F448142

General Info

Members Datasets Scaffolds Average Seq Length
458 196 916 159

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100015753|Ga0070708_1000157535
Length 168
Sequence VSGAAAALRGNRIAVYPGSFDPVTRGHEDLIRRSLAFVDRVVVAVAVNAAKQPLFTVEERLALLGEAVRGPGIEVQSFEGLLVNFARQVGAAVIVRGLRAVSDFEYEFQMALMNRHLDPKLETVFLVPAFDLTYLSSSLVREVARFGGDVSQLVHPAVHRALKAKFGT

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
104 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
120 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
124 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
125 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
126 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100015753 3300005445 Bacteria 6248
2 Ga0065715_10484552 3300005293 Bacteria 794
3 Ga0065707_10369261 3300005295 Bacteria 892
4 Ga0070676_10417359 3300005328 Bacteria 937
5 Ga0070677_10034553 3300005333 Bacteria 1954
6 Ga0068869_100782261 3300005334 Bacteria 819
7 Ga0070680_100030461 3300005336 Bacteria 4334
8 Ga0070680_100131476 3300005336 Bacteria 2094
9 Ga0070660_100453135 3300005339 Bacteria 1064
10 Ga0070660_100484416 3300005339 Bacteria 1028
11 Ga0070689_101240912 3300005340 Bacteria 670
12 Ga0070691_10131384 3300005341 Bacteria 1269
13 Ga0070661_100342646 3300005344 Bacteria 1171
14 Ga0070692_10010116 3300005345 Bacteria 4280
15 Ga0070671_100008393 3300005355 Bacteria 8279
16 Ga0070671_100023147 3300005355 Bacteria 5080
17 Ga0070674_100223277 3300005356 Bacteria 1467
18 Ga0070673_100642173 3300005364 Bacteria 971
19 Ga0070659_100487074 3300005366 Bacteria 1050
20 Ga0070703_10149937 3300005406 Bacteria 875
21 Ga0070703_10287549 3300005406 Bacteria 680
22 Ga0070709_10001038 3300005434 Bacteria 15360
23 Ga0070709_10002501 3300005434 Bacteria 9953
24 Ga0070709_10987862 3300005434 Bacteria 669
25 Ga0070714_100894393 3300005435 Bacteria 862
26 Ga0070713_100091051 3300005436 Bacteria 2623
27 Ga0070701_10003315 3300005438 Bacteria 6350
28 Ga0070711_100000466 3300005439 Bacteria 21169
29 Ga0070711_100148343 3300005439 Bacteria 1766
30 Ga0070711_100215049 3300005439 Bacteria 1491
31 Ga0070705_100001094 3300005440 Bacteria 15037
32 Ga0070705_100012339 3300005440 Bacteria 4341
33 Ga0070705_100019381 3300005440 Bacteria 3581
34 Ga0070705_100072948 3300005440 Bacteria 2081
35 Ga0070705_100961998 3300005440 Bacteria 691
36 Ga0070705_101249170 3300005440 Bacteria 614
37 Ga0070700_100016340 3300005441 Bacteria 4227
38 Ga0070694_100006594 3300005444 Bacteria 7053
39 Ga0070694_100016514 3300005444 Bacteria 4646
40 Ga0070694_100016538 3300005444 Bacteria 4644
41 Ga0070694_100019721 3300005444 Bacteria 4291
42 Ga0070694_100149255 3300005444 Bacteria 1706
43 Ga0070694_100268073 3300005444 Bacteria 1297
44 Ga0070694_100722560 3300005444 Bacteria 811
45 Ga0070708_100001912 3300005445 Bacteria 16029
46 Ga0070708_100010515 3300005445 Bacteria 7502
47 Ga0070708_100031040 3300005445 Bacteria 4623
48 Ga0070708_100121143 3300005445 Bacteria 2413
49 Ga0070708_100254086 3300005445 Bacteria 1651
50 Ga0070708_100614130 3300005445 Bacteria 1025
51 Ga0070708_101046884 3300005445 Bacteria 765
52 Ga0068867_100010994 3300005459 Bacteria 6381
53 Ga0068867_100427932 3300005459 Bacteria 1123
54 Ga0070706_100002003 3300005467 Bacteria 20963
55 Ga0070706_100011664 3300005467 Bacteria 8163
56 Ga0070706_100028410 3300005467 Bacteria 5149
57 Ga0070706_100209801 3300005467 Bacteria 1819
58 Ga0070706_100862871 3300005467 Bacteria 837
59 Ga0070707_100010873 3300005468 Bacteria 8477
60 Ga0070707_100020493 3300005468 Bacteria 6238
61 Ga0070707_100068391 3300005468 Bacteria 3418
62 Ga0070707_100153970 3300005468 Bacteria 2239
63 Ga0070707_100283258 3300005468 Bacteria 1610
64 Ga0070707_100370144 3300005468 Bacteria 1392
65 Ga0070707_100375411 3300005468 Bacteria 1381
66 Ga0070707_100702309 3300005468 Bacteria 974
67 Ga0070698_100000416 3300005471 Bacteria 45414
68 Ga0070698_100062922 3300005471 Bacteria 3743
69 Ga0070698_100385285 3300005471 Bacteria 1335
70 Ga0070698_100527815 3300005471 Bacteria 1119
71 Ga0070698_101089795 3300005471 Bacteria 747
72 Ga0070698_101304589 3300005471 Bacteria 676
73 Ga0070699_100012620 3300005518 Bacteria 7287
74 Ga0070699_100026193 3300005518 Bacteria 5030
75 Ga0070699_100140260 3300005518 Bacteria 2134
76 Ga0070699_100167136 3300005518 Bacteria 1949
77 Ga0070699_100241053 3300005518 Bacteria 1614
78 Ga0070699_100321493 3300005518 Bacteria 1391
79 Ga0070699_100734725 3300005518 Bacteria 902
80 Ga0070699_100832269 3300005518 Bacteria 845
81 Ga0070684_100354898 3300005535 Bacteria 1349
82 Ga0070697_100012367 3300005536 Bacteria 6687
83 Ga0070697_100013876 3300005536 Bacteria 6324
84 Ga0070697_100018326 3300005536 Bacteria 5519
85 Ga0070697_100050051 3300005536 Bacteria 3391
86 Ga0070697_100120583 3300005536 Bacteria 2193
87 Ga0070697_100123649 3300005536 Bacteria 2166
88 Ga0070697_100193144 3300005536 Bacteria 1728
89 Ga0070697_100197734 3300005536 Bacteria 1708
90 Ga0070697_100303329 3300005536 Bacteria 1373
91 Ga0068853_101985950 3300005539 Bacteria 564
92 Ga0070695_100014538 3300005545 Bacteria 4746
93 Ga0070695_100015608 3300005545 Bacteria 4586
94 Ga0070695_100060377 3300005545 Bacteria 2457
95 Ga0070695_100097399 3300005545 Bacteria 1975
96 Ga0070696_100029940 3300005546 Bacteria 3723
97 Ga0070696_100110869 3300005546 Bacteria 1976
98 Ga0070696_100153055 3300005546 Bacteria 1694
99 Ga0070696_100325999 3300005546 Bacteria 1183
100 Ga0070696_100394107 3300005546 Bacteria 1082
101 Ga0070704_100003470 3300005549 Bacteria 9046
102 Ga0070704_100007397 3300005549 Bacteria 6536
103 Ga0070704_100041422 3300005549 Bacteria 3178
104 Ga0070704_100051432 3300005549 Bacteria 2901
105 Ga0070704_100074862 3300005549 Bacteria 2471
106 Ga0070704_100125452 3300005549 Bacteria 1980
107 Ga0070704_100148212 3300005549 Bacteria 1841
108 Ga0070704_100164370 3300005549 Bacteria 1758
109 Ga0070704_100455942 3300005549 Bacteria 1102
110 Ga0070702_100130069 3300005615 Bacteria 1588
111 Ga0068859_100145629 3300005617 Bacteria 2444
112 Ga0068859_100408911 3300005617 Bacteria 1453
113 Ga0068864_100038902 3300005618 Bacteria 4064
114 Ga0068858_100177651 3300005842 Bacteria 2009
115 Ga0070716_100015084 3300006173 Bacteria 3966
116 Ga0070716_100090533 3300006173 Bacteria 1850
117 Ga0070712_100012458 3300006175 Bacteria 5407
118 Ga0070712_100433270 3300006175 Bacteria 1092
119 Ga0097621_100847500 3300006237 Bacteria 849
120 Ga0075428_101206135 3300006844 Bacteria 798
121 Ga0075430_100003192 3300006846 Bacteria 13741
122 Ga0075430_100013015 3300006846 Bacteria 7091
123 Ga0075430_100013975 3300006846 Bacteria 6843
124 Ga0075430_100175908 3300006846 Bacteria 1780
125 Ga0075430_100468978 3300006846 Bacteria 1039
126 Ga0075431_100018581 3300006847 Bacteria 7082
127 Ga0075431_100024864 3300006847 Bacteria 6141
128 Ga0075431_100040068 3300006847 Bacteria 4828
129 Ga0075431_100045255 3300006847 Bacteria 4537
130 Ga0075431_100135269 3300006847 Bacteria 2541
131 Ga0075431_100400289 3300006847 Bacteria 1374
132 Ga0075431_100531926 3300006847 Bacteria 1164
133 Ga0075433_10002882 3300006852 Bacteria 13184
134 Ga0075433_10005522 3300006852 Bacteria 9925
135 Ga0075433_10031658 3300006852 Bacteria 4522
136 Ga0075433_10062789 3300006852 Bacteria 3253
137 Ga0075433_10075783 3300006852 Bacteria 2961
138 Ga0075433_10162312 3300006852 Bacteria 1989
139 Ga0075433_10181006 3300006852 Bacteria 1875
140 Ga0075433_10209841 3300006852 Bacteria 1731
141 Ga0075433_10911131 3300006852 Bacteria 767
142 Ga0075434_100000352 3300006871 Bacteria 33380
143 Ga0075434_100008943 3300006871 Bacteria 9328
144 Ga0075434_100015336 3300006871 Bacteria 7343
145 Ga0075434_100019680 3300006871 Bacteria 6533
146 Ga0075434_100027707 3300006871 Bacteria 5563
147 Ga0075434_100035018 3300006871 Bacteria 4963
148 Ga0075434_100103786 3300006871 Bacteria 2851
149 Ga0075434_100178585 3300006871 Bacteria 2143
150 Ga0075434_100205350 3300006871 Bacteria 1990
151 Ga0075434_100287471 3300006871 Bacteria 1664
152 Ga0075434_101072645 3300006871 Bacteria 819
153 Ga0075429_100010311 3300006880 Bacteria 8084
154 Ga0075429_100066997 3300006880 Bacteria 3125
155 Ga0075429_100280541 3300006880 Unclassified 1459
156 Ga0075429_100353940 3300006880 Unclassified 1286
157 Ga0075436_100010736 3300006914 Bacteria 6282
158 Ga0075436_100025925 3300006914 Bacteria 4036
159 Ga0075436_100105260 3300006914 Bacteria 1967
160 Ga0075436_100115556 3300006914 Bacteria 1875
161 Ga0075436_100154632 3300006914 Bacteria 1615
162 Ga0075436_100238145 3300006914 Bacteria 1294
163 Ga0075436_100246777 3300006914 Bacteria 1271
164 Ga0075436_100263656 3300006914 Bacteria 1229
165 Ga0097620_100145630 3300006931 Bacteria 2444
166 Ga0097620_100408964 3300006931 Bacteria 1453
167 Ga0075435_100010505 3300007076 Bacteria 6771
168 Ga0075435_100012395 3300007076 Bacteria 6310
169 Ga0075435_100026546 3300007076 Bacteria 4520
170 Ga0075435_100068067 3300007076 Bacteria 2900
171 Ga0075435_100114988 3300007076 Bacteria 2240
172 Ga0075435_100144224 3300007076 Bacteria 1999
173 Ga0075435_100867758 3300007076 Bacteria 787
174 Ga0099794_10000151 3300007265 Bacteria 25673
175 Ga0099794_10022882 3300007265 Bacteria 2853
176 Ga0099794_10177231 3300007265 Bacteria 1088
177 Ga0111539_10638844 3300009094 Bacteria 1239
178 Ga0111539_10840575 3300009094 Bacteria 1068
179 Ga0114129_10000918 3300009147 Bacteria 38424
180 Ga0114129_10678818 3300009147 Bacteria 1326
181 Ga0114129_11028369 3300009147 Bacteria 1036
182 Ga0114129_11255736 3300009147 Bacteria 920
183 Ga0114129_11730666 3300009147 Bacteria 762
184 Ga0105243_10430659 3300009148 Bacteria 1233
185 Ga0105242_10015995 3300009176 Bacteria 5830
186 Ga0105248_10104035 3300009177 Bacteria 3200
187 Ga0105248_10721753 3300009177 Bacteria 1125
188 Ga0105237_11472057 3300009545 Bacteria 687
189 Ga0105239_10070935 3300010375 Bacteria 3827
190 Ga0157378_10005002 3300013297 Bacteria 11631
191 Ga0157372_10278929 3300013307 Bacteria 1943
192 Ga0163163_10070485 3300014325 Bacteria 3481
193 Ga0207653_10000333 3300025885 Bacteria 24834
194 Ga0207653_10008089 3300025885 Bacteria 3278
195 Ga0207653_10052804 3300025885 Bacteria 1356
196 Ga0207682_10173314 3300025893 Bacteria 982
197 Ga0207680_10604371 3300025903 Bacteria 785
198 Ga0207699_10003303 3300025906 Bacteria 7687
199 Ga0207684_10004423 3300025910 Bacteria 13237
200 Ga0207684_10029413 3300025910 Bacteria 4679
201 Ga0207684_10095581 3300025910 Bacteria 2535
202 Ga0207684_10169780 3300025910 Bacteria 1880
203 Ga0207684_10176146 3300025910 Bacteria 1844
204 Ga0207684_10300221 3300025910 Bacteria 1384
205 Ga0207684_10799507 3300025910 Bacteria 797
206 Ga0207684_10914503 3300025910 Bacteria 737
207 Ga0207663_10000556 3300025916 Bacteria 16472
208 Ga0207663_10144517 3300025916 Bacteria 1661
209 Ga0207663_10179803 3300025916 Bacteria 1510
210 Ga0207660_10117765 3300025917 Bacteria 2008
211 Ga0207646_10013412 3300025922 Bacteria 7838
212 Ga0207646_10031662 3300025922 Bacteria 4788
213 Ga0207646_10031878 3300025922 Bacteria 4771
214 Ga0207646_10061200 3300025922 Bacteria 3361
215 Ga0207646_10120365 3300025922 Bacteria 2358
216 Ga0207646_10254707 3300025922 Bacteria 1586
217 Ga0207646_10532563 3300025922 Bacteria 1057
218 Ga0207646_10830442 3300025922 Bacteria 822
219 Ga0207681_10757243 3300025923 Bacteria 810
220 Ga0207659_10218030 3300025926 Bacteria 1532
221 Ga0207644_10030023 3300025931 Bacteria 3775
222 Ga0207706_10386384 3300025933 Bacteria 1214
223 Ga0207669_10196522 3300025937 Bacteria 1460
224 Ga0207665_10005385 3300025939 Bacteria 8545
225 Ga0207665_10142532 3300025939 Bacteria 1710
226 Ga0207711_10794109 3300025941 Bacteria 882
227 Ga0207689_10607756 3300025942 Bacteria 920
228 Ga0207679_11280036 3300025945 Bacteria 673
229 Ga0207708_10033874 3300026075 Bacteria 3884
230 Ga0207641_10810806 3300026088 Bacteria 926
231 Ga0207648_10005220 3300026089 Bacteria 13139
232 Ga0207648_10075694 3300026089 Bacteria 2934
233 Ga0207648_10193666 3300026089 Bacteria 1802
234 Ga0209995_1024734 3300027471 Bacteria 1000
235 Ga0209983_1004726 3300027665 Bacteria 2848
236 Ga0209588_1000403 3300027671 Bacteria 11212
237 Ga0209971_1001815 3300027682 Bacteria 5230
238 Ga0209974_10107512 3300027876 Bacteria 979
239 Ga0207428_10502591 3300027907 Bacteria 880
240 Ga0268264_11780324 3300028381 Bacteria 626
241 Ga0307408_100058591 3300031548 Bacteria 2800
242 Ga0307408_100205333 3300031548 Bacteria 1598
243 Ga0307405_11127579 3300031731 Bacteria 675
244 Ga0307413_10002229 3300031824 Bacteria 7809
245 Ga0307413_10016779 3300031824 Bacteria 3795
246 Ga0307413_10220543 3300031824 Bacteria 1385
247 Ga0307413_10490984 3300031824 Bacteria 984
248 Ga0307410_10015315 3300031852 Bacteria 4545
249 Ga0307406_10002595 3300031901 Bacteria 9848
250 Ga0307406_10135379 3300031901 Bacteria 1736
251 Ga0307406_10456547 3300031901 Bacteria 1026
252 Ga0307407_10180450 3300031903 Bacteria 1399
253 Ga0307407_10187705 3300031903 Bacteria 1375
254 Ga0307407_10201302 3300031903 Bacteria 1335
255 Ga0307412_10230008 3300031911 Bacteria 1427
256 Ga0307412_10303057 3300031911 Bacteria 1264
257 Ga0307409_100023234 3300031995 Bacteria 4291
258 Ga0307409_100123482 3300031995 Bacteria 2198
259 Ga0307409_100328990 3300031995 Bacteria 1433
260 Ga0307409_100868642 3300031995 Bacteria 914
261 Ga0307409_101397566 3300031995 Bacteria 726
262 Ga0307416_100058279 3300032002 Bacteria 3130
263 Ga0307416_100073588 3300032002 Bacteria 2850
264 Ga0307416_100181305 3300032002 Bacteria 1974
265 Ga0307416_100264969 3300032002 Bacteria 1682
266 Ga0307414_10205264 3300032004 Bacteria 1606
267 Ga0307414_10833077 3300032004 Bacteria 843
268 Ga0307411_10015244 3300032005 Bacteria 4310
269 Ga0307411_10096525 3300032005 Bacteria 2078
270 Ga0307411_10741060 3300032005 Bacteria 860
271 Ga0307411_10977823 3300032005 Bacteria 756
272 Ga0307415_100334206 3300032126 Bacteria 1269
273 Ga0307415_100919343 3300032126 Bacteria 808
274 Ga0373930_0095265 3300034816 Bacteria 702
275 Ga0373959_0049752 3300034820 Bacteria 902
276 Ga0373928_0035425 3300035084 Bacteria 1124
277 Ga0373928_0161115 3300035084 Bacteria 627
278 Ga0373929_0007509 3300035085 Bacteria 1993
279 Ga0373940_0165259 3300035088 Bacteria 712
280 Ga0373940_0284751 3300035088 Bacteria 565
281 Ga0373949_0167682 3300035090 Bacteria 644
282 Ga0373932_0020821 3300035112 Bacteria 1724
283 Ga0373941_0141126 3300035115 Unclassified 876
284 Ga0373960_0092522 3300035121 Bacteria 969
285 Ga0373955_0612270 3300035172 Bacteria 667
286 Ga0373942_0048319 3300035207 Bacteria 1185
287 Ga0373931_0692450 3300035691 Bacteria 672
288 Ga0373933_0099861 3300035724 Bacteria 1800
289 Ga0373937_0031568 3300036401 Bacteria 4802
290 Ga0373937_0156562 3300036401 Bacteria 2136
291 Ga0395905_0330837 3300037471 Bacteria 1414
292 Ga0395905_0944403 3300037471 Bacteria 765
293 Ga0395901_1956982 3300038443 Bacteria 533
294 Ga0242420_063346 3300038996 Bacteria 741
295 Ga0439439_0017195 3300041406 Unclassified 1776
296 Ga0439439_0054282 3300041406 Bacteria 1055
297 Ga0439448_0032307 3300042005 Bacteria 1665
298 Ga0439455_0019566 3300042012 Bacteria 1598
299 Ga0439462_0045366 3300042015 Unclassified 1177
300 Ga0450923_066526 3300042125 Bacteria 794
301 Ga0450896_027088 3300042133 Bacteria 856
302 Ga0439434_0219399 3300042435 Bacteria 645
303 Ga0451577_0276525 3300042876 Bacteria 1521
304 Ga0451577_0404782 3300042876 Bacteria 1239
305 Ga0453683_0006036 3300044673 Bacteria 8348
306 Ga0453683_0156354 3300044673 Bacteria 1442
307 Ga0453683_0284766 3300044673 Bacteria 1056
308 Ga0453683_0342777 3300044673 Bacteria 959
309 Ga0453683_0453976 3300044673 Bacteria 829
310 Ga0453684_0923943 3300044712 Bacteria 933
311 Ga0451576_0033572 3300045051 Bacteria 5454
312 Ga0451576_0117278 3300045051 Bacteria 2771
313 Ga0451576_0209571 3300045051 Bacteria 2035
314 Ga0451576_0212787 3300045051 Bacteria 2018
315 Ga0451576_0247850 3300045051 Bacteria 1861
316 Ga0451576_0254721 3300045051 Bacteria 1834
317 Ga0451576_0616238 3300045051 Bacteria 1140
318 Ga0451576_0759434 3300045051 Bacteria 1018
319 Ga0451576_1519224 3300045051 Bacteria 695
320 Ga0495590_0188680 3300046457 Bacteria 755
321 Ga0495629_0143143 3300046459 Bacteria 1663
322 Ga0495629_0550914 3300046459 Bacteria 774
323 Ga0495651_0173843 3300046462 Bacteria 1531
324 Ga0495653_0285303 3300046463 Bacteria 1082
325 Ga0495582_0168131 3300046473 Bacteria 1248
326 Ga0495594_0160984 3300046499 Bacteria 1276
327 Ga0495608_0135222 3300046511 Bacteria 1576
328 Ga0495618_0069522 3300046514 Bacteria 2239
329 Ga0495618_0856067 3300046514 Bacteria 527
330 Ga0495630_0369422 3300046517 Bacteria 1098
331 Ga0495642_0120628 3300046528 Bacteria 1125
332 Ga0495652_0180241 3300046529 Bacteria 1622
333 Ga0495652_0294746 3300046529 Bacteria 1182
334 Ga0495640_0385803 3300046533 Bacteria 861
335 Ga0495587_0420946 3300046536 Bacteria 741
336 Ga0495609_0074810 3300046538 Bacteria 1485
337 Ga0495621_0060942 3300046539 Bacteria 1370
338 Ga0495645_0229382 3300046543 Bacteria 1245
339 Ga0495645_0267131 3300046543 Bacteria 1130
340 Ga0495656_0060792 3300046615 Bacteria 1648
341 Ga0495634_0595277 3300046642 Bacteria 642
342 Ga0495659_0159337 3300046664 Bacteria 910
343 Ga0495657_0027767 3300046675 Bacteria 3990
344 Ga0495599_0028657 3300046678 Bacteria 3489
345 Ga0495599_0391630 3300046678 Bacteria 828
346 Ga0495658_0369719 3300046683 Bacteria 912
347 Ga0495613_0436495 3300046689 Bacteria 889
348 Ga0495600_0045969 3300046809 Bacteria 2849
349 Ga0495581_0661997 3300047315 Bacteria 603
350 Ga0495674_0051646 3300047319 Bacteria 3623
351 Ga0495680_0040634 3300047322 Bacteria 3704
352 Ga0495680_0241799 3300047322 Bacteria 1282
353 Ga0495675_0095753 3300047444 Bacteria 1861
354 Ga0495684_0170095 3300047471 Bacteria 1621
355 Ga0495602_0257633 3300048088 Bacteria 1296
356 Ga0496101_0038807 3300048904 Bacteria 3384
357 Ga0496102_0036868 3300048905 Bacteria 4407
358 Ga0496102_0067085 3300048905 Bacteria 3290
359 Ga0496102_0183326 3300048905 Bacteria 1972
360 Ga0496102_0341797 3300048905 Bacteria 1409
361 Ga0496103_0020598 3300048906 Bacteria 3962
362 Ga0496103_0070273 3300048906 Bacteria 2190
363 Ga0496104_0004744 3300048907 Bacteria 11832
364 Ga0496104_0055217 3300048907 Bacteria 3755
365 Ga0496105_0070386 3300048908 Bacteria 2892
366 Ga0496106_0015610 3300048909 Bacteria 5617
367 Ga0496106_0253943 3300048909 Bacteria 1406
368 Ga0496107_0049544 3300048910 Bacteria 3027
369 Ga0496108_0005237 3300048911 Bacteria 10474
370 Ga0496108_0017435 3300048911 Bacteria 5876
371 Ga0496108_0192757 3300048911 Bacteria 1767
372 Ga0496109_0007523 3300048912 Bacteria 9228
373 Ga0496109_0071352 3300048912 Bacteria 3188
374 Ga0496110_0080168 3300048913 Bacteria 2908
375 Ga0496110_0146866 3300048913 Bacteria 2133
376 Ga0496111_0032614 3300048914 Bacteria 3714
377 Ga0496112_0001950 3300048915 Bacteria 16300
378 Ga0496112_0022068 3300048915 Bacteria 6062
379 Ga0496113_0000769 3300048916 Bacteria 16520
380 Ga0496113_0068922 3300048916 Bacteria 2685
381 Ga0496113_0074603 3300048916 Bacteria 2586
382 Ga0496114_0205525 3300048917 Bacteria 1726
383 Ga0496115_0121651 3300048918 Bacteria 2148
384 Ga0501067_0044515 3300049583 Bacteria 2465
385 Ga0501067_0086510 3300049583 Bacteria 1739
386 Ga0501069_0252868 3300049585 Bacteria 1028
387 Ga0501070_0749959 3300049586 Bacteria 769
388 Ga0501076_1222571 3300049592 Bacteria 618
389 Ga0501079_0858168 3300049741 Bacteria 715
390 Ga0501080_0625759 3300049742 Bacteria 954
391 Ga0501081_0487366 3300049743 Bacteria 918
392 Ga0501045_0350063 3300049824 Bacteria 1100
393 nmdc:mga05p37_1065228_c1 3300050507 Bacteria 851
394 nmdc:mga05p37_1268059_c1 3300050507 Bacteria 754
395 nmdc:mga05p37_1366011_c1 3300050507 Bacteria 716
396 nmdc:mga05p37_1573974_c1 3300050507 Bacteria 649
397 nmdc:mga05p37_17318_c1 3300050507 Bacteria 8694
398 nmdc:mga05p37_392138_c1 3300050507 Bacteria 1624
399 nmdc:mga05p37_512066_c1 3300050507 Bacteria 1375
400 nmdc:mga09592_19135_c1 3300050508 Bacteria 5619
401 nmdc:mga0qj67_128114_c1 3300050509 Bacteria 2054
402 nmdc:mga0qj67_18195_c1 3300050509 Bacteria 5353
403 nmdc:mga0qj67_31546_c1 3300050509 Bacteria 4128
404 nmdc:mga0qj67_3465_c1 3300050509 Bacteria 11369
405 nmdc:mga0qj67_643574_c1 3300050509 Bacteria 846
406 nmdc:mga06r32_1275106_c1 3300050510 Bacteria 679
407 nmdc:mga06r32_34849_c1 3300050510 Bacteria 4748
408 nmdc:mga06r32_37191_c1 3300050510 Bacteria 4605
409 nmdc:mga06r32_396593_c2 3300050510 Bacteria 884
410 nmdc:mga06r32_596696_c1 3300050510 Bacteria 1075
411 nmdc:mga06r32_831800_c1 3300050510 Bacteria 882
412 nmdc:mga06r32_9855_c1 3300050510 Bacteria 7085
413 nmdc:mga08y16_1024163_c1 3300050511 Bacteria 804
414 nmdc:mga08y16_640385_c1 3300050511 Bacteria 1068
415 nmdc:mga0n895_114877_c1 3300050512 Bacteria 2710
416 nmdc:mga0n895_126111_c1 3300050512 Bacteria 2584
417 nmdc:mga0n895_146194_c1 3300050512 Bacteria 2394
418 nmdc:mga0n895_14642_c1 3300050512 Bacteria 7132
419 nmdc:mga0n895_178393_c1 3300050512 Bacteria 2155
420 nmdc:mga0n895_29615_c1 3300050512 Bacteria 5225
421 nmdc:mga0n895_33109_c1 3300050512 Bacteria 4965
422 nmdc:mga0n895_40832_c1 3300050512 Unclassified 4508
423 nmdc:mga0n895_551825_c1 3300050512 Bacteria 1158
424 nmdc:mga0n895_647944_c1 3300050512 Bacteria 1055
425 nmdc:mga0n895_9354_c1 3300050512 Bacteria 8569
426 nmdc:mga0n895_9488_c1 3300050512 Bacteria 8517
427 nmdc:mga0n895_9765_c1 3300050512 Bacteria 8423
428 nmdc:mga0rr50_1463043_c1 3300050513 Bacteria 578
429 nmdc:mga0rr50_1522672_c1 3300050513 Bacteria 565
430 nmdc:mga0rr50_1657562_c1 3300050513 Bacteria 539
431 nmdc:mga0rr50_3220_c1 3300050513 Bacteria 9348
432 nmdc:mga0rr50_335255_c1 3300050513 Bacteria 1270
433 nmdc:mga0rr50_39256_c1 3300050513 Bacteria 3433
434 nmdc:mga0rr50_49724_c1 3300050513 Bacteria 3104
435 nmdc:mga0rr50_534844_c1 3300050513 Bacteria 998
436 nmdc:mga0rr50_54416_c1 3300050513 Bacteria 2982
437 nmdc:mga08x19_181958_c1 3300050514 Bacteria 1435
438 nmdc:mga08x19_19925_c1 3300050514 Bacteria 4124
439 nmdc:mga08x19_215266_c1 3300050514 Bacteria 1319
440 nmdc:mga08x19_2813_c1 3300050514 Bacteria 10493
441 nmdc:mga08x19_281795_c1 3300050514 Bacteria 1152
442 nmdc:mga0a205_1047816_c1 3300050515 Bacteria 663
443 nmdc:mga0a205_107718_c2 3300050515 Bacteria 1594
444 nmdc:mga0a205_1301072_c1 3300050515 Bacteria 575
445 nmdc:mga0a205_16499_c1 3300050515 Bacteria 6916
446 nmdc:mga0a205_234402_c1 3300050515 Bacteria 1718
447 nmdc:mga0a205_294493_c1 3300050515 Bacteria 1497
448 nmdc:mga0a205_46089_c1 3300050515 Bacteria 4204
449 nmdc:mga0a205_4744_c1 3300050515 Bacteria 12213
450 nmdc:mga0a205_642208_c1 3300050515 Bacteria 913
451 nmdc:mga0a205_68396_c1 3300050515 Bacteria 3430
452 nmdc:mga0a205_823_c1 3300050515 Bacteria 25240
453 nmdc:mga0a205_925478_c1 3300050515 Bacteria 719
454 Ga0495595_0414684 3300053084 Bacteria 683
455 Ga0590075_046507 3300059424 Bacteria 1112
456 Ga0501082_0627818 3300060353 Bacteria 940
457 Ga0501082_1052063 3300060353 Bacteria 712
458 Ga0530510_0370620 3300061734 Bacteria 1077
459 Ga0070708_100015753
460 Ga0065715_10484552
461 Ga0065707_10369261
462 Ga0070676_10417359
463 Ga0070677_10034553
464 Ga0068869_100782261
465 Ga0070680_100030461
466 Ga0070680_100131476
467 Ga0070660_100453135
468 Ga0070660_100484416
469 Ga0070689_101240912
470 Ga0070691_10131384
471 Ga0070661_100342646
472 Ga0070692_10010116
473 Ga0070671_100008393
474 Ga0070671_100023147
475 Ga0070674_100223277
476 Ga0070673_100642173
477 Ga0070659_100487074
478 Ga0070703_10149937
479 Ga0070703_10287549
480 Ga0070709_10001038
481 Ga0070709_10002501
482 Ga0070709_10987862
483 Ga0070714_100894393
484 Ga0070713_100091051
485 Ga0070701_10003315
486 Ga0070711_100000466
487 Ga0070711_100148343
488 Ga0070711_100215049
489 Ga0070705_100001094
490 Ga0070705_100012339
491 Ga0070705_100019381
492 Ga0070705_100072948
493 Ga0070705_100961998
494 Ga0070705_101249170
495 Ga0070700_100016340
496 Ga0070694_100006594
497 Ga0070694_100016514
498 Ga0070694_100016538
499 Ga0070694_100019721
500 Ga0070694_100149255
501 Ga0070694_100268073
502 Ga0070694_100722560
503 Ga0070708_100001912
504 Ga0070708_100010515
505 Ga0070708_100031040
506 Ga0070708_100121143
507 Ga0070708_100254086
508 Ga0070708_100614130
509 Ga0070708_101046884
510 Ga0068867_100010994
511 Ga0068867_100427932
512 Ga0070706_100002003
513 Ga0070706_100011664
514 Ga0070706_100028410
515 Ga0070706_100209801
516 Ga0070706_100862871
517 Ga0070707_100010873
518 Ga0070707_100020493
519 Ga0070707_100068391
520 Ga0070707_100153970
521 Ga0070707_100283258
522 Ga0070707_100370144
523 Ga0070707_100375411
524 Ga0070707_100702309
525 Ga0070698_100000416
526 Ga0070698_100062922
527 Ga0070698_100385285
528 Ga0070698_100527815
529 Ga0070698_101089795
530 Ga0070698_101304589
531 Ga0070699_100012620
532 Ga0070699_100026193
533 Ga0070699_100140260
534 Ga0070699_100167136
535 Ga0070699_100241053
536 Ga0070699_100321493
537 Ga0070699_100734725
538 Ga0070699_100832269
539 Ga0070684_100354898
540 Ga0070697_100012367
541 Ga0070697_100013876
542 Ga0070697_100018326
543 Ga0070697_100050051
544 Ga0070697_100120583
545 Ga0070697_100123649
546 Ga0070697_100193144
547 Ga0070697_100197734
548 Ga0070697_100303329
549 Ga0068853_101985950
550 Ga0070695_100014538
551 Ga0070695_100015608
552 Ga0070695_100060377
553 Ga0070695_100097399
554 Ga0070696_100029940
555 Ga0070696_100110869
556 Ga0070696_100153055
557 Ga0070696_100325999
558 Ga0070696_100394107
559 Ga0070704_100003470
560 Ga0070704_100007397
561 Ga0070704_100041422
562 Ga0070704_100051432
563 Ga0070704_100074862
564 Ga0070704_100125452
565 Ga0070704_100148212
566 Ga0070704_100164370
567 Ga0070704_100455942
568 Ga0070702_100130069
569 Ga0068859_100145629
570 Ga0068859_100408911
571 Ga0068864_100038902
572 Ga0068858_100177651
573 Ga0070716_100015084
574 Ga0070716_100090533
575 Ga0070712_100012458
576 Ga0070712_100433270
577 Ga0097621_100847500
578 Ga0075428_101206135
579 Ga0075430_100003192
580 Ga0075430_100013015
581 Ga0075430_100013975
582 Ga0075430_100175908
583 Ga0075430_100468978
584 Ga0075431_100018581
585 Ga0075431_100024864
586 Ga0075431_100040068
587 Ga0075431_100045255
588 Ga0075431_100135269
589 Ga0075431_100400289
590 Ga0075431_100531926
591 Ga0075433_10002882
592 Ga0075433_10005522
593 Ga0075433_10031658
594 Ga0075433_10062789
595 Ga0075433_10075783
596 Ga0075433_10162312
597 Ga0075433_10181006
598 Ga0075433_10209841
599 Ga0075433_10911131
600 Ga0075434_100000352
601 Ga0075434_100008943
602 Ga0075434_100015336
603 Ga0075434_100019680
604 Ga0075434_100027707
605 Ga0075434_100035018
606 Ga0075434_100103786
607 Ga0075434_100178585
608 Ga0075434_100205350
609 Ga0075434_100287471
610 Ga0075434_101072645
611 Ga0075429_100010311
612 Ga0075429_100066997
613 Ga0075429_100280541
614 Ga0075429_100353940
615 Ga0075436_100010736
616 Ga0075436_100025925
617 Ga0075436_100105260
618 Ga0075436_100115556
619 Ga0075436_100154632
620 Ga0075436_100238145
621 Ga0075436_100246777
622 Ga0075436_100263656
623 Ga0097620_100145630
624 Ga0097620_100408964
625 Ga0075435_100010505
626 Ga0075435_100012395
627 Ga0075435_100026546
628 Ga0075435_100068067
629 Ga0075435_100114988
630 Ga0075435_100144224
631 Ga0075435_100867758
632 Ga0099794_10000151
633 Ga0099794_10022882
634 Ga0099794_10177231
635 Ga0111539_10638844
636 Ga0111539_10840575
637 Ga0114129_10000918
638 Ga0114129_10678818
639 Ga0114129_11028369
640 Ga0114129_11255736
641 Ga0114129_11730666
642 Ga0105243_10430659
643 Ga0105242_10015995
644 Ga0105248_10104035
645 Ga0105248_10721753
646 Ga0105237_11472057
647 Ga0105239_10070935
648 Ga0157378_10005002
649 Ga0157372_10278929
650 Ga0163163_10070485
651 Ga0207653_10000333
652 Ga0207653_10008089
653 Ga0207653_10052804
654 Ga0207682_10173314
655 Ga0207680_10604371
656 Ga0207699_10003303
657 Ga0207684_10004423
658 Ga0207684_10029413
659 Ga0207684_10095581
660 Ga0207684_10169780
661 Ga0207684_10176146
662 Ga0207684_10300221
663 Ga0207684_10799507
664 Ga0207684_10914503
665 Ga0207663_10000556
666 Ga0207663_10144517
667 Ga0207663_10179803
668 Ga0207660_10117765
669 Ga0207646_10013412
670 Ga0207646_10031662
671 Ga0207646_10031878
672 Ga0207646_10061200
673 Ga0207646_10120365
674 Ga0207646_10254707
675 Ga0207646_10532563
676 Ga0207646_10830442
677 Ga0207681_10757243
678 Ga0207659_10218030
679 Ga0207644_10030023
680 Ga0207706_10386384
681 Ga0207669_10196522
682 Ga0207665_10005385
683 Ga0207665_10142532
684 Ga0207711_10794109
685 Ga0207689_10607756
686 Ga0207679_11280036
687 Ga0207708_10033874
688 Ga0207641_10810806
689 Ga0207648_10005220
690 Ga0207648_10075694
691 Ga0207648_10193666
692 Ga0209995_1024734
693 Ga0209983_1004726
694 Ga0209588_1000403
695 Ga0209971_1001815
696 Ga0209974_10107512
697 Ga0207428_10502591
698 Ga0268264_11780324
699 Ga0307408_100058591
700 Ga0307408_100205333
701 Ga0307405_11127579
702 Ga0307413_10002229
703 Ga0307413_10016779
704 Ga0307413_10220543
705 Ga0307413_10490984
706 Ga0307410_10015315
707 Ga0307406_10002595
708 Ga0307406_10135379
709 Ga0307406_10456547
710 Ga0307407_10180450
711 Ga0307407_10187705
712 Ga0307407_10201302
713 Ga0307412_10230008
714 Ga0307412_10303057
715 Ga0307409_100023234
716 Ga0307409_100123482
717 Ga0307409_100328990
718 Ga0307409_100868642
719 Ga0307409_101397566
720 Ga0307416_100058279
721 Ga0307416_100073588
722 Ga0307416_100181305
723 Ga0307416_100264969
724 Ga0307414_10205264
725 Ga0307414_10833077
726 Ga0307411_10015244
727 Ga0307411_10096525
728 Ga0307411_10741060
729 Ga0307411_10977823
730 Ga0307415_100334206
731 Ga0307415_100919343
732 Ga0373930_0095265
733 Ga0373959_0049752
734 Ga0373928_0035425
735 Ga0373928_0161115
736 Ga0373929_0007509
737 Ga0373940_0165259
738 Ga0373940_0284751
739 Ga0373949_0167682
740 Ga0373932_0020821
741 Ga0373941_0141126
742 Ga0373960_0092522
743 Ga0373955_0612270
744 Ga0373942_0048319
745 Ga0373931_0692450
746 Ga0373933_0099861
747 Ga0373937_0031568
748 Ga0373937_0156562
749 Ga0395905_0330837
750 Ga0395905_0944403
751 Ga0395901_1956982
752 Ga0242420_063346
753 Ga0439439_0017195
754 Ga0439439_0054282
755 Ga0439448_0032307
756 Ga0439455_0019566
757 Ga0439462_0045366
758 Ga0450923_066526
759 Ga0450896_027088
760 Ga0439434_0219399
761 Ga0451577_0276525
762 Ga0451577_0404782
763 Ga0453683_0006036
764 Ga0453683_0156354
765 Ga0453683_0284766
766 Ga0453683_0342777
767 Ga0453683_0453976
768 Ga0453684_0923943
769 Ga0451576_0033572
770 Ga0451576_0117278
771 Ga0451576_0209571
772 Ga0451576_0212787
773 Ga0451576_0247850
774 Ga0451576_0254721
775 Ga0451576_0616238
776 Ga0451576_0759434
777 Ga0451576_1519224
778 Ga0495590_0188680
779 Ga0495629_0143143
780 Ga0495629_0550914
781 Ga0495651_0173843
782 Ga0495653_0285303
783 Ga0495582_0168131
784 Ga0495594_0160984
785 Ga0495608_0135222
786 Ga0495618_0069522
787 Ga0495618_0856067
788 Ga0495630_0369422
789 Ga0495642_0120628
790 Ga0495652_0180241
791 Ga0495652_0294746
792 Ga0495640_0385803
793 Ga0495587_0420946
794 Ga0495609_0074810
795 Ga0495621_0060942
796 Ga0495645_0229382
797 Ga0495645_0267131
798 Ga0495656_0060792
799 Ga0495634_0595277
800 Ga0495659_0159337
801 Ga0495657_0027767
802 Ga0495599_0028657
803 Ga0495599_0391630
804 Ga0495658_0369719
805 Ga0495613_0436495
806 Ga0495600_0045969
807 Ga0495581_0661997
808 Ga0495674_0051646
809 Ga0495680_0040634
810 Ga0495680_0241799
811 Ga0495675_0095753
812 Ga0495684_0170095
813 Ga0495602_0257633
814 Ga0496101_0038807
815 Ga0496102_0036868
816 Ga0496102_0067085
817 Ga0496102_0183326
818 Ga0496102_0341797
819 Ga0496103_0020598
820 Ga0496103_0070273
821 Ga0496104_0004744
822 Ga0496104_0055217
823 Ga0496105_0070386
824 Ga0496106_0015610
825 Ga0496106_0253943
826 Ga0496107_0049544
827 Ga0496108_0005237
828 Ga0496108_0017435
829 Ga0496108_0192757
830 Ga0496109_0007523
831 Ga0496109_0071352
832 Ga0496110_0080168
833 Ga0496110_0146866
834 Ga0496111_0032614
835 Ga0496112_0001950
836 Ga0496112_0022068
837 Ga0496113_0000769
838 Ga0496113_0068922
839 Ga0496113_0074603
840 Ga0496114_0205525
841 Ga0496115_0121651
842 Ga0501067_0044515
843 Ga0501067_0086510
844 Ga0501069_0252868
845 Ga0501070_0749959
846 Ga0501076_1222571
847 Ga0501079_0858168
848 Ga0501080_0625759
849 Ga0501081_0487366
850 Ga0501045_0350063
851 nmdc:mga05p37_1065228_c1
852 nmdc:mga05p37_1268059_c1
853 nmdc:mga05p37_1366011_c1
854 nmdc:mga05p37_1573974_c1
855 nmdc:mga05p37_17318_c1
856 nmdc:mga05p37_392138_c1
857 nmdc:mga05p37_512066_c1
858 nmdc:mga09592_19135_c1
859 nmdc:mga0qj67_128114_c1
860 nmdc:mga0qj67_18195_c1
861 nmdc:mga0qj67_31546_c1
862 nmdc:mga0qj67_3465_c1
863 nmdc:mga0qj67_643574_c1
864 nmdc:mga06r32_1275106_c1
865 nmdc:mga06r32_34849_c1
866 nmdc:mga06r32_37191_c1
867 nmdc:mga06r32_396593_c2
868 nmdc:mga06r32_596696_c1
869 nmdc:mga06r32_831800_c1
870 nmdc:mga06r32_9855_c1
871 nmdc:mga08y16_1024163_c1
872 nmdc:mga08y16_640385_c1
873 nmdc:mga0n895_114877_c1
874 nmdc:mga0n895_126111_c1
875 nmdc:mga0n895_146194_c1
876 nmdc:mga0n895_14642_c1
877 nmdc:mga0n895_178393_c1
878 nmdc:mga0n895_29615_c1
879 nmdc:mga0n895_33109_c1
880 nmdc:mga0n895_40832_c1
881 nmdc:mga0n895_551825_c1
882 nmdc:mga0n895_647944_c1
883 nmdc:mga0n895_9354_c1
884 nmdc:mga0n895_9488_c1
885 nmdc:mga0n895_9765_c1
886 nmdc:mga0rr50_1463043_c1
887 nmdc:mga0rr50_1522672_c1
888 nmdc:mga0rr50_1657562_c1
889 nmdc:mga0rr50_3220_c1
890 nmdc:mga0rr50_335255_c1
891 nmdc:mga0rr50_39256_c1
892 nmdc:mga0rr50_49724_c1
893 nmdc:mga0rr50_534844_c1
894 nmdc:mga0rr50_54416_c1
895 nmdc:mga08x19_181958_c1
896 nmdc:mga08x19_19925_c1
897 nmdc:mga08x19_215266_c1
898 nmdc:mga08x19_2813_c1
899 nmdc:mga08x19_281795_c1
900 nmdc:mga0a205_1047816_c1
901 nmdc:mga0a205_107718_c2
902 nmdc:mga0a205_1301072_c1
903 nmdc:mga0a205_16499_c1
904 nmdc:mga0a205_234402_c1
905 nmdc:mga0a205_294493_c1
906 nmdc:mga0a205_46089_c1
907 nmdc:mga0a205_4744_c1
908 nmdc:mga0a205_642208_c1
909 nmdc:mga0a205_68396_c1
910 nmdc:mga0a205_823_c1
911 nmdc:mga0a205_925478_c1
912 Ga0495595_0414684
913 Ga0590075_046507
914 Ga0501082_0627818
915 Ga0501082_1052063
916 Ga0530510_0370620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

15

143

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9724 1 160
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9723 1 158
1qjc-assembly1.cif.gz_B phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine 0.9719 3 157
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9702 3 159
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9685 1 158
ID Description Score Start End Superfamily
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9646 1 157 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9589 3 158 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9574 1 158 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9517 3 154 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9414 1 158 3.40.50.620
ID Description Score Start End GO Terms
AF-K9TPM2-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9877 4 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-K9X3C4-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9864 1 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2T1C541-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9864 4 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A357KMQ3-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9863 4 159 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-K9WM55-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9862 1 158 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map