F447425

General Info

Members Datasets Scaffolds Average Seq Length
454 365 306 164

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_034872|Ga0400483_034872_356_940
Length 194
Sequence VLFIFVIPVPYSLLSITSFEEDLMLTIHKKICLLGDFAVGKTSLVRRFVYNLFDDKYISTIGVKVSRKTVSLPLTDDIVNITMMLWDLAGSEEFSLMRASYLRGASGAVLVGDLTRPETFDHLHDYINDLLKVSPQAQFVLAANKSDLVEQHQLSAKQLEEIAGGLGIPYRLTSAKMGTEVDELFRYLGNLLVQ

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
6 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
7 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
8 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
9 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
10 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
11 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
12 2643221688 Rhizobium sp. Root482 Isolate Unclassified
13 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
14 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
15 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
16 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
17 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
18 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
19 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
20 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
21 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
22 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
23 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
24 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
25 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
26 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
27 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
28 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
29 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
30 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
31 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
32 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
33 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
34 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
35 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
36 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
37 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
38 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
39 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
40 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
41 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
42 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
43 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
44 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
45 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
46 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
47 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
48 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
49 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
50 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
51 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
52 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
53 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
54 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
55 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
56 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
57 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
58 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
59 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
60 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
61 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
62 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
63 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
64 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
65 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
66 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
67 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
68 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
69 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
70 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
71 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
72 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
73 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
74 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
75 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
76 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
77 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
78 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
79 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
80 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
81 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
82 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
83 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
84 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
85 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
86 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
87 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
88 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
89 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
90 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
91 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
92 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
93 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
94 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
95 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
96 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
97 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
98 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
99 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
100 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
101 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
102 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
103 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
104 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
105 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
106 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
107 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
108 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
109 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
110 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
111 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
112 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
113 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
114 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
115 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
116 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
117 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
118 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
119 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
120 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
121 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
122 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
123 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
124 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
125 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
126 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
127 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
128 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
129 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
130 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
131 3004167301 Mesorhizobium loti 582 Isolate Unclassified
132 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
133 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
134 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
135 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
136 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
137 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
138 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
139 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
140 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
141 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
142 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
143 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
144 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
145 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
146 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
147 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
148 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
149 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
150 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
151 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
152 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
153 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
154 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
155 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
156 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
157 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
158 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
159 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
160 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
165 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
166 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
167 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
168 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
169 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
170 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
172 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
173 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
177 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
178 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
179 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
180 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
181 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
183 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
184 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
185 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
186 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
189 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
190 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
191 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
192 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
193 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
194 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
195 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
196 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
197 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
198 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
200 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
232 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
250 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
251 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
252 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
253 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
260 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
261 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
264 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
265 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
266 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
270 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
271 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
272 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
273 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
309 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
328 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
329 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
339 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
346 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
350 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
351 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
354 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
359 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
360 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
361 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
362 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
363 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
364 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
365 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.18
Metatranscriptomes 0.44
Isolates 32.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 27.97
Rhizoplane 2.42
Rhizosphere 53.52
Stem 0
Stem Tuber 0
Unclassified 10.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10052790 3300002459 Bacteria 838
2 JGI25159J45721_1035802 3300002987 Bacteria 757
3 rootL2_10015679 3300003322 Bacteria 5597
4 rootH1_10154490 3300003323 Bacteria 1969
5 Ga0065707_10220117 3300005295 Bacteria 1226
6 Ga0070676_10395055 3300005328 Bacteria 961
7 Ga0070670_100008304 3300005331 Bacteria 8847
8 Ga0070670_100021270 3300005331 Bacteria 5581
9 Ga0070670_100527295 3300005331 Bacteria 1052
10 Ga0070677_10036803 3300005333 Bacteria 1906
11 Ga0070666_10145296 3300005335 Bacteria 1653
12 Ga0070666_10178200 3300005335 Bacteria 1490
13 Ga0070669_100136954 3300005353 Bacteria 1884
14 Ga0070675_100000509 3300005354 Bacteria 26573
15 Ga0070674_100199823 3300005356 Bacteria 1543
16 Ga0070674_100302518 3300005356 Bacteria 1275
17 Ga0070673_100231215 3300005364 Bacteria 1604
18 Ga0070659_100653058 3300005366 Bacteria 907
19 Ga0070667_100194690 3300005367 Bacteria 1797
20 Ga0070667_101284556 3300005367 Bacteria 686
21 Ga0070663_100413464 3300005455 Unclassified 1105
22 Ga0070663_100572561 3300005455 Bacteria 947
23 Ga0070678_100273675 3300005456 Bacteria 1425
24 Ga0070662_100841606 3300005457 Bacteria 781
25 Ga0068867_100609638 3300005459 Bacteria 953
26 Ga0068867_100922721 3300005459 Bacteria 787
27 Ga0070707_101277828 3300005468 Unclassified 700
28 Ga0070698_100202537 3300005471 Unclassified 1920
29 Ga0070697_100034875 3300005536 Unclassified 4058
30 Ga0068853_100223356 3300005539 Bacteria 1721
31 Ga0070695_100273535 3300005545 Bacteria 1238
32 Ga0070695_100363652 3300005545 Bacteria 1087
33 Ga0070665_100423119 3300005548 Bacteria 1341
34 Ga0070665_100595304 3300005548 Unclassified 1119
35 Ga0070664_100649810 3300005564 Bacteria 980
36 Ga0070664_101206952 3300005564 Bacteria 714
37 Ga0068857_100141873 3300005577 Unclassified 2172
38 Ga0068857_100473645 3300005577 Bacteria 1173
39 Ga0068859_100053849 3300005617 Unclassified 4046
40 Ga0068859_100122983 3300005617 Unclassified 2662
41 Ga0068859_100184676 3300005617 Bacteria 2169
42 Ga0068864_100156583 3300005618 Unclassified 2068
43 Ga0068861_101029095 3300005719 Bacteria 788
44 Ga0081455_10345220 3300005937 Archaea 1052
45 Ga0081540_1031760 3300005983 Bacteria 2895
46 Ga0075365_10012997 3300006038 Bacteria 4966
47 Ga0075365_10017483 3300006038 Bacteria 4388
48 Ga0075367_10633879 3300006178 Bacteria 680
49 Ga0075428_100674026 3300006844 Bacteria 1102
50 Ga0075431_100210137 3300006847 Bacteria 1988
51 Ga0075431_100926208 3300006847 Bacteria 840
52 Ga0075434_100366410 3300006871 Bacteria 1462
53 Ga0075429_100034792 3300006880 Bacteria 4378
54 Ga0075429_101157105 3300006880 Bacteria 675
55 Ga0075436_100070416 3300006914 Bacteria 2418
56 Ga0097620_100053851 3300006931 Unclassified 4046
57 Ga0097620_100122977 3300006931 Unclassified 2662
58 Ga0097620_100184674 3300006931 Bacteria 2169
59 Ga0099794_10005964 3300007265 Archaea 4916
60 Ga0099794_10012024 3300007265 Bacteria 3722
61 Ga0099794_10012568 3300007265 Archaea 3658
62 Ga0099794_10098979 3300007265 Archaea 1454
63 Ga0099794_10182135 3300007265 Archaea 1072
64 Ga0105240_10008821 3300009093 Bacteria 14361
65 Ga0105240_10487891 3300009093 Bacteria 1372
66 Ga0111539_10901245 3300009094 Bacteria 1029
67 Ga0114129_10075137 3300009147 Bacteria 4705
68 Ga0105243_10706452 3300009148 Bacteria 983
69 Ga0105248_10003866 3300009177 Bacteria 16567
70 Ga0105248_10320419 3300009177 Bacteria 1746
71 Ga0105248_10637761 3300009177 Bacteria 1202
72 Ga0105248_10921588 3300009177 Bacteria 987
73 Ga0105238_10872169 3300009551 Bacteria 918
74 Ga0105239_10479254 3300010375 Bacteria 1413
75 Ga0105239_10917532 3300010375 Bacteria 1005
76 Ga0157374_11045526 3300013296 Bacteria 836
77 Ga0163162_10401231 3300013306 Bacteria 1504
78 Ga0157375_10178518 3300013308 Bacteria 2274
79 Ga0157375_10424262 3300013308 Bacteria 1496
80 Ga0157375_11534529 3300013308 Bacteria 787
81 Ga0163163_10022509 3300014325 Bacteria 5969
82 Ga0163163_10102383 3300014325 Bacteria 2887
83 Ga0157380_10281104 3300014326 Bacteria 1523
84 Ga0157380_11238214 3300014326 Bacteria 791
85 Ga0182008_10054145 3300014497 Bacteria 1986
86 Ga0182008_10077637 3300014497 Bacteria 1634
87 Ga0157377_10063294 3300014745 Unclassified 2119
88 Ga0157379_10080077 3300014968 Bacteria 2926
89 Ga0157379_10823782 3300014968 Bacteria 877
90 Ga0182007_10059991 3300015262 Bacteria 1247
91 Ga0183362_10003 3300015683 Bacteria 977584
92 Ga0163161_10146306 3300017792 Bacteria 1792
93 Ga0163161_10381932 3300017792 Bacteria 1126
94 Ga0206353_11251689 3300020082 Bacteria 930
95 Ga0213871_10010143 3300021441 Unclassified 2129
96 Ga0209025_1032836 3300025294 Bacteria 2416
97 Ga0209758_1034265 3300025297 Bacteria 2023
98 Ga0207682_10092429 3300025893 Bacteria 1313
99 Ga0207680_10130891 3300025903 Bacteria 1653
100 Ga0207647_10145758 3300025904 Bacteria 1386
101 Ga0207645_10082644 3300025907 Bacteria 2059
102 Ga0207643_10305840 3300025908 Bacteria 990
103 Ga0207695_10279949 3300025913 Bacteria 1562
104 Ga0207671_10374666 3300025914 Bacteria 1130
105 Ga0207681_10294767 3300025923 Bacteria 1282
106 Ga0207650_10035619 3300025925 Bacteria 3616
107 Ga0207650_10158738 3300025925 Bacteria 1790
108 Ga0207659_10008640 3300025926 Bacteria 6336
109 Ga0207706_10775179 3300025933 Bacteria 816
110 Ga0207669_10228106 3300025937 Bacteria 1372
111 Ga0207691_10126757 3300025940 Bacteria 2258
112 Ga0207711_10300076 3300025941 Bacteria 1481
113 Ga0207711_10355475 3300025941 Bacteria 1357
114 Ga0207651_10194925 3300025960 Bacteria 1619
115 Ga0207668_10432038 3300025972 Bacteria 1120
116 Ga0207668_11505610 3300025972 Bacteria 607
117 Ga0207658_10449131 3300025986 Bacteria 1141
118 Ga0207639_10310103 3300026041 Bacteria 1397
119 Ga0207648_10671994 3300026089 Bacteria 958
120 Ga0207648_11337970 3300026089 Bacteria 673
121 Ga0207676_10010429 3300026095 Bacteria 6616
122 Ga0207683_10316282 3300026121 Bacteria 1429
123 Ga0209971_1031854 3300027682 Bacteria 1265
124 Ga0209966_1007326 3300027695 Bacteria 1932
125 Ga0209813_10091410 3300027866 Bacteria 1022
126 Ga0268266_10437558 3300028379 Unclassified 1242
127 Ga0268266_10515057 3300028379 Unclassified 1143
128 Ga0268266_10909219 3300028379 Bacteria 851
129 Ga0307515_10000152 3300028794 Bacteria 167305
130 Ga0265340_10356969 3300031247 Unclassified 646
131 Ga0265327_10000201 3300031251 Bacteria 124359
132 Ga0307408_100335904 3300031548 Bacteria 1277
133 Ga0307408_100583339 3300031548 Bacteria 991
134 Ga0316579_10042166 3300031691 Bacteria 2120
135 Ga0316576_10959930 3300031727 Unclassified 610
136 Ga0307405_10047490 3300031731 Unclassified 2644
137 Ga0307405_10342767 3300031731 Bacteria 1150
138 Ga0316577_10046759 3300031733 Bacteria 2417
139 Ga0316577_10086120 3300031733 Bacteria 1758
140 Ga0316577_10098637 3300031733 Bacteria 1637
141 Ga0316577_10212548 3300031733 Unclassified 1093
142 Ga0307413_10048349 3300031824 Bacteria 2542
143 Ga0307410_10221927 3300031852 Archaea 1454
144 Ga0307407_10028340 3300031903 Bacteria 2993
145 Ga0307412_10044716 3300031911 Unclassified 2890
146 Ga0307412_10223555 3300031911 Bacteria 1445
147 Ga0307412_11639709 3300031911 Bacteria 588
148 Ga0307416_100361207 3300032002 Bacteria 1474
149 Ga0307414_10039227 3300032004 Bacteria 3189
150 Ga0307414_10398411 3300032004 Bacteria 1195
151 Ga0307411_10233034 3300032005 Bacteria 1436
152 Ga0316593_10122711 3300032168 Unclassified 934
153 Ga0373956_0111122 3300035119 Unclassified 1276
154 Ga0373957_0092560 3300035120 Unclassified 1203
155 Ga0373933_0015709 3300035724 Bacteria 4223
156 Ga0373937_0009490 3300036401 Bacteria 8459
157 Ga0373937_1229540 3300036401 Unclassified 697
158 Ga0373937_1806192 3300036401 Unclassified 558
159 Ga0316582_0077646 3300036647 Bacteria 2162
160 Ga0316582_0327327 3300036647 Bacteria 1054
161 Ga0316582_0406751 3300036647 Bacteria 938
162 Ga0316584_0336992 3300036712 Bacteria 1085
163 Ga0316584_0490671 3300036712 Bacteria 864
164 Ga0400484_17891 3300038725 Bacteria 1773
165 Ga0400484_44988 3300038725 Bacteria 11944
166 Ga0400490_14230 3300038726 Bacteria 1654
167 Ga0400490_27062 3300038726 Bacteria 2153
168 Ga0400490_61360 3300038726 Unclassified 1484
169 Ga0400488_13516 3300038741 Bacteria 1437
170 Ga0400486_05362 3300038742 Unclassified 1409
171 Ga0400486_19400 3300038742 Bacteria 1969
172 Ga0400483_034872 3300039062 Unclassified 1564
173 Ga0400483_059744 3300039062 Unclassified 1233
174 Ga0400483_060246 3300039062 Bacteria 4391
175 Ga0400483_126355 3300039062 Bacteria 20764
176 Ga0400483_188111 3300039062 Unclassified 1534
177 Ga0400483_239883 3300039062 Bacteria 12110
178 Ga0400483_255563 3300039062 Bacteria 18141
179 Ga0400483_284775 3300039062 Bacteria 38019
180 Ga0400489_37742 3300039093 Bacteria 57008
181 Ga0400489_54794 3300039093 Bacteria 3370
182 Ga0436360_0217294 3300039438 Unclassified 1000
183 Ga0436360_0441795 3300039438 Bacteria 4665
184 Ga0436361_0508114 3300039447 Bacteria 767
185 Ga0436363_1638583 3300039450 Bacteria 1038
186 Ga0436362_0803905 3300039453 Unclassified 636
187 Ga0436362_0933957 3300039453 Bacteria 2424
188 Ga0439438_175882 3300041405 Bacteria 509
189 Ga0451787_204256 3300041441 Bacteria 890
190 Ga0451789_0391636 3300041443 Bacteria 1747
191 Ga0451791_0426488 3300041451 Bacteria 1143
192 Ga0451802_0796272 3300041460 Bacteria 1018
193 Ga0451807_1512998 3300041486 Bacteria 773
194 Ga0451833_0594143 3300041491 Bacteria 1324
195 Ga0451851_0541899 3300041507 Bacteria 891
196 Ga0451853_1571654 3300041512 Bacteria 616
197 Ga0439431_0016134 3300041997 Bacteria 1745
198 Ga0439441_004555 3300042001 Bacteria 2109
199 Ga0439432_012070 3300042006 Bacteria 2964
200 Ga0439449_0006023 3300042007 Bacteria 4631
201 Ga0439446_0018673 3300042156 Unclassified 1945
202 Ga0439446_0051814 3300042156 Bacteria 1227
203 Ga0450893_0021760 3300042532 Bacteria 1108
204 Ga0453683_0256463 3300044673 Unclassified 1115
205 Ga0453684_0002251 3300044712 Bacteria 47800
206 Ga0453684_0005750 3300044712 Bacteria 24231
207 Ga0453684_0066572 3300044712 Unclassified 4586
208 Ga0453684_0176870 3300044712 Bacteria 2509
209 Ga0453684_0194486 3300044712 Bacteria 2370
210 Ga0453684_0421416 3300044712 Unclassified 1491
211 Ga0495592_0189648 3300046454 Unclassified 1394
212 Ga0495592_0624271 3300046454 Bacteria 655
213 Ga0495638_0000399 3300046460 Bacteria 53351
214 Ga0495638_0431447 3300046460 Bacteria 677
215 Ga0495651_0239088 3300046462 Bacteria 1247
216 Ga0495605_0164951 3300046474 Bacteria 982
217 Ga0495664_0026858 3300046477 Bacteria 3355
218 Ga0495616_0335231 3300046513 Bacteria 632
219 Ga0495618_0170889 3300046514 Unclassified 1383
220 Ga0495618_0273677 3300046514 Bacteria 1055
221 Ga0495628_0048008 3300046516 Bacteria 3385
222 Ga0495630_0093877 3300046517 Unclassified 2268
223 Ga0495637_0210494 3300046520 Bacteria 711
224 Ga0495663_0105898 3300046525 Bacteria 930
225 Ga0495642_0251200 3300046528 Bacteria 773
226 Ga0495640_0950119 3300046533 Bacteria 508
227 Ga0495621_0005805 3300046539 Bacteria 3568
228 Ga0495597_0380320 3300046542 Bacteria 538
229 Ga0495645_0006278 3300046543 Bacteria 8242
230 Ga0495667_0021859 3300046559 Bacteria 4313
231 Ga0495656_0000056 3300046615 Bacteria 53530
232 Ga0495668_0054059 3300046616 Bacteria 2220
233 Ga0495668_0242665 3300046616 Bacteria 986
234 Ga0495625_0151517 3300046660 Bacteria 1558
235 Ga0495625_0295901 3300046660 Bacteria 1037
236 Ga0495657_0060784 3300046675 Bacteria 2502
237 Ga0495649_0053144 3300046694 Bacteria 2194
238 Ga0495660_0089838 3300046810 Bacteria 1599
239 Ga0495604_0005399 3300047317 Bacteria 10140
240 Ga0495674_0029894 3300047319 Plasmid 4957
241 Ga0495680_0153418 3300047322 Unclassified 1677
242 Ga0495687_048552 3300047443 Bacteria 1820
243 Ga0495675_0028047 3300047444 Bacteria 3589
244 Ga0495685_208031 3300047447 Bacteria 626
245 Ga0495681_0150023 3300047470 Bacteria 979
246 Ga0495684_0168744 3300047471 Unclassified 1629
247 Ga0495686_0351286 3300047472 Bacteria 801
248 Ga0495602_0000922 3300048088 Bacteria 28382
249 Ga0495615_0043192 3300048090 Bacteria 1133
250 Ga0496101_0244742 3300048904 Bacteria 1396
251 Ga0496104_0571679 3300048907 Bacteria 1041
252 Ga0496106_1099581 3300048909 Bacteria 623
253 Ga0496112_0400833 3300048915 Unclassified 1312
254 Ga0496114_0639912 3300048917 Bacteria 936
255 Ga0496118_0460595 3300048921 Bacteria 643
256 Ga0496119_0078496 3300048922 Bacteria 1909
257 Ga0496120_0078154 3300048923 Bacteria 1800
258 Ga0501031_0303300 3300049568 Unclassified 1035
259 Ga0501036_0012007 3300049572 Bacteria 7179
260 Ga0501039_0028643 3300049575 Bacteria 4288
261 Ga0501042_0817731 3300049578 Bacteria 678
262 Ga0501046_0171165 3300049580 Bacteria 1630
263 Ga0501071_0352054 3300049587 Bacteria 1121
264 Ga0501072_0805908 3300049588 Unclassified 735
265 Ga0501076_0270784 3300049592 Bacteria 1391
266 Ga0501077_0191547 3300049593 Unclassified 1299
267 Ga0501217_049029 3300049661 Unclassified 1098
268 Ga0501261_012487 3300049690 Bacteria 1143
269 Ga0501225_0186510 3300049705 Unclassified 651
270 Ga0501080_0750652 3300049742 Unclassified 858
271 Ga0501081_0394408 3300049743 Unclassified 1024
272 Ga0501081_0633167 3300049743 Bacteria 801
273 Ga0501268_075788 3300049765 Unclassified 687
274 Ga0501045_0090705 3300049824 Bacteria 2258
275 nmdc:mga03683_30455_c1 3300050489 Bacteria 2159
276 nmdc:mga03n38_587409_c1 3300050490 Bacteria 633
277 nmdc:mga0yw44_104284_c1 3300050492 Bacteria 1810
278 nmdc:mga0yw44_116181_c1 3300050492 Bacteria 1719
279 nmdc:mga0yw44_62662_c1 3300050492 Bacteria 2285
280 nmdc:mga0yw44_88482_c1 3300050492 Bacteria 1953
281 nmdc:mga0k408_318307_c1 3300050493 Bacteria 928
282 nmdc:mga06z11_193096_c1 3300050494 Bacteria 1179
283 nmdc:mga06z11_327778_c1 3300050494 Bacteria 914
284 nmdc:mga04h51_69813_c1 3300050495 Bacteria 1224
285 nmdc:mga05p37_72226_c1 3300050507 Bacteria 4246
286 nmdc:mga0rr50_1483126_c1 3300050513 Bacteria 573
287 nmdc:mga0sz30_27923_c1 3300050516 Bacteria 1964
288 Ga0495601_0628500 3300053077 Bacteria 688
289 Ga0495612_0002787 3300053078 Bacteria 7232
290 Ga0500610_0110562 3300053079 Bacteria 1413
291 Ga0495655_0115867 3300053083 Bacteria 810
292 Ga0495619_0080063 3300053085 Bacteria 2198
293 Ga0500646_0367716 3300053090 Bacteria 527
294 Ga0500650_0144530 3300053098 Bacteria 1102
295 Ga0500604_0051614 3300053151 Bacteria 1270
296 Ga0500620_001434 3300053155 Bacteria 4396
297 Ga0500627_0058760 3300053158 Bacteria 1688
298 Ga0500611_144480 3300053727 Bacteria 649
299 Ga0500609_040929 3300053731 Bacteria 641
300 Ga0501084_0305787 3300054114 Bacteria 1343
301 Ga0501082_0014921 3300060353 Bacteria 6695
302 Ga0501082_0275453 3300060353 Bacteria 1465
303 Ga0501082_0309896 3300060353 Unclassified 1375
304 Ga0501082_0353653 3300060353 Bacteria 1281
305 Ga0501082_0481478 3300060353 Unclassified 1085
306 Ga0530510_0734149 3300061734 Bacteria 753

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958092219 2958095199 137
2 3300041405 Ga0439438_175882 Ga0439438_175882_32_457 141
3 3300050493 nmdc:mga0k408_318307_c1 nmdc:mga0k408_318307_c1_472_897 141
4 3300013308 Ga0157375_10178518 Ga0157375_101785183 145
5 iso_pu_bacteria 2922130491 2922131918 152
6 iso_pu_bacteria 3004167301 3004171833 153
7 3300036401 Ga0373937_1229540 Ga0373937_1229540_108_587 155
8 3300039093 Ga0400489_37742 Ga0400489_37742_14067_14552 155
9 3300046533 Ga0495640_0950119 Ga0495640_0950119_25_495 156
10 3300003323 rootH1_10154490 rootH1_101544902 157
11 3300005366 Ga0070659_100653058 Ga0070659_1006530582 157
12 3300005536 Ga0070697_100034875 Ga0070697_1000348752 157
13 3300025294 Ga0209025_1032836 Ga0209025_10328362 157
14 3300025297 Ga0209758_1034265 Ga0209758_10342652 157
15 3300031548 Ga0307408_100335904 Ga0307408_1003359042 157
16 3300031731 Ga0307405_10342767 Ga0307405_103427672 157
17 3300039447 Ga0436361_0508114 Ga0436361_0508114_17_490 157
18 3300041441 Ga0451787_204256 Ga0451787_204256_304_777 157
19 3300041512 Ga0451853_1571654 Ga0451853_1571654_86_559 157
20 3300046460 Ga0495638_0000399 Ga0495638_0000399_637_1110 157
21 3300046542 Ga0495597_0380320 Ga0495597_0380320_49_522 157
22 3300047444 Ga0495675_0028047 Ga0495675_0028047_3101_3574 157
23 3300050489 nmdc:mga03683_30455_c1 nmdc:mga03683_30455_c1_29_502 157
24 3300050492 nmdc:mga0yw44_104284_c1 nmdc:mga0yw44_104284_c1_807_1280 157
25 3300053090 Ga0500646_0367716 Ga0500646_0367716_10_483 157
26 3300031727 Ga0316576_10959930 Ga0316576_109599301 158
27 3300039062 Ga0400483_059744 Ga0400483_059744_251_736 158
28 3300039062 Ga0400483_060246 Ga0400483_060246_454_969 158
29 3300039062 Ga0400483_126355 Ga0400483_126355_15421_15936 158
30 3300039062 Ga0400483_188111 Ga0400483_188111_860_1375 158
31 3300039062 Ga0400483_239883 Ga0400483_239883_1769_2296 158
32 3300039062 Ga0400483_255563 Ga0400483_255563_11659_12174 158
33 3300039062 Ga0400483_284775 Ga0400483_284775_19658_20173 158
34 3300049572 Ga0501036_0012007 Ga0501036_0012007_6675_7163 158
35 3300049575 Ga0501039_0028643 Ga0501039_0028643_17_505 158
36 3300049593 Ga0501077_0191547 Ga0501077_0191547_261_749 158
37 iso_pu_bacteria 2508501127 2509142511 159
38 iso_pu_bacteria 2510461069 2510840888 159
39 iso_pu_bacteria 2513237146 2513924649 159
40 iso_pu_bacteria 2513237305 2514421480 159
41 iso_pu_bacteria 2597489875 2597812040 159
42 iso_pu_bacteria 2599185170 2599416201 159
43 iso_pu_bacteria 2643221688 2644491616 159
44 iso_pu_bacteria 2721755686 2723573896 159
45 iso_pu_bacteria 2838035591 2838036322 159
46 iso_pu_bacteria 2838661181 2838665020 159
47 iso_pu_bacteria 2841734538 2841735556 159
48 iso_pu_bacteria 2856342000 2856343566 159
49 iso_pu_bacteria 2871474448 2871479110 159
50 iso_pu_bacteria 2874123672 2874124686 159
51 iso_pu_bacteria 2878788777 2878793482 159
52 iso_pu_bacteria 2882632389 2882637670 159
53 iso_pu_bacteria 2885312484 2885315449 159
54 iso_pu_bacteria 2888343758 2888344603 159
55 iso_pu_bacteria 2924754689 2924754708 159
56 iso_pu_bacteria 2933016740 2933018734 159
57 iso_pu_bacteria 2937836603 2937842368 159
58 iso_pu_bacteria 2958071322 2958075449 159
59 iso_pu_bacteria 2970524798 2970526330 159
60 iso_pu_bacteria 2970540015 2970545676 159
61 iso_pu_bacteria 8004395343 8004403826 159
62 iso_pu_bacteria 8004633249 8004636429 159
63 iso_pu_bacteria 8055617313 8055618060 159
64 3300044673 Ga0453683_0256463 Ga0453683_0256463_151_651 160
65 iso_pu_bacteria 2512875016 2512932758 160
66 iso_pu_bacteria 2512875024 2512959619 160
67 iso_pu_bacteria 2599185301 2599937748 160
68 iso_pu_bacteria 2643221595 2643987829 160
69 iso_pu_bacteria 2643221627 2644156559 160
70 iso_pu_bacteria 2791355123 2792752527 160
71 iso_pu_bacteria 2844009547 2844016209 160
72 iso_pu_bacteria 2856320880 2856326819 160
73 iso_pu_bacteria 2856364286 2856367067 160
74 iso_pu_bacteria 2857349434 2857351375 160
75 iso_pu_bacteria 2869162929 2869163958 160
76 iso_pu_bacteria 2869234852 2869237058 160
77 iso_pu_bacteria 2869256925 2869259312 160
78 iso_pu_bacteria 2869278585 2869283630 160
79 iso_pu_bacteria 2869285874 2869287397 160
80 iso_pu_bacteria 2871429161 2871430489 160
81 iso_pu_bacteria 2871488783 2871492577 160
82 iso_pu_bacteria 2874109183 2874115040 160
83 iso_pu_bacteria 2874139085 2874143674 160
84 iso_pu_bacteria 2874146452 2874148977 160
85 iso_pu_bacteria 2874155637 2874155981 160
86 iso_pu_bacteria 2874168670 2874169511 160
87 iso_pu_bacteria 2876363079 2876364990 160
88 iso_pu_bacteria 2876369609 2876370050 160
89 iso_pu_bacteria 2876413966 2876415548 160
90 iso_pu_bacteria 2878730984 2878735642 160
91 iso_pu_bacteria 2878738818 2878738939 160
92 iso_pu_bacteria 2878745973 2878746921 160
93 iso_pu_bacteria 2878753008 2878758459 160
94 iso_pu_bacteria 2881147464 2881154752 160
95 iso_pu_bacteria 2881155292 2881158329 160
96 iso_pu_bacteria 2881161766 2881166676 160
97 iso_pu_bacteria 2881845957 2881852272 160
98 iso_pu_bacteria 2881853255 2881855525 160
99 iso_pu_bacteria 2882912400 2882919496 160
100 iso_pu_bacteria 2885305155 2885311018 160
101 iso_pu_bacteria 2885318864 2885322829 160
102 iso_pu_bacteria 2885326080 2885332220 160
103 iso_pu_bacteria 2885334103 2885340123 160
104 iso_pu_bacteria 2888337043 2888338876 160
105 iso_pu_bacteria 2888350351 2888354959 160
106 iso_pu_bacteria 2889016732 2889018394 160
107 iso_pu_bacteria 2903448605 2903449997 160
108 iso_pu_bacteria 2903492973 2903496692 160
109 iso_pu_bacteria 2903492973 2903504377 160
110 iso_pu_bacteria 2903513507 2903513530 160
111 iso_pu_bacteria 2903521522 2903522275 160
112 iso_pu_bacteria 2903528002 2903528653 160
113 iso_pu_bacteria 2904659560 2904664548 160
114 iso_pu_bacteria 2906308376 2906309939 160
115 iso_pu_bacteria 2906321335 2906322370 160
116 iso_pu_bacteria 2906354277 2906359952 160
117 iso_pu_bacteria 2922185730 2922192430 160
118 iso_pu_bacteria 2924710171 2924713085 160
119 iso_pu_bacteria 2924733363 2924739906 160
120 iso_pu_bacteria 2924762789 2924765928 160
121 iso_pu_bacteria 2924776078 2924776301 160
122 iso_pu_bacteria 2937813078 2937815136 160
123 iso_pu_bacteria 2937822353 2937823396 160
124 iso_pu_bacteria 2937848649 2937851103 160
125 iso_pu_bacteria 2937877337 2937884241 160
126 iso_pu_bacteria 2937972304 2937979656 160
127 iso_pu_bacteria 2958034702 2958040142 160
128 iso_pu_bacteria 2958041894 2958054486 160
129 iso_pu_bacteria 2958084443 2958091552 160
130 iso_pu_bacteria 2958100919 2958103250 160
131 iso_pu_bacteria 2958130278 2958131682 160
132 iso_pu_bacteria 2958144490 2958148451 160
133 iso_pu_bacteria 2958172287 2958174854 160
134 iso_pu_bacteria 2958179912 2958180754 160
135 iso_pu_bacteria 2961077736 2961078591 160
136 iso_pu_bacteria 2961114664 2961119547 160
137 iso_pu_bacteria 2961127735 2961129604 160
138 iso_pu_bacteria 2961170736 2961173347 160
139 iso_pu_bacteria 2963644680 2963646445 160
140 iso_pu_bacteria 2965119406 2965119959 160
141 iso_pu_bacteria 2967996073 2967998518 160
142 iso_pu_bacteria 2968003550 2968006056 160
143 iso_pu_bacteria 2968016561 2968018983 160
144 iso_pu_bacteria 2968083720 2968090756 160
145 iso_pu_bacteria 2968110612 2968115802 160
146 iso_pu_bacteria 2968138860 2968144978 160
147 iso_pu_bacteria 2970469710 2970470844 160
148 iso_pu_bacteria 2970489779 2970490727 160
149 iso_pu_bacteria 2970503327 2970505940 160
150 iso_pu_bacteria 2970510686 2970510960 160
151 iso_pu_bacteria 2970593180 2970597945 160
152 iso_pu_bacteria 2970619444 2970622213 160
153 iso_pu_bacteria 2977821940 2977826992 160
154 iso_pu_bacteria 2977828996 2977835246 160
155 iso_pu_bacteria 2977843712 2977845719 160
156 iso_pu_bacteria 2977864932 2977865967 160
157 iso_pu_bacteria 2977898635 2977904429 160
158 iso_pu_bacteria 2977922695 2977923441 160
159 iso_pu_bacteria 2977942078 2977945992 160
160 iso_pu_bacteria 2977971508 2977979017 160
161 iso_pu_bacteria 2979710463 2979712987 160
162 iso_pu_bacteria 2979742915 2979752148 160
163 iso_pu_bacteria 2979808191 2979810661 160
164 iso_pu_bacteria 2987636660 2987638559 160
165 iso_pu_bacteria 2987652177 2987656589 160
166 iso_pu_bacteria 2987666974 2987673254 160
167 iso_pu_bacteria 2996348954 2996356620 160
168 iso_pu_bacteria 2996386984 2996391023 160
169 iso_pu_bacteria 3000135777 3000140862 160
170 iso_pu_bacteria 3004203850 3004205198 160
171 iso_pu_bacteria 3004211236 3004212745 160
172 iso_pu_bacteria 3004218560 3004221435 160
173 iso_pu_bacteria 3004232784 3004239740 160
174 iso_pu_bacteria 3004268573 3004268600 160
175 iso_pu_bacteria 3004275668 3004282923 160
176 iso_pu_bacteria 3004289098 3004294612 160
177 iso_pu_bacteria 8004312739 8004313219 160
178 iso_pu_bacteria 8004374579 8004379975 160
179 iso_pu_bacteria 8004387939 8004389378 160
180 iso_pu_bacteria 8004714634 8004716085 160
181 3300038725 Ga0400484_17891 Ga0400484_17891_1036_1539 161
182 3300038725 Ga0400484_44988 Ga0400484_44988_10950_11459 161
183 3300038726 Ga0400490_14230 Ga0400490_14230_1119_1628 161
184 3300038726 Ga0400490_61360 Ga0400490_61360_971_1474 161
185 3300038742 Ga0400486_05362 Ga0400486_05362_121_630 161
186 3300038742 Ga0400486_19400 Ga0400486_19400_211_714 161
187 3300044712 Ga0453684_0421416 Ga0453684_0421416_958_1464 161
188 3300038726 Ga0400490_27062 Ga0400490_27062_833_1360 162
189 3300038741 Ga0400488_13516 Ga0400488_13516_189_716 162
190 3300044712 Ga0453684_0002251 Ga0453684_0002251_10944_11465 162
191 3300005617 Ga0068859_100184676 Ga0068859_1001846761 163
192 3300006880 Ga0075429_101157105 Ga0075429_1011571051 163
193 3300006931 Ga0097620_100184674 Ga0097620_1001846741 163
194 3300031691 Ga0316579_10042166 Ga0316579_100421662 163
195 3300031733 Ga0316577_10212548 Ga0316577_102125482 163
196 3300031824 Ga0307413_10048349 Ga0307413_100483492 163
197 3300032168 Ga0316593_10122711 Ga0316593_101227112 163
198 3300036647 Ga0316582_0077646 Ga0316582_0077646_1544_2059 163
199 3300036647 Ga0316582_0327327 Ga0316582_0327327_13_540 163
200 3300036647 Ga0316582_0406751 Ga0316582_0406751_301_867 163
201 3300039062 Ga0400483_034872 Ga0400483_034872_356_940 163
202 3300039093 Ga0400489_54794 Ga0400489_54794_2800_3321 163
203 3300039093 Ga0400489_54794 Ga0400489_54794_755_1270 163
204 3300044712 Ga0453684_0066572 Ga0453684_0066572_3033_3569 163
205 3300044712 Ga0453684_0176870 Ga0453684_0176870_562_1098 163
206 3300044712 Ga0453684_0194486 Ga0453684_0194486_499_1008 163
207 3300049578 Ga0501042_0817731 Ga0501042_0817731_94_585 163
208 3300060353 Ga0501082_0014921 Ga0501082_0014921_2788_3279 163
209 3300002987 JGI25159J45721_1035802 JGI25159J45721_10358022 164
210 3300003322 rootL2_10015679 rootL2_100156795 164
211 3300005295 Ga0065707_10220117 Ga0065707_102201172 164
212 3300005328 Ga0070676_10395055 Ga0070676_103950552 164
213 3300005331 Ga0070670_100527295 Ga0070670_1005272952 164
214 3300005333 Ga0070677_10036803 Ga0070677_100368032 164
215 3300005335 Ga0070666_10145296 Ga0070666_101452962 164
216 3300005335 Ga0070666_10178200 Ga0070666_101782002 164
217 3300005353 Ga0070669_100136954 Ga0070669_1001369542 164
218 3300005356 Ga0070674_100199823 Ga0070674_1001998232 164
219 3300005356 Ga0070674_100302518 Ga0070674_1003025182 164
220 3300005364 Ga0070673_100231215 Ga0070673_1002312152 164
221 3300005367 Ga0070667_100194690 Ga0070667_1001946902 164
222 3300005367 Ga0070667_101284556 Ga0070667_1012845562 164
223 3300005455 Ga0070663_100572561 Ga0070663_1005725612 164
224 3300005456 Ga0070678_100273675 Ga0070678_1002736752 164
225 3300005457 Ga0070662_100841606 Ga0070662_1008416062 164
226 3300005459 Ga0068867_100609638 Ga0068867_1006096382 164
227 3300005459 Ga0068867_100922721 Ga0068867_1009227212 164
228 3300005471 Ga0070698_100202537 Ga0070698_1002025372 164
229 3300005539 Ga0068853_100223356 Ga0068853_1002233562 164
230 3300005548 Ga0070665_100423119 Ga0070665_1004231192 164
231 3300005548 Ga0070665_100595304 Ga0070665_1005953042 164
232 3300005564 Ga0070664_101206952 Ga0070664_1012069522 164
233 3300005577 Ga0068857_100473645 Ga0068857_1004736452 164
234 3300005719 Ga0068861_101029095 Ga0068861_1010290951 164
235 3300005937 Ga0081455_10345220 Ga0081455_103452201 164
236 3300005983 Ga0081540_1031760 Ga0081540_10317602 164
237 3300006038 Ga0075365_10012997 Ga0075365_100129972 164
238 3300006038 Ga0075365_10017483 Ga0075365_100174833 164
239 3300006178 Ga0075367_10633879 Ga0075367_106338792 164
240 3300006844 Ga0075428_100674026 Ga0075428_1006740262 164
241 3300006847 Ga0075431_100210137 Ga0075431_1002101371 164
242 3300006847 Ga0075431_100926208 Ga0075431_1009262082 164
243 3300006871 Ga0075434_100366410 Ga0075434_1003664102 164
244 3300006914 Ga0075436_100070416 Ga0075436_1000704162 164
245 3300007265 Ga0099794_10005964 Ga0099794_100059642 164
246 3300007265 Ga0099794_10012568 Ga0099794_100125684 164
247 3300009093 Ga0105240_10008821 Ga0105240_100088214 164
248 3300009093 Ga0105240_10487891 Ga0105240_104878912 164
249 3300009148 Ga0105243_10706452 Ga0105243_107064522 164
250 3300009177 Ga0105248_10003866 Ga0105248_1000386614 164
251 3300009177 Ga0105248_10637761 Ga0105248_106377612 164
252 3300009177 Ga0105248_10921588 Ga0105248_109215882 164
253 3300009551 Ga0105238_10872169 Ga0105238_108721692 164
254 3300010375 Ga0105239_10479254 Ga0105239_104792542 164
255 3300010375 Ga0105239_10917532 Ga0105239_109175322 164
256 3300013296 Ga0157374_11045526 Ga0157374_110455262 164
257 3300013306 Ga0163162_10401231 Ga0163162_104012312 164
258 3300013308 Ga0157375_10424262 Ga0157375_104242622 164
259 3300013308 Ga0157375_11534529 Ga0157375_115345292 164
260 3300014326 Ga0157380_10281104 Ga0157380_102811042 164
261 3300014497 Ga0182008_10054145 Ga0182008_100541452 164
262 3300014497 Ga0182008_10077637 Ga0182008_100776372 164
263 3300014968 Ga0157379_10823782 Ga0157379_108237821 164
264 3300015262 Ga0182007_10059991 Ga0182007_100599912 164
265 3300015683 Ga0183362_10003 Ga0183362_10003430 164
266 3300017792 Ga0163161_10146306 Ga0163161_101463062 164
267 3300017792 Ga0163161_10381932 Ga0163161_103819322 164
268 3300020082 Ga0206353_11251689 Ga0206353_112516892 164
269 3300021441 Ga0213871_10010143 Ga0213871_100101432 164
270 3300025893 Ga0207682_10092429 Ga0207682_100924292 164
271 3300025903 Ga0207680_10130891 Ga0207680_101308912 164
272 3300025904 Ga0207647_10145758 Ga0207647_101457581 164
273 3300025907 Ga0207645_10082644 Ga0207645_100826442 164
274 3300025908 Ga0207643_10305840 Ga0207643_103058402 164
275 3300025913 Ga0207695_10279949 Ga0207695_102799492 164
276 3300025914 Ga0207671_10374666 Ga0207671_103746662 164
277 3300025923 Ga0207681_10294767 Ga0207681_102947672 164
278 3300025933 Ga0207706_10775179 Ga0207706_107751792 164
279 3300025937 Ga0207669_10228106 Ga0207669_102281062 164
280 3300025940 Ga0207691_10126757 Ga0207691_101267572 164
281 3300025941 Ga0207711_10355475 Ga0207711_103554751 164
282 3300025960 Ga0207651_10194925 Ga0207651_101949252 164
283 3300025972 Ga0207668_10432038 Ga0207668_104320382 164
284 3300025972 Ga0207668_11505610 Ga0207668_115056101 164
285 3300025986 Ga0207658_10449131 Ga0207658_104491312 164
286 3300026041 Ga0207639_10310103 Ga0207639_103101032 164
287 3300026089 Ga0207648_10671994 Ga0207648_106719942 164
288 3300026089 Ga0207648_11337970 Ga0207648_113379701 164
289 3300026121 Ga0207683_10316282 Ga0207683_103162822 164
290 3300027866 Ga0209813_10091410 Ga0209813_100914101 164
291 3300028379 Ga0268266_10437558 Ga0268266_104375582 164
292 3300028379 Ga0268266_10515057 Ga0268266_105150572 164
293 3300028379 Ga0268266_10909219 Ga0268266_109092192 164
294 3300028794 Ga0307515_10000152 Ga0307515_1000015235 164
295 3300031251 Ga0265327_10000201 Ga0265327_1000020133 164
296 3300031548 Ga0307408_100583339 Ga0307408_1005833391 164
297 3300031733 Ga0316577_10046759 Ga0316577_100467592 164
298 3300031733 Ga0316577_10086120 Ga0316577_100861202 164
299 3300031733 Ga0316577_10098637 Ga0316577_100986372 164
300 3300031911 Ga0307412_10223555 Ga0307412_102235552 164
301 3300031911 Ga0307412_11639709 Ga0307412_116397091 164
302 3300032004 Ga0307414_10398411 Ga0307414_103984112 164
303 3300035119 Ga0373956_0111122 Ga0373956_0111122_200_703 164
304 3300035120 Ga0373957_0092560 Ga0373957_0092560_573_1076 164
305 3300035724 Ga0373933_0015709 Ga0373933_0015709_1262_1765 164
306 3300036401 Ga0373937_0009490 Ga0373937_0009490_3582_4085 164
307 3300036401 Ga0373937_1806192 Ga0373937_1806192_16_516 164
308 3300036712 Ga0316584_0336992 Ga0316584_0336992_392_910 164
309 3300036712 Ga0316584_0490671 Ga0316584_0490671_301_840 164
310 3300039438 Ga0436360_0217294 Ga0436360_0217294_300_794 164
311 3300039438 Ga0436360_0441795 Ga0436360_0441795_3195_3698 164
312 3300039450 Ga0436363_1638583 Ga0436363_1638583_518_1021 164
313 3300039453 Ga0436362_0803905 Ga0436362_0803905_20_514 164
314 3300039453 Ga0436362_0933957 Ga0436362_0933957_144_647 164
315 3300041443 Ga0451789_0391636 Ga0451789_0391636_594_1088 164
316 3300041451 Ga0451791_0426488 Ga0451791_0426488_303_797 164
317 3300041460 Ga0451802_0796272 Ga0451802_0796272_309_803 164
318 3300041486 Ga0451807_1512998 Ga0451807_1512998_267_761 164
319 3300041491 Ga0451833_0594143 Ga0451833_0594143_732_1226 164
320 3300041507 Ga0451851_0541899 Ga0451851_0541899_263_757 164
321 3300041997 Ga0439431_0016134 Ga0439431_0016134_182_676 164
322 3300042001 Ga0439441_004555 Ga0439441_004555_161_655 164
323 3300042006 Ga0439432_012070 Ga0439432_012070_1820_2314 164
324 3300042007 Ga0439449_0006023 Ga0439449_0006023_1278_1772 164
325 3300042156 Ga0439446_0051814 Ga0439446_0051814_407_901 164
326 3300042532 Ga0450893_0021760 Ga0450893_0021760_585_1079 164
327 3300046454 Ga0495592_0189648 Ga0495592_0189648_590_1093 164
328 3300046454 Ga0495592_0624271 Ga0495592_0624271_134_628 164
329 3300046460 Ga0495638_0431447 Ga0495638_0431447_149_643 164
330 3300046462 Ga0495651_0239088 Ga0495651_0239088_612_1106 164
331 3300046474 Ga0495605_0164951 Ga0495605_0164951_410_904 164
332 3300046477 Ga0495664_0026858 Ga0495664_0026858_2039_2542 164
333 3300046513 Ga0495616_0335231 Ga0495616_0335231_63_557 164
334 3300046514 Ga0495618_0170889 Ga0495618_0170889_723_1226 164
335 3300046514 Ga0495618_0273677 Ga0495618_0273677_382_876 164
336 3300046516 Ga0495628_0048008 Ga0495628_0048008_1292_1795 164
337 3300046517 Ga0495630_0093877 Ga0495630_0093877_940_1434 164
338 3300046520 Ga0495637_0210494 Ga0495637_0210494_40_534 164
339 3300046525 Ga0495663_0105898 Ga0495663_0105898_20_514 164
340 3300046528 Ga0495642_0251200 Ga0495642_0251200_154_648 164
341 3300046539 Ga0495621_0005805 Ga0495621_0005805_444_938 164
342 3300046543 Ga0495645_0006278 Ga0495645_0006278_1401_1904 164
343 3300046559 Ga0495667_0021859 Ga0495667_0021859_2889_3392 164
344 3300046615 Ga0495656_0000056 Ga0495656_0000056_21217_21711 164
345 3300046616 Ga0495668_0054059 Ga0495668_0054059_761_1255 164
346 3300046616 Ga0495668_0242665 Ga0495668_0242665_170_664 164
347 3300046660 Ga0495625_0151517 Ga0495625_0151517_110_604 164
348 3300046660 Ga0495625_0295901 Ga0495625_0295901_411_905 164
349 3300046675 Ga0495657_0060784 Ga0495657_0060784_1453_1956 164
350 3300046694 Ga0495649_0053144 Ga0495649_0053144_636_1130 164
351 3300046810 Ga0495660_0089838 Ga0495660_0089838_395_889 164
352 3300047317 Ga0495604_0005399 Ga0495604_0005399_6110_6613 164
353 3300047319 Ga0495674_0029894 Ga0495674_0029894_4141_4644 164
354 3300047322 Ga0495680_0153418 Ga0495680_0153418_98_601 164
355 3300047443 Ga0495687_048552 Ga0495687_048552_855_1349 164
356 3300047447 Ga0495685_208031 Ga0495685_208031_60_554 164
357 3300047470 Ga0495681_0150023 Ga0495681_0150023_121_615 164
358 3300047471 Ga0495684_0168744 Ga0495684_0168744_422_925 164
359 3300047472 Ga0495686_0351286 Ga0495686_0351286_269_763 164
360 3300048088 Ga0495602_0000922 Ga0495602_0000922_26458_26961 164
361 3300048090 Ga0495615_0043192 Ga0495615_0043192_292_786 164
362 3300048904 Ga0496101_0244742 Ga0496101_0244742_366_860 164
363 3300048907 Ga0496104_0571679 Ga0496104_0571679_411_905 164
364 3300048909 Ga0496106_1099581 Ga0496106_1099581_21_515 164
365 3300048915 Ga0496112_0400833 Ga0496112_0400833_557_1060 164
366 3300048917 Ga0496114_0639912 Ga0496114_0639912_264_758 164
367 3300048921 Ga0496118_0460595 Ga0496118_0460595_97_591 164
368 3300048922 Ga0496119_0078496 Ga0496119_0078496_380_874 164
369 3300048923 Ga0496120_0078154 Ga0496120_0078154_1239_1733 164
370 3300049580 Ga0501046_0171165 Ga0501046_0171165_47_541 164
371 3300049587 Ga0501071_0352054 Ga0501071_0352054_313_807 164
372 3300049592 Ga0501076_0270784 Ga0501076_0270784_856_1350 164
373 3300049742 Ga0501080_0750652 Ga0501080_0750652_69_599 164
374 3300049743 Ga0501081_0394408 Ga0501081_0394408_83_613 164
375 3300049743 Ga0501081_0633167 Ga0501081_0633167_62_556 164
376 3300049824 Ga0501045_0090705 Ga0501045_0090705_678_1172 164
377 3300050490 nmdc:mga03n38_587409_c1 nmdc:mga03n38_587409_c1_10_504 164
378 3300050492 nmdc:mga0yw44_116181_c1 nmdc:mga0yw44_116181_c1_121_624 164
379 3300050492 nmdc:mga0yw44_62662_c1 nmdc:mga0yw44_62662_c1_795_1289 164
380 3300050492 nmdc:mga0yw44_88482_c1 nmdc:mga0yw44_88482_c1_1023_1517 164
381 3300050494 nmdc:mga06z11_193096_c1 nmdc:mga06z11_193096_c1_666_1160 164
382 3300050494 nmdc:mga06z11_327778_c1 nmdc:mga06z11_327778_c1_29_523 164
383 3300050495 nmdc:mga04h51_69813_c1 nmdc:mga04h51_69813_c1_55_549 164
384 3300050513 nmdc:mga0rr50_1483126_c1 nmdc:mga0rr50_1483126_c1_33_530 164
385 3300050516 nmdc:mga0sz30_27923_c1 nmdc:mga0sz30_27923_c1_475_969 164
386 3300053077 Ga0495601_0628500 Ga0495601_0628500_125_619 164
387 3300053078 Ga0495612_0002787 Ga0495612_0002787_639_1142 164
388 3300053079 Ga0500610_0110562 Ga0500610_0110562_253_747 164
389 3300053083 Ga0495655_0115867 Ga0495655_0115867_92_586 164
390 3300053085 Ga0495619_0080063 Ga0495619_0080063_725_1228 164
391 3300053098 Ga0500650_0144530 Ga0500650_0144530_454_948 164
392 3300053151 Ga0500604_0051614 Ga0500604_0051614_443_937 164
393 3300053155 Ga0500620_001434 Ga0500620_001434_1941_2435 164
394 3300053158 Ga0500627_0058760 Ga0500627_0058760_296_790 164
395 3300053727 Ga0500611_144480 Ga0500611_144480_145_639 164
396 3300053731 Ga0500609_040929 Ga0500609_040929_18_512 164
397 3300054114 Ga0501084_0305787 Ga0501084_0305787_665_1159 164
398 3300060353 Ga0501082_0275453 Ga0501082_0275453_83_577 164
399 3300060353 Ga0501082_0353653 Ga0501082_0353653_654_1184 164
400 3300061734 Ga0530510_0734149 Ga0530510_0734149_40_534 164
401 iso_pu_bacteria 637000159 637075843 164
402 3300002459 JGI24751J29686_10052790 JGI24751J29686_100527901 165
403 3300005331 Ga0070670_100008304 Ga0070670_1000083042 165
404 3300005331 Ga0070670_100021270 Ga0070670_1000212707 165
405 3300005354 Ga0070675_100000509 Ga0070675_1000005094 165
406 3300005455 Ga0070663_100413464 Ga0070663_1004134642 165
407 3300005468 Ga0070707_101277828 Ga0070707_1012778281 165
408 3300005545 Ga0070695_100273535 Ga0070695_1002735352 165
409 3300005545 Ga0070695_100363652 Ga0070695_1003636522 165
410 3300005564 Ga0070664_100649810 Ga0070664_1006498102 165
411 3300005577 Ga0068857_100141873 Ga0068857_1001418731 165
412 3300005617 Ga0068859_100053849 Ga0068859_1000538493 165
413 3300005617 Ga0068859_100122983 Ga0068859_1001229833 165
414 3300005618 Ga0068864_100156583 Ga0068864_1001565832 165
415 3300006880 Ga0075429_100034792 Ga0075429_1000347922 165
416 3300006931 Ga0097620_100053851 Ga0097620_1000538513 165
417 3300006931 Ga0097620_100122977 Ga0097620_1001229773 165
418 3300007265 Ga0099794_10012024 Ga0099794_100120245 165
419 3300007265 Ga0099794_10098979 Ga0099794_100989791 165
420 3300007265 Ga0099794_10182135 Ga0099794_101821352 165
421 3300009094 Ga0111539_10901245 Ga0111539_109012452 165
422 3300009147 Ga0114129_10075137 Ga0114129_100751373 165
423 3300009177 Ga0105248_10320419 Ga0105248_103204192 165
424 3300014325 Ga0163163_10022509 Ga0163163_100225093 165
425 3300014325 Ga0163163_10102383 Ga0163163_101023832 165
426 3300014326 Ga0157380_11238214 Ga0157380_112382141 165
427 3300014745 Ga0157377_10063294 Ga0157377_100632942 165
428 3300014968 Ga0157379_10080077 Ga0157379_100800772 165
429 3300025925 Ga0207650_10035619 Ga0207650_100356192 165
430 3300025925 Ga0207650_10158738 Ga0207650_101587382 165
431 3300025926 Ga0207659_10008640 Ga0207659_100086406 165
432 3300025941 Ga0207711_10300076 Ga0207711_103000762 165
433 3300026095 Ga0207676_10010429 Ga0207676_100104296 165
434 3300027682 Ga0209971_1031854 Ga0209971_10318542 165
435 3300027695 Ga0209966_1007326 Ga0209966_10073262 165
436 3300031247 Ga0265340_10356969 Ga0265340_103569691 165
437 3300031731 Ga0307405_10047490 Ga0307405_100474903 165
438 3300031852 Ga0307410_10221927 Ga0307410_102219272 165
439 3300031903 Ga0307407_10028340 Ga0307407_100283403 165
440 3300031911 Ga0307412_10044716 Ga0307412_100447163 165
441 3300032002 Ga0307416_100361207 Ga0307416_1003612071 165
442 3300032004 Ga0307414_10039227 Ga0307414_100392273 165
443 3300032005 Ga0307411_10233034 Ga0307411_102330343 165
444 3300042156 Ga0439446_0018673 Ga0439446_0018673_380_883 165
445 3300044712 Ga0453684_0005750 Ga0453684_0005750_4604_5131 165
446 3300049568 Ga0501031_0303300 Ga0501031_0303300_79_591 165
447 3300049588 Ga0501072_0805908 Ga0501072_0805908_159_662 165
448 3300049661 Ga0501217_049029 Ga0501217_049029_349_846 165
449 3300049690 Ga0501261_012487 Ga0501261_012487_81_617 165
450 3300049705 Ga0501225_0186510 Ga0501225_0186510_40_537 165
451 3300049765 Ga0501268_075788 Ga0501268_075788_87_584 165
452 3300050507 nmdc:mga05p37_72226_c1 nmdc:mga05p37_72226_c1_2133_2630 165
453 3300060353 Ga0501082_0309896 Ga0501082_0309896_188_715 165
454 3300060353 Ga0501082_0481478 Ga0501082_0481478_313_816 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00071

Ras

Ras family

30

194

0.95

PF08477

Roc

Ras of Complex, Roc, domain of DAPkinase

30

147

0.93

PF04670

Gtr1_RagA

Gtr1/RagA G protein conserved region

30

164

0.85

PF00025

Arf

ADP-ribosylation factor family

16

191

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fg5-assembly1.cif.gz_A crystal structure of human rab31 in complex with a gtp analogue 0.9352 1 158
1n6k-assembly1.cif.gz_A crystal structure of human rab5a a30p mutant complex with gdp and aluminum fluoride 0.9305 2 159
7bl1-assembly1.cif.gz_DDD human complex ii-bats bound to membrane-attached rab5a-gtp 0.9305 2 159
1n6n-assembly1.cif.gz_A crystal structure of human rab5a a30r mutant complex with gppnhp 0.9302 2 159
2bme-assembly2.cif.gz_B high resolution structure of gppnhp-bound human rab4a 0.9301 1 164
ID Description Score Start End Superfamily
af_Q6PHN9_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9361 1 164 3.40.50.300
af_Q22045_4_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9361 2 164 3.40.50.300
af_Q4CRV8_1_196_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9311 1 164 3.40.50.300
af_Q4DSV2_4_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9292 2 164 3.40.50.300
af_P35285_3_194_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9285 1 162 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A316U9R0-F1-model_v4 Ras-domain-containing protein 0.9459 6 126 GO:0003924
GO:0005525
AF-A0A5K1B7R9-F1-model_v4 Uncharacterized protein 0.9428 2 63 GO:0003924
GO:0005525
AF-A0A4Q2E0N8-F1-model_v4 GTP-binding protein 0.9426 2 123 GO:0003924
GO:0005525
GO:0005886
GO:0007165
GO:0012505
AF-A0A4X2JMT1-F1-model_v4 RAB1B, member RAS oncogene family 0.942 2 165 GO:0003924
GO:0005525
GO:0005737
GO:0015031
GO:0016020
AF-A0A2U3VNN7-F1-model_v4 Ras-related protein Rab-35 isoform X2 0.9415 1 112 GO:0003924
GO:0005525

Feature Viewer

pLDDT pTM Quality
88.49 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map