F447413

General Info

Members Datasets Scaffolds Average Seq Length
454 298 377 262

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10239892|Ga0307410_102398922
Length 305
Sequence MPGRADRGNFGNPERTGPAEYGLAGRSCHSVLPPAGQGAPHIGDNSPMPITIKTPDEIEKMRVAGRLAAEVLQVVAPHVKPGVTTAELDRICHDHIVKVQNAIPANVGYKGFPATVCTSVNNVICHGIPSEAKILKDGDIVNIDVTVIKDGWHGDTSRMYFAGTPSVMAKRLVDVTREAMFRGIRTVKPGATLGDIGHAIQQYAEAERFSVVREYCGHGIGRIYHEDPQVLHYGRAGEGLVLKPGMTFTIEPMINEGQRHTKLLPDGWTVVTKDRKLSAQWEHTVAVTETGVEILTRLPGDDNDL

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
6 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
7 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
8 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
9 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
10 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
11 2643221559 Lysobacter sp. Root559 Isolate Unclassified
12 2643221570 Acidovorax sp. Root568 Isolate Unclassified
13 2643221573 Lysobacter sp. Root604 Isolate Unclassified
14 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
15 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
16 2643221586 Lysobacter sp. Root667 Isolate Unclassified
17 2643221593 Lysobacter sp. Root690 Isolate Unclassified
18 2643221596 Acidovorax sp. Root70 Isolate Unclassified
19 2643221612 Lysobacter sp. Root76 Isolate Unclassified
20 2643221638 Duganella sp. Root336D2 Isolate Unclassified
21 2643221652 Acidovorax sp. Root402 Isolate Unclassified
22 2643221695 Lysobacter sp. Root494 Isolate Unclassified
23 2643221717 Acidovorax sp. Root267 Isolate Unclassified
24 2643221720 Lysobacter sp. Root916 Isolate Unclassified
25 2643221727 Lysobacter sp. Root96 Isolate Unclassified
26 2643221728 Lysobacter sp. Root983 Isolate Unclassified
27 2721755523 Delftia sp. HK171 Isolate Unclassified
28 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
29 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
30 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
31 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
32 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
33 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
34 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
35 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
36 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
37 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
38 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
39 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
40 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
41 2865014394 Pantoea sp. R-71966 Isolate Unclassified
42 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
43 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
44 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
45 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
46 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
47 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
48 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
49 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
50 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
51 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
52 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
53 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
54 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
55 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
56 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
57 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
58 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
59 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
60 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
61 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
62 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
63 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
64 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
65 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
66 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
67 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
68 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
69 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
70 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
71 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
72 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
80 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
81 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
82 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
83 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
84 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
91 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
99 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
100 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
101 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
113 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
150 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
197 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
198 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
224 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
225 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
226 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
232 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
294 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
296 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
297 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
298 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.6
Metatranscriptomes 0.44
Isolates 16.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 20.26
Nodule 1.1
Rhizoplane 3.52
Rhizosphere 55.29
Stem 0
Stem Tuber 0
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009349 3300002067 Bacteria 3150
2 JGI24735J21928_10011056 3300002067 Bacteria 2866
3 JGI25162J39368_1001517 3300002737 Bacteria 12031
4 JGI25152J39213_1000018 3300002773 Bacteria 109715
5 JGI25150J39212_1000578 3300002774 Bacteria 14562
6 JGI25151J46595_10000111 3300003187 Bacteria 111802
7 JGI25151J46595_10000253 3300003187 Bacteria 62673
8 JGI25406J46586_10000477 3300003203 Bacteria 18681
9 JGI25153J46596_10000085 3300003215 Bacteria 111802
10 rootH1_10013885 3300003316 Bacteria 2711
11 JGI25161J50226_1001331 3300003374 Bacteria 7624
12 Ga0055526_1000036 3300003771 Bacteria 135235
13 Ga0055526_1000328 3300003771 Bacteria 39221
14 Ga0055537_1000083 3300003773 Bacteria 68713
15 Ga0055537_1003554 3300003773 Bacteria 4763
16 Ga0055537_1004529 3300003773 Bacteria 3959
17 Ga0055524_1000359 3300003775 Bacteria 41002
18 Ga0055536_1001443 3300003781 Bacteria 14353
19 Ga0055536_1001487 3300003781 Bacteria 14092
20 Ga0055536_1004015 3300003781 Bacteria 7680
21 Ga0055536_1010019 3300003781 Bacteria 3828
22 Ga0055534_1000089 3300003784 Bacteria 71523
23 Ga0055534_1000103 3300003784 Bacteria 65838
24 Ga0055534_1008103 3300003784 Bacteria 2420
25 Ga0055528_1000004 3300003790 Bacteria 285772
26 Ga0055528_1000585 3300003790 Bacteria 27488
27 Ga0055528_1002210 3300003790 Bacteria 10634
28 Ga0055528_1002781 3300003790 Bacteria 9162
29 Ga0055530_10000996 3300003791 Bacteria 22669
30 Ga0055530_10001891 3300003791 Bacteria 14362
31 Ga0055530_10004209 3300003791 Bacteria 7564
32 Ga0055530_10004656 3300003791 Bacteria 6962
33 Ga0055531_10003226 3300003794 Bacteria 10462
34 Ga0055531_10004626 3300003794 Bacteria 8271
35 Ga0055531_10009980 3300003794 Bacteria 4786
36 Ga0055531_10012159 3300003794 Bacteria 4075
37 Ga0055531_10023325 3300003794 Bacteria 2325
38 Ga0058692_1000002 3300003856 Bacteria 508401
39 Ga0058692_1000216 3300003856 Bacteria 34036
40 Ga0055543_1001333 3300004625 Bacteria 10072
41 Ga0065714_10070932 3300005288 Bacteria 3725
42 Ga0065704_10002263 3300005289 Bacteria 6652
43 Ga0065704_10104025 3300005289 Bacteria 2154
44 Ga0070658_10005116 3300005327 Bacteria 10676
45 Ga0068869_100168001 3300005334 Bacteria 1712
46 Ga0070666_10000012 3300005335 Bacteria 244720
47 Ga0070680_100107942 3300005336 Bacteria 2315
48 Ga0068868_100238121 3300005338 Bacteria 1528
49 Ga0070660_100291050 3300005339 Bacteria 1337
50 Ga0070668_100125520 3300005347 Bacteria 2055
51 Ga0070668_100159682 3300005347 Bacteria 1828
52 Ga0070669_100255525 3300005353 Bacteria 1396
53 Ga0070671_100035768 3300005355 Bacteria 4115
54 Ga0070705_100169611 3300005440 Bacteria 1468
55 Ga0070678_100021379 3300005456 Bacteria 4266
56 Ga0070685_10285839 3300005466 Bacteria 1106
57 Ga0068853_100267566 3300005539 Bacteria 1573
58 Ga0070693_100009436 3300005547 Bacteria 4852
59 Ga0070665_100031214 3300005548 Bacteria 5363
60 Ga0070665_100374687 3300005548 Bacteria 1430
61 Ga0070702_100245355 3300005615 Bacteria 1211
62 Ga0068864_100037451 3300005618 Bacteria 4139
63 Ga0068858_100405582 3300005842 Bacteria 1310
64 Ga0081538_10031617 3300005981 Bacteria 3565
65 Ga0081539_10000072 3300005985 Bacteria 232726
66 Ga0075364_10000021 3300006051 Bacteria 53922
67 Ga0075364_10012183 3300006051 Bacteria 5251
68 Ga0075364_10041923 3300006051 Bacteria 2973
69 Ga0075364_10367022 3300006051 Bacteria 981
70 Ga0075362_10060360 3300006177 Bacteria 1714
71 Ga0075367_10033424 3300006178 Bacteria 2964
72 Ga0075366_10128651 3300006195 Bacteria 1528
73 Ga0068871_100502372 3300006358 Bacteria 1093
74 Ga0075434_100208114 3300006871 Bacteria 1977
75 Ga0079104_1000025 3300006946 Bacteria 218785
76 Ga0105251_10000305 3300009011 Bacteria 49239
77 Ga0105251_10005519 3300009011 Bacteria 8237
78 Ga0105251_10050630 3300009011 Bacteria 1983
79 Ga0105251_10130713 3300009011 Bacteria 1138
80 Ga0105244_10044519 3300009036 Bacteria 2286
81 Ga0105244_10092631 3300009036 Bacteria 1485
82 Ga0105250_10005794 3300009092 Bacteria 5494
83 Ga0105250_10006276 3300009092 Bacteria 5213
84 Ga0105243_10000881 3300009148 Bacteria 28283
85 Ga0105243_10159462 3300009148 Bacteria 1944
86 Ga0105241_10334270 3300009174 Bacteria 1310
87 Ga0105242_10047654 3300009176 Bacteria 3480
88 Ga0105248_10362758 3300009177 Bacteria 1631
89 Ga0105238_10000540 3300009551 Bacteria 39588
90 Ga0105148_102738 3300009978 Bacteria 1241
91 Ga0157373_10105995 3300013100 Bacteria 1976
92 Ga0157371_10001165 3300013102 Bacteria 28235
93 Ga0157371_10021987 3300013102 Bacteria 4682
94 Ga0157369_10004928 3300013105 Bacteria 15634
95 Ga0157369_10032030 3300013105 Bacteria 5784
96 Ga0157369_10526540 3300013105 Bacteria 1222
97 Ga0157378_10311586 3300013297 Bacteria 1526
98 Ga0163162_10000444 3300013306 Bacteria 38235
99 Ga0157372_10007235 3300013307 Bacteria 11819
100 Ga0157372_10072115 3300013307 Bacteria 3891
101 Ga0157372_10295811 3300013307 Bacteria 1883
102 Ga0157375_10098641 3300013308 Bacteria 2999
103 Ga0182008_10009029 3300014497 Bacteria 5400
104 Ga0182008_10053644 3300014497 Bacteria 1996
105 Ga0182006_1045175 3300015261 Bacteria 1715
106 Ga0182007_10079772 3300015262 Bacteria 1074
107 Ga0182005_1000932 3300015265 Bacteria 12773
108 Ga0183360_10001 3300015689 Bacteria 3943671
109 Ga0163161_10028167 3300017792 Bacteria 3987
110 Ga0163161_10030037 3300017792 Bacteria 3865
111 Ga0206349_1676967 3300020075 Bacteria 3152
112 Ga0224712_10202842 3300022467 Bacteria 902
113 Ga0209760_104234 3300025207 Bacteria 1238
114 Ga0209436_101467 3300025208 Bacteria 8202
115 Ga0209437_100032 3300025233 Bacteria 520075
116 Ga0207425_1000028 3300025245 Bacteria 286333
117 Ga0209129_1000065 3300025258 Bacteria 232568
118 Ga0209565_1000001 3300025263 Bacteria 2950419
119 Ga0209565_1000014 3300025263 Bacteria 530302
120 Ga0209565_1000081 3300025263 Bacteria 155639
121 Ga0209565_1002968 3300025263 Bacteria 5757
122 Ga0209673_1000001 3300025273 Bacteria 3176258
123 Ga0209673_1000904 3300025273 Bacteria 37938
124 Ga0209673_1009004 3300025273 Bacteria 4381
125 Ga0209673_1052445 3300025273 Bacteria 1070
126 Ga0209130_1003185 3300025284 Bacteria 7248
127 Ga0209130_1009760 3300025284 Bacteria 2703
128 Ga0209675_1000001 3300025291 Bacteria 2950293
129 Ga0209675_1000021 3300025291 Bacteria 334833
130 Ga0209675_1004716 3300025291 Bacteria 5965
131 Ga0209675_1026517 3300025291 Bacteria 1440
132 Ga0209676_1000024 3300025292 Bacteria 578839
133 Ga0209676_1000203 3300025292 Bacteria 132949
134 Ga0209676_1000891 3300025292 Bacteria 38072
135 Ga0209676_1001141 3300025292 Bacteria 29048
136 Ga0209676_1005031 3300025292 Bacteria 7073
137 Ga0209676_1017130 3300025292 Bacteria 2578
138 Ga0209676_1030611 3300025292 Bacteria 1643
139 Ga0209025_1000002 3300025294 Bacteria 1393142
140 Ga0209025_1000015 3300025294 Bacteria 808120
141 Ga0209025_1001506 3300025294 Bacteria 29986
142 Ga0209025_1005152 3300025294 Bacteria 10828
143 Ga0209564_1000001 3300025295 Bacteria 3176258
144 Ga0209564_1000374 3300025295 Bacteria 82748
145 Ga0209564_1008667 3300025295 Bacteria 4973
146 Ga0209758_1000003 3300025297 Bacteria 1398533
147 Ga0209758_1019952 3300025297 Bacteria 3200
148 Ga0209050_1000894 3300025298 Bacteria 39568
149 Ga0209050_1001262 3300025298 Bacteria 29205
150 Ga0209050_1003631 3300025298 Bacteria 11164
151 Ga0209050_1004269 3300025298 Bacteria 9810
152 Ga0209050_1020959 3300025298 Bacteria 2406
153 Ga0209256_1000002 3300025299 Bacteria 1906740
154 Ga0209256_1002517 3300025299 Bacteria 14732
155 Ga0209256_1003016 3300025299 Bacteria 12453
156 Ga0209051_1001453 3300025303 Bacteria 20094
157 Ga0209257_1000204 3300025304 Bacteria 143800
158 Ga0209257_1000325 3300025304 Bacteria 99936
159 Ga0209257_1001190 3300025304 Bacteria 32758
160 Ga0209257_1001230 3300025304 Bacteria 31830
161 Ga0209257_1003198 3300025304 Bacteria 14522
162 Ga0207696_1004979 3300025711 Bacteria 5605
163 Ga0207696_1014650 3300025711 Bacteria 2682
164 Ga0207696_1021275 3300025711 Bacteria 2080
165 Ga0207655_1018751 3300025728 Bacteria 3653
166 Ga0207655_1036912 3300025728 Bacteria 2160
167 Ga0207713_1000011 3300025735 Bacteria 507224
168 Ga0207713_1037979 3300025735 Bacteria 2048
169 Ga0207680_10000013 3300025903 Bacteria 244716
170 Ga0207705_10004884 3300025909 Bacteria 10056
171 Ga0207705_10117864 3300025909 Bacteria 1967
172 Ga0207657_10038315 3300025919 Bacteria 4269
173 Ga0207681_10105683 3300025923 Bacteria 2039
174 Ga0207694_10000122 3300025924 Bacteria 82443
175 Ga0207650_10173149 3300025925 Bacteria 1716
176 Ga0207650_10339642 3300025925 Bacteria 1233
177 Ga0207690_10093458 3300025932 Bacteria 2131
178 Ga0207690_10352152 3300025932 Bacteria 1164
179 Ga0207686_10321338 3300025934 Bacteria 1156
180 Ga0207709_10000159 3300025935 Bacteria 91803
181 Ga0207709_10004875 3300025935 Bacteria 7680
182 Ga0207709_10214806 3300025935 Bacteria 1383
183 Ga0207691_10000320 3300025940 Bacteria 47773
184 Ga0207689_10088130 3300025942 Bacteria 2549
185 Ga0207668_10008378 3300025972 Bacteria 6159
186 Ga0207668_10043455 3300025972 Bacteria 3050
187 Ga0207668_10267732 3300025972 Bacteria 1395
188 Ga0207640_10153942 3300025981 Bacteria 1692
189 Ga0207677_10093552 3300026023 Bacteria 2192
190 Ga0207703_10323447 3300026035 Bacteria 1413
191 Ga0207639_10072203 3300026041 Bacteria 2702
192 Ga0207678_10188190 3300026067 Bacteria 1763
193 Ga0207641_10384407 3300026088 Bacteria 1345
194 Ga0207676_10200171 3300026095 Bacteria 1764
195 Ga0207674_10400970 3300026116 Bacteria 1325
196 Ga0207683_10019798 3300026121 Bacteria 5748
197 Ga0209281_1000007 3300027111 Bacteria 938265
198 Ga0209371_1000004 3300027312 Bacteria 1098197
199 Ga0209371_1000034 3300027312 Bacteria 379021
200 Ga0209371_1000363 3300027312 Bacteria 48923
201 Ga0209371_1002419 3300027312 Bacteria 10474
202 Ga0209969_1003869 3300027360 Bacteria 2084
203 Ga0209999_1006000 3300027543 Bacteria 2183
204 Ga0209983_1014308 3300027665 Bacteria 1634
205 Ga0209974_10001452 3300027876 Bacteria 8607
206 Ga0209974_10025383 3300027876 Bacteria 1961
207 Ga0268266_10000021 3300028379 Bacteria 522453
208 Ga0268266_10122312 3300028379 Bacteria 2317
209 Ga0268266_10137048 3300028379 Bacteria 2193
210 Ga0265318_10001789 3300028577 Bacteria 12225
211 Ga0265338_10232704 3300028800 Bacteria 1369
212 Ga0268256_1000005 3300030500 Bacteria 1082342
213 Ga0268256_1000310 3300030500 Bacteria 48923
214 Ga0268256_1000329 3300030500 Bacteria 46502
215 Ga0268256_1012699 3300030500 Bacteria 2589
216 Ga0268256_1039073 3300030500 Bacteria 1074
217 Ga0316183_1205388 3300030742 Bacteria 10997
218 Ga0316181_1074201 3300030744 Bacteria 1423
219 Ga0316181_1238080 3300030744 Bacteria 3278
220 Ga0316182_1359052 3300030745 Bacteria 959
221 Ga0265340_10026303 3300031247 Bacteria 2942
222 Ga0265316_10001900 3300031344 Bacteria 21937
223 Ga0265316_10036454 3300031344 Bacteria 3977
224 Ga0307513_10021897 3300031456 Bacteria 7532
225 Ga0307513_10121646 3300031456 Bacteria 2576
226 Ga0307408_100000815 3300031548 Bacteria 24822
227 Ga0307405_10127823 3300031731 Bacteria 1751
228 Ga0307405_10412222 3300031731 Bacteria 1061
229 Ga0307413_10143045 3300031824 Bacteria 1655
230 Ga0307410_10029465 3300031852 Bacteria 3495
231 Ga0307410_10239892 3300031852 Bacteria 1404
232 Ga0307410_10292099 3300031852 Bacteria 1283
233 Ga0307406_10001340 3300031901 Bacteria 13827
234 Ga0307406_10027208 3300031901 Bacteria 3443
235 Ga0307412_10268070 3300031911 Bacteria 1335
236 Ga0307409_100208398 3300031995 Bacteria 1754
237 Ga0307414_10010446 3300032004 Bacteria 5387
238 Ga0307414_10085753 3300032004 Bacteria 2321
239 Ga0307414_10092394 3300032004 Bacteria 2252
240 Ga0307414_10099037 3300032004 Bacteria 2189
241 Ga0307414_10272448 3300032004 Bacteria 1418
242 Ga0307411_10419626 3300032005 Bacteria 1111
243 Ga0373950_0023984 3300034818 Bacteria 1094
244 Ga0373952_0008329 3300035092 Bacteria 1965
245 Ga0395899_0034252 3300037312 Bacteria 3813
246 Ga0395900_0207555 3300037418 Bacteria 1979
247 Ga0395905_0004028 3300037471 Bacteria 15418
248 Ga0395905_0004849 3300037471 Bacteria 13871
249 Ga0395905_0109512 3300037471 Bacteria 2593
250 Ga0395905_0172869 3300037471 Bacteria 2029
251 Ga0395901_0005473 3300038443 Bacteria 12858
252 Ga0237819_00047 3300038705 Bacteria 41634
253 Ga0439436_0041852 3300041404 Bacteria 1310
254 Ga0439438_009265 3300041405 Bacteria 3197
255 Ga0439447_000192 3300041407 Bacteria 21822
256 Ga0439466_0000033 3300041411 Bacteria 59925
257 Ga0439465_0000521 3300041413 Bacteria 11510
258 Ga0439465_0008761 3300041413 Bacteria 3187
259 Ga0451797_1356149 3300041453 Bacteria 1256
260 Ga0451800_0743803 3300041459 Bacteria 2231
261 Ga0451802_0893561 3300041460 Bacteria 2359
262 Ga0451806_008777 3300041462 Bacteria 3609
263 Ga0451807_1122491 3300041486 Bacteria 1256
264 Ga0451807_2237182 3300041486 Bacteria 1703
265 Ga0451853_0369548 3300041512 Bacteria 1199
266 Ga0439445_0024673 3300042004 Bacteria 1530
267 Ga0439432_009545 3300042006 Bacteria 3379
268 Ga0439449_0000100 3300042007 Bacteria 27698
269 Ga0439449_0008298 3300042007 Bacteria 3951
270 Ga0439449_0011539 3300042007 Bacteria 3323
271 Ga0439449_0013732 3300042007 Bacteria 3048
272 Ga0439452_016575 3300042010 Bacteria 1999
273 Ga0439462_0037214 3300042015 Bacteria 1296
274 Ga0450907_001397 3300042146 Bacteria 5287
275 Ga0439464_0001393 3300042439 Bacteria 5671
276 Ga0451577_0030387 3300042876 Bacteria 4882
277 Ga0451577_0058858 3300042876 Bacteria 3426
278 Ga0451577_0121782 3300042876 Bacteria 2337
279 Ga0466972_0197570 3300044658 Bacteria 942
280 Ga0466966_0009900 3300044684 Bacteria 6318
281 Ga0451576_0286874 3300045051 Bacteria 1721
282 Ga0495585_0119237 3300046492 Bacteria 1397
283 Ga0495596_0032545 3300046500 Bacteria 2078
284 Ga0495607_0039609 3300046501 Bacteria 2813
285 Ga0495606_0006031 3300046507 Bacteria 11346
286 Ga0495643_0003914 3300046522 Bacteria 10676
287 Ga0495648_0011947 3300046524 Bacteria 6512
288 Ga0495663_0001073 3300046525 Bacteria 8910
289 Ga0495663_0112453 3300046525 Bacteria 906
290 Ga0495621_0000034 3300046539 Bacteria 26649
291 Ga0495621_0042391 3300046539 Bacteria 1602
292 Ga0495597_0002821 3300046542 Bacteria 10660
293 Ga0495656_0023952 3300046615 Bacteria 2406
294 Ga0495625_0065261 3300046660 Bacteria 2566
295 Ga0495660_0102904 3300046810 Bacteria 1467
296 Ga0495636_0002356 3300047318 Bacteria 7254
297 Ga0495636_0009372 3300047318 Bacteria 3855
298 Ga0495672_0000096 3300047320 Bacteria 143686
299 Ga0495672_0000308 3300047320 Bacteria 65628
300 Ga0495672_0244508 3300047320 Bacteria 874
301 Ga0495679_008109 3300047446 Bacteria 4300
302 Ga0495686_0018413 3300047472 Bacteria 4688
303 Ga0496101_0045073 3300048904 Unclassified 3158
304 Ga0496102_0003269 3300048905 Bacteria 13736
305 Ga0496104_0981189 3300048907 Bacteria 749
306 Ga0496105_0005796 3300048908 Bacteria 9419
307 Ga0496108_0147255 3300048911 Bacteria 2030
308 Ga0496109_0032427 3300048912 Bacteria 4696
309 Ga0496110_0185013 3300048913 Bacteria 1891
310 Ga0496111_0283607 3300048914 Bacteria 1228
311 Ga0496114_0032003 3300048917 Bacteria 4327
312 Ga0496116_0065961 3300048919 Bacteria 2318
313 Ga0496117_0000017 3300048920 Bacteria 490421
314 Ga0496117_0000145 3300048920 Bacteria 153289
315 Ga0496117_0001552 3300048920 Bacteria 32622
316 Ga0496117_0010196 3300048920 Bacteria 8612
317 Ga0496117_0154078 3300048920 Bacteria 1356
318 Ga0496118_0000018 3300048921 Bacteria 490421
319 Ga0496118_0000681 3300048921 Bacteria 55339
320 Ga0496118_0011182 3300048921 Bacteria 8787
321 Ga0496118_0026279 3300048921 Bacteria 4964
322 Ga0496118_0026978 3300048921 Bacteria 4874
323 Ga0496119_0000005 3300048922 Bacteria 529799
324 Ga0496119_0000902 3300048922 Bacteria 38716
325 Ga0496119_0001396 3300048922 Bacteria 29276
326 Ga0496120_0000005 3300048923 Bacteria 529797
327 Ga0496120_0000605 3300048923 Bacteria 54408
328 Ga0496120_0003200 3300048923 Bacteria 15224
329 Ga0496121_0000606 3300048924 Bacteria 67168
330 Ga0496121_0007368 3300048924 Bacteria 13299
331 Ga0496121_0120433 3300048924 Bacteria 1983
332 Ga0496122_0001415 3300048925 Bacteria 38850
333 Ga0496122_0009883 3300048925 Bacteria 9942
334 Ga0496122_0021138 3300048925 Bacteria 5839
335 Ga0496123_0000185 3300048926 Bacteria 126153
336 Ga0496123_0007762 3300048926 Bacteria 10009
337 Ga0496123_0019039 3300048926 Bacteria 5423
338 Ga0496124_0000032 3300048927 Bacteria 332524
339 Ga0496124_0001008 3300048927 Bacteria 44603
340 Ga0496124_0005901 3300048927 Bacteria 13551
341 Ga0496124_0010984 3300048927 Bacteria 9100
342 Ga0496124_0012740 3300048927 Bacteria 8265
343 Ga0496124_0014295 3300048927 Bacteria 7682
344 Ga0496125_0019981 3300048928 Bacteria 6297
345 Ga0496125_0025896 3300048928 Bacteria 5360
346 Ga0496125_0065542 3300048928 Bacteria 2876
347 Ga0496125_0149626 3300048928 Bacteria 1606
348 Ga0496126_0003747 3300048929 Bacteria 18906
349 Ga0496126_0068216 3300048929 Bacteria 3176
350 Ga0496126_0079718 3300048929 Bacteria 2898
351 Ga0495678_072444 3300049459 Bacteria 1259
352 Ga0501300_005773 3300049523 Bacteria 1822
353 Ga0501031_0039084 3300049568 Bacteria 3095
354 Ga0501032_0026292 3300049569 Bacteria 4005
355 Ga0501033_0003657 3300049570 Bacteria 12535
356 Ga0501033_0072057 3300049570 Bacteria 2537
357 Ga0501034_0001322 3300049571 Bacteria 33524
358 Ga0501034_0047892 3300049571 Bacteria 4314
359 Ga0501034_0260087 3300049571 Bacteria 1678
360 Ga0501034_0326174 3300049571 Bacteria 1467
361 Ga0501038_0032794 3300049574 Bacteria 4578
362 Ga0501038_0141941 3300049574 Bacteria 1964
363 Ga0501038_0174759 3300049574 Bacteria 1736
364 Ga0501039_0246320 3300049575 Bacteria 1405
365 Ga0501043_0041384 3300049579 Bacteria 3620
366 Ga0501043_0117490 3300049579 Bacteria 2087
367 Ga0501046_0043566 3300049580 Bacteria 3572
368 Ga0501047_0137520 3300049581 Bacteria 2323
369 Ga0501073_0035880 3300049589 Bacteria 3523
370 Ga0501225_0004143 3300049705 Bacteria 4336
371 Ga0501267_001614 3300049764 Bacteria 1960
372 Ga0501044_0187785 3300049823 Bacteria 2030
373 Ga0501044_0481986 3300049823 Bacteria 1143
374 nmdc:mga00v17_1917_c1 3300050491 Bacteria 10748
375 nmdc:mga0n895_323338_c1 3300050512 Bacteria 1563
376 Ga0500634_0006424 3300053161 Bacteria 5689
377 Ga0590071_014237 3300059421 Bacteria 1865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0981189 Ga0496104_0981189_31_687 210
2 3300044658 Ga0466972_0197570 Ga0466972_0197570_16_732 234
3 3300003203 JGI25406J46586_10000477 JGI25406J46586_100004778 240
4 3300005985 Ga0081539_10000072 Ga0081539_10000072231 240
5 3300022467 Ga0224712_10202842 Ga0224712_102028421 240
6 3300047320 Ga0495672_0244508 Ga0495672_0244508_16_753 242
7 3300028577 Ga0265318_10001789 Ga0265318_100017892 245
8 3300028800 Ga0265338_10232704 Ga0265338_102327042 245
9 3300031247 Ga0265340_10026303 Ga0265340_100263031 246
10 3300031344 Ga0265316_10001900 Ga0265316_1000190011 246
11 iso_pu_bacteria 2554235132 2554814649 248
12 iso_pu_bacteria 2606217733 2608382082 248
13 iso_pu_bacteria 2547132374 2548498596 249
14 iso_pu_bacteria 2643221570 2643865415 249
15 iso_pu_bacteria 2643221596 2643990620 249
16 iso_pu_bacteria 2643221652 2644296122 249
17 iso_pu_bacteria 2643221717 2644649331 249
18 iso_pu_bacteria 2721755523 2722882656 249
19 iso_pu_bacteria 2839138175 2839143277 249
20 iso_pu_bacteria 2842718218 2842722183 249
21 iso_pu_bacteria 2874220319 2874220976 249
22 iso_pu_bacteria 2919089067 2919091185 249
23 iso_pu_bacteria 2928496128 2928497818 249
24 iso_pu_bacteria 2931380184 2931381380 249
25 iso_pu_bacteria 2974320154 2974323701 249
26 iso_pu_bacteria 2990710928 2990712002 249
27 iso_pu_bacteria 2515154123 2515689934 250
28 iso_pu_bacteria 2894023352 2894025816 250
29 3300006871 Ga0075434_100208114 Ga0075434_1002081142 251
30 3300050512 nmdc:mga0n895_323338_c1 nmdc:mga0n895_323338_c1_69_962 251
31 iso_pu_bacteria 2571042365 2572253424 251
32 iso_pu_bacteria 2643221559 2643819017 251
33 iso_pu_bacteria 2643221573 2643879537 251
34 iso_pu_bacteria 2643221579 2643905678 251
35 iso_pu_bacteria 2643221581 2643913194 251
36 iso_pu_bacteria 2643221586 2643941314 251
37 iso_pu_bacteria 2643221593 2643974424 251
38 iso_pu_bacteria 2643221612 2644080441 251
39 iso_pu_bacteria 2643221695 2644528768 251
40 iso_pu_bacteria 2643221720 2644662852 251
41 iso_pu_bacteria 2643221727 2644697054 251
42 iso_pu_bacteria 2643221728 2644698193 251
43 iso_pu_bacteria 2747842501 2748015935 251
44 iso_pu_bacteria 2808606414 2809126095 251
45 iso_pu_bacteria 2842391507 2842392915 251
46 iso_pu_bacteria 2842757796 2842758697 251
47 iso_pu_bacteria 2842780639 2842783536 251
48 iso_pu_bacteria 2844528606 2844529875 251
49 iso_pu_bacteria 2852649853 2852651365 251
50 iso_pu_bacteria 2857442823 2857446551 251
51 iso_pu_bacteria 2865014394 2865014829 251
52 iso_pu_bacteria 2881609920 2881611129 251
53 iso_pu_bacteria 2894414249 2894416077 251
54 iso_pu_bacteria 2895498888 2895499238 251
55 iso_pu_bacteria 2895511927 2895512259 251
56 iso_pu_bacteria 2895522137 2895522269 251
57 iso_pu_bacteria 2895525241 2895527287 251
58 iso_pu_bacteria 2923516293 2923517779 251
59 iso_pu_bacteria 2945951305 2945955707 251
60 iso_pu_bacteria 8002869464 8002871649 251
61 3300005981 Ga0081538_10031617 Ga0081538_100316172 252
62 3300015265 Ga0182005_1000932 Ga0182005_10009326 252
63 3300031852 Ga0307410_10292099 Ga0307410_102920991 252
64 3300048927 Ga0496124_0010984 Ga0496124_0010984_3157_3924 252
65 3300059421 Ga0590071_014237 Ga0590071_014237_270_1067 252
66 iso_pu_bacteria 2811994881 2812365770 252
67 iso_pu_bacteria 2923519811 2923525737 252
68 3300006946 Ga0079104_1000025 Ga0079104_1000025106 253
69 3300009092 Ga0105250_10005794 Ga0105250_100057942 253
70 3300009148 Ga0105243_10000881 Ga0105243_100008815 253
71 3300025711 Ga0207696_1014650 Ga0207696_10146502 253
72 3300025935 Ga0207709_10000159 Ga0207709_1000015951 253
73 3300027111 Ga0209281_1000007 Ga0209281_1000007115 253
74 3300027876 Ga0209974_10001452 Ga0209974_100014525 253
75 3300031901 Ga0307406_10001340 Ga0307406_1000134013 253
76 3300045051 Ga0451576_0286874 Ga0451576_0286874_743_1549 253
77 3300046542 Ga0495597_0002821 Ga0495597_0002821_7929_8744 253
78 iso_pu_bacteria 2857576091 2857578675 253
79 iso_pu_bacteria 2929199973 2929203417 253
80 iso_pu_bacteria 2939631187 2939631478 253
81 iso_pu_bacteria 8055909800 8055910471 253
82 3300002067 JGI24735J21928_10011056 JGI24735J21928_100110563 254
83 3300002737 JGI25162J39368_1001517 JGI25162J39368_10015179 254
84 3300003316 rootH1_10013885 rootH1_100138852 254
85 3300003856 Ga0058692_1000216 Ga0058692_100021611 254
86 3300005334 Ga0068869_100168001 Ga0068869_1001680012 254
87 3300005347 Ga0070668_100125520 Ga0070668_1001255202 254
88 3300005466 Ga0070685_10285839 Ga0070685_102858392 254
89 3300006051 Ga0075364_10012183 Ga0075364_100121832 254
90 3300006358 Ga0068871_100502372 Ga0068871_1005023721 254
91 3300009011 Ga0105251_10000305 Ga0105251_1000030553 254
92 3300009011 Ga0105251_10050630 Ga0105251_100506303 254
93 3300009011 Ga0105251_10130713 Ga0105251_101307132 254
94 3300009036 Ga0105244_10092631 Ga0105244_100926313 254
95 3300009092 Ga0105250_10006276 Ga0105250_100062762 254
96 3300009176 Ga0105242_10047654 Ga0105242_100476542 254
97 3300013100 Ga0157373_10105995 Ga0157373_101059952 254
98 3300013102 Ga0157371_10021987 Ga0157371_100219875 254
99 3300013105 Ga0157369_10004928 Ga0157369_100049286 254
100 3300013105 Ga0157369_10526540 Ga0157369_105265402 254
101 3300013307 Ga0157372_10007235 Ga0157372_100072353 254
102 3300013307 Ga0157372_10295811 Ga0157372_102958112 254
103 3300017792 Ga0163161_10030037 Ga0163161_100300375 254
104 3300025207 Ga0209760_104234 Ga0209760_1042342 254
105 3300025233 Ga0209437_100032 Ga0209437_10003295 254
106 3300025711 Ga0207696_1004979 Ga0207696_10049794 254
107 3300025711 Ga0207696_1021275 Ga0207696_10212752 254
108 3300025728 Ga0207655_1018751 Ga0207655_10187515 254
109 3300025728 Ga0207655_1036912 Ga0207655_10369122 254
110 3300025735 Ga0207713_1000011 Ga0207713_1000011147 254
111 3300025932 Ga0207690_10352152 Ga0207690_103521521 254
112 3300025934 Ga0207686_10321338 Ga0207686_103213382 254
113 3300025942 Ga0207689_10088130 Ga0207689_100881303 254
114 3300025972 Ga0207668_10267732 Ga0207668_102677322 254
115 3300027312 Ga0209371_1000034 Ga0209371_1000034351 254
116 3300027312 Ga0209371_1000363 Ga0209371_100036310 254
117 3300027312 Ga0209371_1002419 Ga0209371_10024193 254
118 3300030500 Ga0268256_1000310 Ga0268256_100031010 254
119 3300030500 Ga0268256_1000329 Ga0268256_100032917 254
120 3300030500 Ga0268256_1012699 Ga0268256_10126993 254
121 3300030500 Ga0268256_1039073 Ga0268256_10390731 254
122 3300031344 Ga0265316_10036454 Ga0265316_100364544 254
123 3300037471 Ga0395905_0004028 Ga0395905_0004028_11507_12343 254
124 3300041405 Ga0439438_009265 Ga0439438_009265_2208_2993 254
125 3300041407 Ga0439447_000192 Ga0439447_000192_1842_2627 254
126 3300041411 Ga0439466_0000033 Ga0439466_0000033_49634_50419 254
127 3300042006 Ga0439432_009545 Ga0439432_009545_157_942 254
128 3300042010 Ga0439452_016575 Ga0439452_016575_971_1756 254
129 3300042146 Ga0450907_001397 Ga0450907_001397_1193_1978 254
130 3300042439 Ga0439464_0001393 Ga0439464_0001393_1027_1812 254
131 3300044684 Ga0466966_0009900 Ga0466966_0009900_854_1660 254
132 3300046492 Ga0495585_0119237 Ga0495585_0119237_567_1352 254
133 3300046500 Ga0495596_0032545 Ga0495596_0032545_1172_1957 254
134 3300046524 Ga0495648_0011947 Ga0495648_0011947_2463_3248 254
135 3300046810 Ga0495660_0102904 Ga0495660_0102904_648_1433 254
136 3300047320 Ga0495672_0000096 Ga0495672_0000096_49238_50023 254
137 3300047446 Ga0495679_008109 Ga0495679_008109_435_1220 254
138 3300048904 Ga0496101_0045073 Ga0496101_0045073_1237_2013 254
139 3300048905 Ga0496102_0003269 Ga0496102_0003269_8139_8924 254
140 3300048908 Ga0496105_0005796 Ga0496105_0005796_1848_2633 254
141 3300048919 Ga0496116_0065961 Ga0496116_0065961_1220_2005 254
142 3300048920 Ga0496117_0000017 Ga0496117_0000017_136429_137214 254
143 3300048920 Ga0496117_0000145 Ga0496117_0000145_80234_81019 254
144 3300048921 Ga0496118_0000018 Ga0496118_0000018_136429_137214 254
145 3300048921 Ga0496118_0026279 Ga0496118_0026279_3070_3855 254
146 3300048921 Ga0496118_0026978 Ga0496118_0026978_3891_4676 254
147 3300048922 Ga0496119_0000005 Ga0496119_0000005_5662_6447 254
148 3300048922 Ga0496119_0001396 Ga0496119_0001396_4771_5556 254
149 3300048923 Ga0496120_0000005 Ga0496120_0000005_207177_207962 254
150 3300048923 Ga0496120_0003200 Ga0496120_0003200_9668_10453 254
151 3300048924 Ga0496121_0000606 Ga0496121_0000606_22960_23745 254
152 3300048925 Ga0496122_0001415 Ga0496122_0001415_22039_22824 254
153 3300048926 Ga0496123_0000185 Ga0496123_0000185_22058_22843 254
154 3300048927 Ga0496124_0001008 Ga0496124_0001008_21292_22077 254
155 3300048927 Ga0496124_0005901 Ga0496124_0005901_5655_6440 254
156 3300048928 Ga0496125_0149626 Ga0496125_0149626_472_1257 254
157 3300048929 Ga0496126_0079718 Ga0496126_0079718_241_1026 254
158 3300049459 Ga0495678_072444 Ga0495678_072444_321_1106 254
159 3300049568 Ga0501031_0039084 Ga0501031_0039084_1787_2551 254
160 3300049570 Ga0501033_0072057 Ga0501033_0072057_320_1084 254
161 3300049571 Ga0501034_0326174 Ga0501034_0326174_362_1126 254
162 3300049574 Ga0501038_0174759 Ga0501038_0174759_568_1395 254
163 3300049575 Ga0501039_0246320 Ga0501039_0246320_342_1169 254
164 3300049580 Ga0501046_0043566 Ga0501046_0043566_293_1120 254
165 3300049589 Ga0501073_0035880 Ga0501073_0035880_2678_3505 254
166 iso_pu_bacteria 2939589442 2939590483 254
167 iso_pu_bacteria 2939622612 2939622642 254
168 iso_pu_bacteria 2941475908 2941477703 254
169 iso_pu_bacteria 2961064222 2961067082 254
170 iso_pu_bacteria 2974307012 2974309474 254
171 iso_pu_bacteria 2977247770 2977250194 254
172 iso_pu_bacteria 2984514374 2984515315 254
173 iso_pu_bacteria 8021622325 8021624734 254
174 3300002067 JGI24735J21928_10009349 JGI24735J21928_100093492 255
175 3300002773 JGI25152J39213_1000018 JGI25152J39213_100001894 255
176 3300002774 JGI25150J39212_1000578 JGI25150J39212_10005787 255
177 3300003187 JGI25151J46595_10000111 JGI25151J46595_1000011195 255
178 3300003187 JGI25151J46595_10000253 JGI25151J46595_1000025347 255
179 3300003215 JGI25153J46596_10000085 JGI25153J46596_100000857 255
180 3300003374 JGI25161J50226_1001331 JGI25161J50226_10013316 255
181 3300003771 Ga0055526_1000036 Ga0055526_100003690 255
182 3300003771 Ga0055526_1000328 Ga0055526_100032820 255
183 3300003773 Ga0055537_1000083 Ga0055537_100008337 255
184 3300003773 Ga0055537_1003554 Ga0055537_10035541 255
185 3300003773 Ga0055537_1004529 Ga0055537_10045292 255
186 3300003775 Ga0055524_1000359 Ga0055524_10003593 255
187 3300003781 Ga0055536_1001443 Ga0055536_10014437 255
188 3300003781 Ga0055536_1001487 Ga0055536_10014876 255
189 3300003781 Ga0055536_1004015 Ga0055536_10040153 255
190 3300003781 Ga0055536_1010019 Ga0055536_10100192 255
191 3300003784 Ga0055534_1000089 Ga0055534_100008957 255
192 3300003784 Ga0055534_1000103 Ga0055534_100010326 255
193 3300003784 Ga0055534_1008103 Ga0055534_10081032 255
194 3300003790 Ga0055528_1000004 Ga0055528_1000004235 255
195 3300003790 Ga0055528_1000585 Ga0055528_10005854 255
196 3300003790 Ga0055528_1002210 Ga0055528_100221011 255
197 3300003790 Ga0055528_1002781 Ga0055528_10027817 255
198 3300003791 Ga0055530_10000996 Ga0055530_1000099612 255
199 3300003791 Ga0055530_10001891 Ga0055530_100018916 255
200 3300003791 Ga0055530_10004209 Ga0055530_100042093 255
201 3300003791 Ga0055530_10004656 Ga0055530_100046566 255
202 3300003794 Ga0055531_10003226 Ga0055531_100032263 255
203 3300003794 Ga0055531_10004626 Ga0055531_100046262 255
204 3300003794 Ga0055531_10009980 Ga0055531_100099804 255
205 3300003794 Ga0055531_10012159 Ga0055531_100121594 255
206 3300003794 Ga0055531_10023325 Ga0055531_100233252 255
207 3300003856 Ga0058692_1000002 Ga0058692_1000002351 255
208 3300004625 Ga0055543_1001333 Ga0055543_10013337 255
209 3300005288 Ga0065714_10070932 Ga0065714_100709322 255
210 3300005289 Ga0065704_10002263 Ga0065704_100022632 255
211 3300005289 Ga0065704_10104025 Ga0065704_101040253 255
212 3300005327 Ga0070658_10005116 Ga0070658_100051162 255
213 3300005335 Ga0070666_10000012 Ga0070666_10000012149 255
214 3300005336 Ga0070680_100107942 Ga0070680_1001079422 255
215 3300005338 Ga0068868_100238121 Ga0068868_1002381212 255
216 3300005339 Ga0070660_100291050 Ga0070660_1002910502 255
217 3300005347 Ga0070668_100159682 Ga0070668_1001596822 255
218 3300005353 Ga0070669_100255525 Ga0070669_1002555251 255
219 3300005355 Ga0070671_100035768 Ga0070671_1000357682 255
220 3300005440 Ga0070705_100169611 Ga0070705_1001696112 255
221 3300005456 Ga0070678_100021379 Ga0070678_1000213792 255
222 3300005539 Ga0068853_100267566 Ga0068853_1002675663 255
223 3300005547 Ga0070693_100009436 Ga0070693_1000094362 255
224 3300005548 Ga0070665_100031214 Ga0070665_1000312146 255
225 3300005548 Ga0070665_100374687 Ga0070665_1003746871 255
226 3300005615 Ga0070702_100245355 Ga0070702_1002453551 255
227 3300005618 Ga0068864_100037451 Ga0068864_1000374512 255
228 3300005842 Ga0068858_100405582 Ga0068858_1004055821 255
229 3300006051 Ga0075364_10000021 Ga0075364_100000212 255
230 3300006051 Ga0075364_10041923 Ga0075364_100419232 255
231 3300006051 Ga0075364_10367022 Ga0075364_103670221 255
232 3300006177 Ga0075362_10060360 Ga0075362_100603602 255
233 3300006178 Ga0075367_10033424 Ga0075367_100334243 255
234 3300006195 Ga0075366_10128651 Ga0075366_101286511 255
235 3300009011 Ga0105251_10005519 Ga0105251_100055193 255
236 3300009036 Ga0105244_10044519 Ga0105244_100445192 255
237 3300009148 Ga0105243_10159462 Ga0105243_101594622 255
238 3300009174 Ga0105241_10334270 Ga0105241_103342702 255
239 3300009177 Ga0105248_10362758 Ga0105248_103627582 255
240 3300009551 Ga0105238_10000540 Ga0105238_1000054010 255
241 3300009978 Ga0105148_102738 Ga0105148_1027381 255
242 3300013102 Ga0157371_10001165 Ga0157371_100011656 255
243 3300013105 Ga0157369_10032030 Ga0157369_100320305 255
244 3300013297 Ga0157378_10311586 Ga0157378_103115862 255
245 3300013306 Ga0163162_10000444 Ga0163162_1000044425 255
246 3300013307 Ga0157372_10072115 Ga0157372_100721152 255
247 3300013308 Ga0157375_10098641 Ga0157375_100986412 255
248 3300014497 Ga0182008_10009029 Ga0182008_100090293 255
249 3300014497 Ga0182008_10053644 Ga0182008_100536442 255
250 3300015261 Ga0182006_1045175 Ga0182006_10451751 255
251 3300015262 Ga0182007_10079772 Ga0182007_100797721 255
252 3300015689 Ga0183360_10001 Ga0183360_100012322 255
253 3300017792 Ga0163161_10028167 Ga0163161_100281672 255
254 3300020075 Ga0206349_1676967 Ga0206349_16769673 255
255 3300025208 Ga0209436_101467 Ga0209436_1014675 255
256 3300025245 Ga0207425_1000028 Ga0207425_1000028264 255
257 3300025258 Ga0209129_1000065 Ga0209129_1000065212 255
258 3300025263 Ga0209565_1000001 Ga0209565_10000011535 255
259 3300025263 Ga0209565_1000014 Ga0209565_1000014374 255
260 3300025263 Ga0209565_1000081 Ga0209565_1000081117 255
261 3300025263 Ga0209565_1002968 Ga0209565_10029682 255
262 3300025273 Ga0209673_1000001 Ga0209673_10000011535 255
263 3300025273 Ga0209673_1000904 Ga0209673_100090418 255
264 3300025273 Ga0209673_1009004 Ga0209673_10090046 255
265 3300025273 Ga0209673_1052445 Ga0209673_10524451 255
266 3300025284 Ga0209130_1003185 Ga0209130_10031855 255
267 3300025284 Ga0209130_1009760 Ga0209130_10097603 255
268 3300025291 Ga0209675_1000001 Ga0209675_1000001999 255
269 3300025291 Ga0209675_1000021 Ga0209675_1000021115 255
270 3300025291 Ga0209675_1004716 Ga0209675_10047165 255
271 3300025291 Ga0209675_1026517 Ga0209675_10265172 255
272 3300025292 Ga0209676_1000024 Ga0209676_1000024507 255
273 3300025292 Ga0209676_1000203 Ga0209676_1000203103 255
274 3300025292 Ga0209676_1000891 Ga0209676_100089133 255
275 3300025292 Ga0209676_1001141 Ga0209676_100114117 255
276 3300025292 Ga0209676_1005031 Ga0209676_10050317 255
277 3300025292 Ga0209676_1017130 Ga0209676_10171302 255
278 3300025292 Ga0209676_1030611 Ga0209676_10306111 255
279 3300025294 Ga0209025_1000002 Ga0209025_10000028 255
280 3300025294 Ga0209025_1000015 Ga0209025_1000015149 255
281 3300025294 Ga0209025_1001506 Ga0209025_10015068 255
282 3300025294 Ga0209025_1005152 Ga0209025_10051522 255
283 3300025295 Ga0209564_1000001 Ga0209564_10000011161 255
284 3300025295 Ga0209564_1000374 Ga0209564_100037466 255
285 3300025295 Ga0209564_1008667 Ga0209564_10086673 255
286 3300025297 Ga0209758_1000003 Ga0209758_100000315 255
287 3300025297 Ga0209758_1019952 Ga0209758_10199521 255
288 3300025298 Ga0209050_1000894 Ga0209050_10008947 255
289 3300025298 Ga0209050_1001262 Ga0209050_10012628 255
290 3300025298 Ga0209050_1003631 Ga0209050_10036314 255
291 3300025298 Ga0209050_1004269 Ga0209050_10042693 255
292 3300025298 Ga0209050_1020959 Ga0209050_10209591 255
293 3300025299 Ga0209256_1000002 Ga0209256_1000002393 255
294 3300025299 Ga0209256_1002517 Ga0209256_10025173 255
295 3300025299 Ga0209256_1003016 Ga0209256_100301611 255
296 3300025303 Ga0209051_1001453 Ga0209051_100145317 255
297 3300025304 Ga0209257_1000204 Ga0209257_1000204108 255
298 3300025304 Ga0209257_1000325 Ga0209257_100032577 255
299 3300025304 Ga0209257_1001190 Ga0209257_100119016 255
300 3300025304 Ga0209257_1001230 Ga0209257_100123028 255
301 3300025304 Ga0209257_1003198 Ga0209257_10031987 255
302 3300025735 Ga0207713_1037979 Ga0207713_10379793 255
303 3300025903 Ga0207680_10000013 Ga0207680_10000013150 255
304 3300025909 Ga0207705_10004884 Ga0207705_100048842 255
305 3300025909 Ga0207705_10117864 Ga0207705_101178641 255
306 3300025919 Ga0207657_10038315 Ga0207657_100383153 255
307 3300025923 Ga0207681_10105683 Ga0207681_101056832 255
308 3300025924 Ga0207694_10000122 Ga0207694_100001228 255
309 3300025925 Ga0207650_10173149 Ga0207650_101731492 255
310 3300025925 Ga0207650_10339642 Ga0207650_103396422 255
311 3300025932 Ga0207690_10093458 Ga0207690_100934582 255
312 3300025935 Ga0207709_10004875 Ga0207709_100048755 255
313 3300025935 Ga0207709_10214806 Ga0207709_102148062 255
314 3300025940 Ga0207691_10000320 Ga0207691_100003203 255
315 3300025972 Ga0207668_10008378 Ga0207668_100083782 255
316 3300025972 Ga0207668_10043455 Ga0207668_100434553 255
317 3300025981 Ga0207640_10153942 Ga0207640_101539422 255
318 3300026023 Ga0207677_10093552 Ga0207677_100935522 255
319 3300026035 Ga0207703_10323447 Ga0207703_103234472 255
320 3300026041 Ga0207639_10072203 Ga0207639_100722032 255
321 3300026067 Ga0207678_10188190 Ga0207678_101881902 255
322 3300026088 Ga0207641_10384407 Ga0207641_103844071 255
323 3300026095 Ga0207676_10200171 Ga0207676_102001712 255
324 3300026116 Ga0207674_10400970 Ga0207674_104009702 255
325 3300026121 Ga0207683_10019798 Ga0207683_100197982 255
326 3300027312 Ga0209371_1000004 Ga0209371_1000004560 255
327 3300027360 Ga0209969_1003869 Ga0209969_10038692 255
328 3300027543 Ga0209999_1006000 Ga0209999_10060001 255
329 3300027665 Ga0209983_1014308 Ga0209983_10143082 255
330 3300027876 Ga0209974_10025383 Ga0209974_100253832 255
331 3300028379 Ga0268266_10000021 Ga0268266_10000021152 255
332 3300028379 Ga0268266_10122312 Ga0268266_101223123 255
333 3300028379 Ga0268266_10137048 Ga0268266_101370481 255
334 3300030500 Ga0268256_1000005 Ga0268256_1000005486 255
335 3300030742 Ga0316183_1205388 Ga0316183_12053887 255
336 3300030744 Ga0316181_1074201 Ga0316181_10742012 255
337 3300030744 Ga0316181_1238080 Ga0316181_12380801 255
338 3300030745 Ga0316182_1359052 Ga0316182_13590522 255
339 3300031456 Ga0307513_10021897 Ga0307513_100218973 255
340 3300031456 Ga0307513_10121646 Ga0307513_101216461 255
341 3300031548 Ga0307408_100000815 Ga0307408_10000081512 255
342 3300031731 Ga0307405_10127823 Ga0307405_101278232 255
343 3300031731 Ga0307405_10412222 Ga0307405_104122221 255
344 3300031824 Ga0307413_10143045 Ga0307413_101430452 255
345 3300031852 Ga0307410_10029465 Ga0307410_100294652 255
346 3300031852 Ga0307410_10239892 Ga0307410_102398922 255
347 3300031901 Ga0307406_10027208 Ga0307406_100272083 255
348 3300031911 Ga0307412_10268070 Ga0307412_102680702 255
349 3300031995 Ga0307409_100208398 Ga0307409_1002083982 255
350 3300032004 Ga0307414_10010446 Ga0307414_100104461 255
351 3300032004 Ga0307414_10085753 Ga0307414_100857531 255
352 3300032004 Ga0307414_10092394 Ga0307414_100923942 255
353 3300032004 Ga0307414_10099037 Ga0307414_100990372 255
354 3300032004 Ga0307414_10272448 Ga0307414_102724481 255
355 3300032005 Ga0307411_10419626 Ga0307411_104196262 255
356 3300034818 Ga0373950_0023984 Ga0373950_0023984_45_821 255
357 3300035092 Ga0373952_0008329 Ga0373952_0008329_860_1636 255
358 3300037312 Ga0395899_0034252 Ga0395899_0034252_984_1778 255
359 3300037418 Ga0395900_0207555 Ga0395900_0207555_291_1112 255
360 3300037471 Ga0395905_0004849 Ga0395905_0004849_10402_11196 255
361 3300037471 Ga0395905_0109512 Ga0395905_0109512_1340_2134 255
362 3300037471 Ga0395905_0172869 Ga0395905_0172869_404_1180 255
363 3300038443 Ga0395901_0005473 Ga0395901_0005473_11577_12371 255
364 3300038705 Ga0237819_00047 Ga0237819_00047_1572_2348 255
365 3300041404 Ga0439436_0041852 Ga0439436_0041852_50_898 255
366 3300041413 Ga0439465_0000521 Ga0439465_0000521_7893_8687 255
367 3300041413 Ga0439465_0008761 Ga0439465_0008761_305_1099 255
368 3300041453 Ga0451797_1356149 Ga0451797_1356149_275_1069 255
369 3300041459 Ga0451800_0743803 Ga0451800_0743803_137_922 255
370 3300041460 Ga0451802_0893561 Ga0451802_0893561_475_1269 255
371 3300041462 Ga0451806_008777 Ga0451806_008777_277_1071 255
372 3300041486 Ga0451807_1122491 Ga0451807_1122491_185_979 255
373 3300041486 Ga0451807_2237182 Ga0451807_2237182_18_812 255
374 3300041512 Ga0451853_0369548 Ga0451853_0369548_147_941 255
375 3300042004 Ga0439445_0024673 Ga0439445_0024673_630_1406 255
376 3300042007 Ga0439449_0000100 Ga0439449_0000100_17118_17894 255
377 3300042007 Ga0439449_0008298 Ga0439449_0008298_720_1514 255
378 3300042007 Ga0439449_0011539 Ga0439449_0011539_2099_2875 255
379 3300042007 Ga0439449_0013732 Ga0439449_0013732_1382_2158 255
380 3300042015 Ga0439462_0037214 Ga0439462_0037214_163_939 255
381 3300042876 Ga0451577_0030387 Ga0451577_0030387_3239_4018 255
382 3300042876 Ga0451577_0058858 Ga0451577_0058858_2526_3302 255
383 3300042876 Ga0451577_0121782 Ga0451577_0121782_991_1779 255
384 3300046501 Ga0495607_0039609 Ga0495607_0039609_1047_1832 255
385 3300046507 Ga0495606_0006031 Ga0495606_0006031_4649_5434 255
386 3300046522 Ga0495643_0003914 Ga0495643_0003914_3340_4122 255
387 3300046525 Ga0495663_0001073 Ga0495663_0001073_83_877 255
388 3300046525 Ga0495663_0112453 Ga0495663_0112453_70_846 255
389 3300046539 Ga0495621_0000034 Ga0495621_0000034_4993_5769 255
390 3300046539 Ga0495621_0042391 Ga0495621_0042391_219_1010 255
391 3300046615 Ga0495656_0023952 Ga0495656_0023952_790_1566 255
392 3300046660 Ga0495625_0065261 Ga0495625_0065261_924_1706 255
393 3300047318 Ga0495636_0002356 Ga0495636_0002356_714_1490 255
394 3300047318 Ga0495636_0009372 Ga0495636_0009372_2603_3379 255
395 3300047320 Ga0495672_0000308 Ga0495672_0000308_17453_18235 255
396 3300047472 Ga0495686_0018413 Ga0495686_0018413_1653_2429 255
397 3300048911 Ga0496108_0147255 Ga0496108_0147255_715_1491 255
398 3300048912 Ga0496109_0032427 Ga0496109_0032427_1508_2284 255
399 3300048913 Ga0496110_0185013 Ga0496110_0185013_1030_1806 255
400 3300048914 Ga0496111_0283607 Ga0496111_0283607_283_1059 255
401 3300048917 Ga0496114_0032003 Ga0496114_0032003_3157_3933 255
402 3300048920 Ga0496117_0001552 Ga0496117_0001552_25375_26157 255
403 3300048920 Ga0496117_0010196 Ga0496117_0010196_1500_2282 255
404 3300048920 Ga0496117_0154078 Ga0496117_0154078_389_1156 255
405 3300048921 Ga0496118_0000681 Ga0496118_0000681_47946_48728 255
406 3300048921 Ga0496118_0011182 Ga0496118_0011182_6446_7228 255
407 3300048922 Ga0496119_0000902 Ga0496119_0000902_16001_16783 255
408 3300048923 Ga0496120_0000605 Ga0496120_0000605_47836_48618 255
409 3300048924 Ga0496121_0007368 Ga0496121_0007368_6129_6911 255
410 3300048924 Ga0496121_0120433 Ga0496121_0120433_214_981 255
411 3300048925 Ga0496122_0009883 Ga0496122_0009883_3496_4290 255
412 3300048925 Ga0496122_0021138 Ga0496122_0021138_2043_2819 255
413 3300048926 Ga0496123_0007762 Ga0496123_0007762_5731_6525 255
414 3300048926 Ga0496123_0019039 Ga0496123_0019039_3136_3912 255
415 3300048927 Ga0496124_0000032 Ga0496124_0000032_238303_239079 255
416 3300048927 Ga0496124_0012740 Ga0496124_0012740_6048_6914 255
417 3300048927 Ga0496124_0014295 Ga0496124_0014295_6313_7095 255
418 3300048928 Ga0496125_0019981 Ga0496125_0019981_5478_6260 255
419 3300048928 Ga0496125_0025896 Ga0496125_0025896_624_1391 255
420 3300048928 Ga0496125_0065542 Ga0496125_0065542_1713_2495 255
421 3300048929 Ga0496126_0003747 Ga0496126_0003747_12344_13126 255
422 3300048929 Ga0496126_0068216 Ga0496126_0068216_1598_2365 255
423 3300049523 Ga0501300_005773 Ga0501300_005773_607_1401 255
424 3300049569 Ga0501032_0026292 Ga0501032_0026292_2718_3512 255
425 3300049570 Ga0501033_0003657 Ga0501033_0003657_3063_3857 255
426 3300049571 Ga0501034_0001322 Ga0501034_0001322_20509_21285 255
427 3300049571 Ga0501034_0047892 Ga0501034_0047892_3307_4101 255
428 3300049571 Ga0501034_0260087 Ga0501034_0260087_185_979 255
429 3300049574 Ga0501038_0032794 Ga0501038_0032794_3402_4196 255
430 3300049574 Ga0501038_0141941 Ga0501038_0141941_804_1598 255
431 3300049579 Ga0501043_0041384 Ga0501043_0041384_827_1621 255
432 3300049579 Ga0501043_0117490 Ga0501043_0117490_915_1709 255
433 3300049581 Ga0501047_0137520 Ga0501047_0137520_656_1450 255
434 3300049705 Ga0501225_0004143 Ga0501225_0004143_712_1488 255
435 3300049764 Ga0501267_001614 Ga0501267_001614_326_1102 255
436 3300049823 Ga0501044_0187785 Ga0501044_0187785_830_1624 255
437 3300049823 Ga0501044_0481986 Ga0501044_0481986_103_897 255
438 3300050491 nmdc:mga00v17_1917_c1 nmdc:mga00v17_1917_c1_2660_3436 255
439 3300053161 Ga0500634_0006424 Ga0500634_0006424_3643_4413 255
440 iso_pu_bacteria 2524614729 2525556972 255
441 iso_pu_bacteria 2547132130 2547500581 255
442 iso_pu_bacteria 2547132130 2547501558 255
443 iso_pu_bacteria 2576861471 2578459025 255
444 iso_pu_bacteria 2627854209 2630648568 255
445 iso_pu_bacteria 2643221554 2643789143 255
446 iso_pu_bacteria 2643221638 2644215083 255
447 iso_pu_bacteria 2816332141 2816516374 255
448 iso_pu_bacteria 2937610967 2937611797 255
449 iso_pu_bacteria 2939626828 2939627736 255
450 iso_pu_bacteria 2941489479 2941489627 255
451 iso_pu_bacteria 2961047084 2961047741 255
452 iso_pu_bacteria 2987605356 2987608237 255
453 iso_pu_bacteria 2995948881 2995950836 255
454 iso_pu_bacteria 8003014200 8003014771 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

59

289

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9969 2 255
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9893 2 250
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9853 2 255
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9853 2 250
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9836 2 249
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9967 2 255 3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9885 14 127 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.985 2 255 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9836 2 249 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.982 1 251 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A6A5L7G8-F1-model_v4 deleted 1.001 1 242
AF-A0A4Q6F1R4-F1-model_v4 deleted 1.001 37 250
AF-A0A1I1G459-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 1 1 254 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A381UK33-F1-model_v4 Peptidase M24 domain-containing protein 0.9996 1 253 GO:0005829
GO:0006508
GO:0070006
AF-A0A3C0LYD4-F1-model_v4 deleted 0.9989 105 205

Feature Viewer

pLDDT pTM Quality
97.35 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map