
566 Ga0157374_10514571
567 Ga0157378_10009438
568 Ga0157378_10041061
569 Ga0157378_10069556
570 Ga0163162_10001202
571 Ga0163162_10002182
572 Ga0163162_10049288
573 Ga0157372_10000030
574 Ga0157372_10000332
575 Ga0157372_10028159
576 Ga0157372_10052694
577 Ga0157372_10067480
578 Ga0157372_10096978
579 Ga0157372_10202665
580 Ga0157372_11284620
581 Ga0157375_10034701
582 Ga0157375_10092834
583 Ga0157375_10101632
584 Ga0157375_10180919
585 Ga0163163_10223642
586 Ga0163163_11251937
587 Ga0182008_10000002
588 Ga0182008_10000600
589 Ga0182008_10005586
590 Ga0182008_10465863
591 Ga0157377_10106714
592 Ga0157377_10137918
593 Ga0157379_10676461
594 Ga0157376_10387862
595 Ga0182006_1000806
596 Ga0182006_1024244
597 Ga0182006_1038054
598 Ga0182007_10000002
599 Ga0183373_1004
600 Ga0163161_10002163
601 Ga0163161_10284084
602 Ga0163161_10777976
603 Ga0197907_10169535
604 Ga0197907_10475699
605 Ga0206356_11384705
606 Ga0206349_1139351
607 Ga0206355_1081006
608 Ga0206351_10170033
609 Ga0206351_10512829
610 Ga0206351_10535463
611 Ga0206350_10057460
612 Ga0206350_10752456
613 Ga0206354_11040595
614 Ga0154015_1221621
615 Ga0154015_1495562
616 Ga0213874_10016241
617 Ga0224712_10014571
618 Ga0207425_1000008
619 Ga0209129_1000040
620 Ga0209233_1012915
621 Ga0209455_1001523
622 Ga0209676_1000009
623 Ga0209025_1000020
624 Ga0209758_1000022
625 Ga0209050_1000048
626 Ga0209051_1045041
627 Ga0207655_1034177
628 Ga0207647_10185681
629 Ga0207654_10079744
630 Ga0207654_10232303
631 Ga0207654_10358612
632 Ga0207707_10031720
633 Ga0207695_10034063
634 Ga0207695_10081967
635 Ga0207695_11009569
636 Ga0207671_10005707
637 Ga0207671_10016438
638 Ga0207646_10043598
639 Ga0207650_10685855
640 Ga0207659_10345408
641 Ga0207687_10089938
642 Ga0207687_10467095
643 Ga0207690_10002170
644 Ga0207706_10624386
645 Ga0207709_10000026
646 Ga0207709_10046554
647 Ga0207670_10574794
648 Ga0207669_10726307
649 Ga0207691_10065725
650 Ga0207689_10351897
651 Ga0207667_10106089
652 Ga0207667_10189183
653 Ga0207667_10945169
654 Ga0207678_10092160
655 Ga0207702_10001407
656 Ga0207674_10111233
657 Ga0207674_10145777
658 Ga0207674_10154132
659 Ga0207683_10027584
660 Ga0307515_10007084
661 Ga0316176_1220529
662 Ga0316183_1116825
663 Ga0316181_1163475
664 Ga0316181_1278947
665 Ga0316182_1040405
666 Ga0316182_1329782
667 Ga0265316_10020371
668 Ga0307509_10083314
669 Ga0307408_100001588
670 Ga0307408_100013046
671 Ga0316576_10159181
672 Ga0307405_10000006
673 Ga0307405_10004590
674 Ga0307407_10000003
675 Ga0307412_10000085
676 Ga0307412_10003826
677 Ga0307412_10418719
678 Ga0307409_100017984
679 Ga0307409_100416635
680 Ga0307416_100000002
681 Ga0307414_10003085
682 Ga0307414_10005613
683 Ga0307414_10024602
684 Ga0307414_10042461
685 Ga0307414_10191471
686 Ga0307411_10020538
687 Ga0307411_10037313
688 Ga0307415_100356188
689 Ga0316587_1012842
690 Ga0316596_1001212
691 Ga0316574_0090687
692 Ga0265778_020049
693 Ga0316582_0011844
694 Ga0316582_0154988
695 Ga0395899_0000034
696 Ga0395899_0001602
697 Ga0395899_0006152
698 Ga0395900_0000346
699 Ga0395900_0001482
700 Ga0395900_0006693
701 Ga0395900_0246964
702 Ga0395900_0595500
703 Ga0395898_0034336
704 Ga0395898_0142638
705 Ga0395905_0000001
706 Ga0395905_0000528
707 Ga0395905_0072091
708 Ga0316581_0016800
709 Ga0395901_0000351
710 Ga0395901_0059478
711 Ga0395901_0543057
712 Ga0395901_1409034
713 Ga0436361_0986181
714 Ga0436363_0295223
715 Ga0451788_12913
716 Ga0451792_23573
717 Ga0451794_19467
718 Ga0451795_0947176
719 Ga0451805_112588
720 Ga0451807_0581933
721 Ga0451855_1749242
722 Ga0439448_0046763
723 Ga0439450_059290
724 Ga0451577_0140717
725 Ga0466969_0035704
726 Ga0466966_0001476
727 Ga0466961_0045113
728 Ga0453684_0023556
729 Ga0453684_0806234
730 Ga0466959_0127914
731 Ga0466959_0145372
732 Ga0451576_0019276
733 Ga0451576_1129103
734 Ga0466958_0043675
735 Ga0495627_009866
736 Ga0495590_0072473
737 Ga0495638_0089155
738 Ga0495651_0068871
739 Ga0495650_0000023
740 Ga0495605_0148599
741 Ga0495664_0419589
742 Ga0495585_0000476
743 Ga0495585_0001907
744 Ga0495585_0118280
745 Ga0495596_0046855
746 Ga0495596_0184096
747 Ga0495607_0080240
748 Ga0495607_0113779
749 Ga0495583_0085235
750 Ga0495583_0190015
751 Ga0495606_0023436
752 Ga0495606_0024036
753 Ga0495606_0036258
754 Ga0495606_0168585
755 Ga0495610_0001849
756 Ga0495616_0025587
757 Ga0495618_0102321
758 Ga0495618_0428721
759 Ga0495620_0056438
760 Ga0495630_0542651
761 Ga0495631_0004390
762 Ga0495631_0033241
763 Ga0495632_0130057
764 Ga0495637_0040010
765 Ga0495637_0041918
766 Ga0495637_0158018
767 Ga0495644_0079122
768 Ga0495652_0473926
769 Ga0495652_0531369
770 Ga0495654_0091877
771 Ga0495609_0017215
772 Ga0495609_0022533
773 Ga0495609_0027308
774 Ga0495622_0111351
775 Ga0495633_0000072
776 Ga0495633_0115342
777 Ga0495633_0119015
778 Ga0495633_0256488
779 Ga0495668_0000165
780 Ga0495611_0131612
781 Ga0495625_0000308
782 Ga0495625_0013495
783 Ga0495625_0242905
784 Ga0495635_0530275
785 Ga0495661_0065084
786 Ga0495661_0323384
787 Ga0495646_0271356
788 Ga0495658_0076828
789 Ga0495669_0053117
790 Ga0495669_0246481
791 Ga0495670_0022047
792 Ga0495670_0183300
793 Ga0495671_0130335
794 Ga0495649_0000105
795 Ga0495589_0058652
796 Ga0495660_0095929
797 Ga0495660_0188987
798 Ga0495683_0073794
799 Ga0495687_000233
800 Ga0495687_002320
801 Ga0495677_0012602
802 Ga0495679_021070
803 Ga0495685_141527
804 Ga0495673_0060045
805 Ga0495681_0060533
806 Ga0495686_0004780
807 Ga0495686_0009510
808 Ga0495686_0042525
809 Ga0495593_0188527
810 Ga0496116_0019557
811 Ga0496117_0001863
812 Ga0496122_0000862
813 Ga0496122_0008592
814 Ga0496123_0014741
815 Ga0496123_0020092
816 Ga0496124_0052574
817 Ga0496125_0075544
818 Ga0496125_0348066
819 Ga0501343_004698
820 Ga0501305_004136
821 Ga0501305_034353
822 Ga0501307_018919
823 Ga0501307_036688
824 Ga0501312_027917
825 Ga0501316_021413
826 Ga0501317_029550
827 Ga0501318_005079
828 Ga0501319_000490
829 Ga0501323_004149
830 Ga0501324_010908
831 Ga0501335_011303
832 Ga0501340_003372
833 Ga0501034_0017257
834 Ga0501041_0056837
835 Ga0501048_0051280
836 Ga0501071_0070312
837 Ga0501071_0268810
838 Ga0501072_0344591
839 Ga0501075_0555390
840 Ga0501076_0267173
841 Ga0501076_0544252
842 Ga0501250_011545
843 Ga0501252_011366
844 Ga0501266_036556
845 Ga0501045_0477526
846 nmdc:mga0k408_10405_c1
847 nmdc:mga0k408_349_c1
848 nmdc:mga07m45_66618_c1
849 nmdc:mga0n895_1534_c1
850 nmdc:mga08x19_10642_c1
851 Ga0500635_0004581
852 Ga0500651_0000078
853 Ga0500608_000343
854 Ga0500608_004284
855 Ga0500614_027799
856 Ga0500618_000005
857 Ga0500622_0000385
858 Ga0500624_000517
859 Ga0500634_0069538
860 Ga0500634_0129329
861 Ga0587084_053289
862 Ga0587093_007268
863 Ga0587066_009357
864 Ga0587070_001969
865 Ga0587070_019373
866 Ga0587073_0030821
867 Ga0587073_0054401
868 Ga0587077_008642
869 Ga0587083_0002547
870 Ga0587088_009558
871 Ga0587092_037705
872 Ga0587094_004559
873 Ga0587106_002077
874 Ga0587062_004358
875 Ga0587067_009616
876 Ga0587076_073321
877 Ga0587107_029406
878 Ga0501082_0497085
879 2586210017
880 2599479394
881 2722726165
882 2738755689
883 2738762094
884 2738854389
885 2739301926
886 2739614408
887 2739646660
888 2776615280
889 2819545817
890 2842724290
891 2842908308
892 2842913576
893 2849282612
894 2852625406
895 2852629101
896 2857631639
897 2883072439
898 2884934417
899 2890807164
900 2896346857
901 2898716196
902 2902051200
903 2904449057
904 2911143832
905 2914763461
906 2919189059
907 2919438005
908 2928082296
909 2928149125
910 2932085008
911 2939666786
912 2945998887
913 2954021330
914 2977235841
915 3003236841
916 8055591298

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00297

Ribosomal_L3

Ribosomal protein L3

112

229

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9354 1 204
8c97-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.931 1 204
6pvk-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class a 0.9184 2 205
6ppf-assembly1.cif.gz_D bacterial 45srbga ribosomal particle class b 0.9093 2 205
8c93-assembly1.cif.gz_D cryo-em captures early ribosome assembly in action 0.9078 1 204
ID Description Score Start End Superfamily
af_Q54I61_95_160_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9587 32 86 3.30.160.810
1vw3C01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9359 1 205 2.40.30.10
af_P60438_33_95_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.934 34 93 3.30.160.810
af_Q2FW06_34_105_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9284 33 95 3.30.160.810
af_Q9SKX4_88_148_3.30.160.810 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9187 33 91 3.30.160.810
ID Description Score Start End GO Terms
AF-A0A7Y1SZQ3-F1-model_v4 50S ribosomal protein L3 0.9684 1 119 GO:0003735
GO:0005840
GO:0006412
AF-A0A7Y1SZQ3-F1-model_v4 50S ribosomal protein L3 0.9605 1 119 GO:0003735
GO:0005840
GO:0006412
AF-A0A2V5X3H4-F1-model_v4 50S ribosomal protein L3 0.9577 1 117 GO:0003735
GO:0006412
GO:0022625
AF-A0A2V5X3H4-F1-model_v4 50S ribosomal protein L3 0.9499 1 117 GO:0003735
GO:0006412
GO:0022625
AF-A0A0G1QCC0-F1-model_v4 Large ribosomal subunit protein uL3 (50S ribosomal protein L3) 0.8735 2 205 GO:0003735
GO:0006412
GO:0022625

Map