F446752

General Info

Members Datasets Scaffolds Average Seq Length
451 239 451 90

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101071127|Ga0068863_1010711271
Length 103
Sequence VVTVTSDKNVQTRMDLKTFSTIFTSVFIAELGDKTQLATLLFASDKETSKLTVFIGASLALVVTSAIGVMAGSVISQYVSEKTLHYLAGIGFIAIGIWTLVKA

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
184 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
185 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
208 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
213 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
216 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
222 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
223 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.22
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000393 3300000532 Bacteria 4250
2 JGI24737J22298_10125478 3300001990 Bacteria 758
3 JGI24737J22298_10201178 3300001990 Bacteria 588
4 Ga0065704_10406542 3300005289 Unclassified 746
5 Ga0065704_10693806 3300005289 Unclassified 552
6 Ga0065712_10006790 3300005290 Bacteria 6590
7 Ga0065715_10006755 3300005293 Unclassified 4178
8 Ga0065715_10014542 3300005293 Bacteria 4944
9 Ga0065715_10280347 3300005293 Bacteria 1088
10 Ga0065707_10122232 3300005295 Bacteria 2092
11 Ga0065707_10137096 3300005295 Unclassified 1797
12 Ga0070676_10014318 3300005328 Bacteria 4359
13 Ga0070690_100351667 3300005330 Bacteria 1070
14 Ga0070690_100708704 3300005330 Bacteria 773
15 Ga0070670_100001204 3300005331 Bacteria 20535
16 Ga0070677_10027089 3300005333 Bacteria 2155
17 Ga0070677_10094979 3300005333 Bacteria 1304
18 Ga0070677_10384355 3300005333 Unclassified 736
19 Ga0070666_10349041 3300005335 Bacteria 1058
20 Ga0070666_11250894 3300005335 Bacteria 553
21 Ga0070680_100010224 3300005336 Bacteria 7233
22 Ga0070680_100383553 3300005336 Unclassified 1197
23 Ga0068868_100168962 3300005338 Bacteria 1810
24 Ga0068868_101205881 3300005338 Unclassified 700
25 Ga0070660_100070931 3300005339 Bacteria 2719
26 Ga0070689_100086382 3300005340 Unclassified 2467
27 Ga0070691_10010878 3300005341 Bacteria 4153
28 Ga0070691_10907857 3300005341 Unclassified 544
29 Ga0070661_100010018 3300005344 Bacteria 6578
30 Ga0070669_100337992 3300005353 Bacteria 1219
31 Ga0070669_100719393 3300005353 Unclassified 844
32 Ga0070675_100522126 3300005354 Bacteria 1071
33 Ga0070674_100834319 3300005356 Bacteria 798
34 Ga0070674_101960324 3300005356 Unclassified 533
35 Ga0070673_100045290 3300005364 Bacteria 3411
36 Ga0070673_100704187 3300005364 Bacteria 927
37 Ga0070688_100112597 3300005365 Bacteria 1812
38 Ga0070688_101548102 3300005365 Bacteria 540
39 Ga0070659_100042157 3300005366 Bacteria 3568
40 Ga0070667_100351502 3300005367 Bacteria 1334
41 Ga0070701_10008841 3300005438 Bacteria 4379
42 Ga0070705_100077889 3300005440 Bacteria 2026
43 Ga0070705_101085871 3300005440 Bacteria 654
44 Ga0070705_101858779 3300005440 Bacteria 512
45 Ga0070705_101912797 3300005440 Bacteria 505
46 Ga0070700_100002407 3300005441 Bacteria 9539
47 Ga0070700_100139417 3300005441 Bacteria 1646
48 Ga0070694_100019641 3300005444 Bacteria 4300
49 Ga0070694_100079252 3300005444 Bacteria 2280
50 Ga0070694_100753170 3300005444 Unclassified 795
51 Ga0070663_100050881 3300005455 Bacteria 2948
52 Ga0070678_100104013 3300005456 Bacteria 2207
53 Ga0070662_100012982 3300005457 Bacteria 5535
54 Ga0070662_100146698 3300005457 Bacteria 1833
55 Ga0070662_100440453 3300005457 Unclassified 1080
56 Ga0070681_10018226 3300005458 Bacteria 7017
57 Ga0070681_10210891 3300005458 Bacteria 1858
58 Ga0070685_10216015 3300005466 Bacteria 1254
59 Ga0070706_101504858 3300005467 Unclassified 615
60 Ga0070699_100606725 3300005518 Unclassified 998
61 Ga0070699_101253320 3300005518 Unclassified 680
62 Ga0070679_100006428 3300005530 Bacteria 10947
63 Ga0070679_100074523 3300005530 Unclassified 3385
64 Ga0070697_100009028 3300005536 Bacteria 7788
65 Ga0070697_100074585 3300005536 Unclassified 2787
66 Ga0070697_100735678 3300005536 Unclassified 871
67 Ga0070672_100664899 3300005543 Bacteria 910
68 Ga0070695_100084226 3300005545 Bacteria 2108
69 Ga0070695_101002112 3300005545 Unclassified 679
70 Ga0070695_101075070 3300005545 Bacteria 657
71 Ga0070696_100039980 3300005546 Bacteria 3238
72 Ga0070696_100127386 3300005546 Bacteria 1849
73 Ga0070696_100155309 3300005546 Bacteria 1682
74 Ga0070693_100050694 3300005547 Bacteria 2374
75 Ga0070693_100199021 3300005547 Bacteria 1300
76 Ga0070665_100736557 3300005548 Bacteria 999
77 Ga0070665_101695148 3300005548 Bacteria 639
78 Ga0070704_100231841 3300005549 Bacteria 1507
79 Ga0070704_100245716 3300005549 Bacteria 1467
80 Ga0068855_100061205 3300005563 Bacteria 4399
81 Ga0070664_100465737 3300005564 Bacteria 1162
82 Ga0068857_100466011 3300005577 Bacteria 1183
83 Ga0068854_100080159 3300005578 Bacteria 2408
84 Ga0068854_100142597 3300005578 Bacteria 1840
85 Ga0068856_101819609 3300005614 Bacteria 620
86 Ga0070702_100025913 3300005615 Bacteria 3147
87 Ga0068852_102476049 3300005616 Unclassified 539
88 Ga0068859_100199144 3300005617 Bacteria 2087
89 Ga0068859_100449731 3300005617 Bacteria 1384
90 Ga0068864_101673833 3300005618 Bacteria 641
91 Ga0068866_11369839 3300005718 Bacteria 516
92 Ga0068861_100471500 3300005719 Bacteria 1129
93 Ga0068861_102162235 3300005719 Unclassified 557
94 Ga0068861_102487641 3300005719 Unclassified 521
95 Ga0068870_10023409 3300005840 Unclassified 3045
96 Ga0068863_101071127 3300005841 Bacteria 810
97 Ga0068860_100861154 3300005843 Bacteria 921
98 Ga0068862_100178375 3300005844 Bacteria 1905
99 Ga0068862_101179898 3300005844 Unclassified 763
100 Ga0081455_10000235 3300005937 Bacteria 71796
101 Ga0081455_10278057 3300005937 Bacteria 1211
102 Ga0081455_10537479 3300005937 Unclassified 776
103 Ga0070716_100638328 3300006173 Unclassified 806
104 Ga0097621_100071620 3300006237 Bacteria 2865
105 Ga0068871_101303526 3300006358 Bacteria 683
106 Ga0075428_100114265 3300006844 Bacteria 2941
107 Ga0075428_100505351 3300006844 Bacteria 1293
108 Ga0075428_100574149 3300006844 Unclassified 1205
109 Ga0075428_100751193 3300006844 Unclassified 1038
110 Ga0075428_101390121 3300006844 Bacteria 737
111 Ga0075428_101448675 3300006844 Bacteria 720
112 Ga0075430_100086083 3300006846 Bacteria 2631
113 Ga0075430_100119155 3300006846 Bacteria 2200
114 Ga0075430_100120034 3300006846 Bacteria 2191
115 Ga0075430_100514768 3300006846 Bacteria 987
116 Ga0075430_100737785 3300006846 Bacteria 812
117 Ga0075431_100132674 3300006847 Unclassified 2569
118 Ga0075431_100284939 3300006847 Unclassified 1672
119 Ga0075431_100796192 3300006847 Unclassified 919
120 Ga0075433_10014604 3300006852 Bacteria 6420
121 Ga0075433_10042696 3300006852 Bacteria 3935
122 Ga0075433_10077508 3300006852 Unclassified 2928
123 Ga0075433_10319099 3300006852 Bacteria 1375
124 Ga0075433_11382291 3300006852 Bacteria 609
125 Ga0075434_100006851 3300006871 Bacteria 10492
126 Ga0075434_100182908 3300006871 Bacteria 2117
127 Ga0075434_100228147 3300006871 Bacteria 1882
128 Ga0075429_100092640 3300006880 Unclassified 2635
129 Ga0075429_100223985 3300006880 Bacteria 1647
130 Ga0075429_100530387 3300006880 Bacteria 1032
131 Ga0068865_100661782 3300006881 Bacteria 889
132 Ga0068865_101160924 3300006881 Bacteria 682
133 Ga0075436_100100729 3300006914 Bacteria 2012
134 Ga0075436_100516598 3300006914 Bacteria 875
135 Ga0097620_100199143 3300006931 Bacteria 2087
136 Ga0097620_100449730 3300006931 Bacteria 1384
137 Ga0075435_100063103 3300007076 Bacteria 3009
138 Ga0075435_100082755 3300007076 Unclassified 2639
139 Ga0075435_101727991 3300007076 Bacteria 549
140 Ga0099795_10516654 3300007788 Bacteria 559
141 Ga0111539_10036555 3300009094 Bacteria 5936
142 Ga0111539_10125511 3300009094 Bacteria 3007
143 Ga0111539_10192672 3300009094 Bacteria 2378
144 Ga0111539_10728224 3300009094 Unclassified 1155
145 Ga0111539_11105883 3300009094 Unclassified 921
146 Ga0114129_11156273 3300009147 Unclassified 966
147 Ga0114129_11273124 3300009147 Bacteria 913
148 Ga0114129_11435494 3300009147 Bacteria 850
149 Ga0114129_11569963 3300009147 Bacteria 807
150 Ga0114129_12079472 3300009147 Unclassified 685
151 Ga0105243_12721419 3300009148 Unclassified 535
152 Ga0105241_10133021 3300009174 Bacteria 2016
153 Ga0105242_12182739 3300009176 Bacteria 599
154 Ga0105248_10701359 3300009177 Bacteria 1142
155 Ga0105237_10479013 3300009545 Bacteria 1251
156 Ga0105249_10818489 3300009553 Bacteria 996
157 Ga0105249_11216014 3300009553 Bacteria 825
158 Ga0105249_13287028 3300009553 Unclassified 520
159 Ga0105239_10083873 3300010375 Bacteria 3510
160 Ga0105246_10146214 3300011119 Bacteria 1784
161 Ga0157324_1008614 3300012506 Bacteria 825
162 Ga0157373_10045421 3300013100 Bacteria 3135
163 Ga0157373_10149412 3300013100 Bacteria 1643
164 Ga0157373_10383288 3300013100 Bacteria 1006
165 Ga0157373_10472864 3300013100 Bacteria 904
166 Ga0157371_10016353 3300013102 Bacteria 5540
167 Ga0157374_10019947 3300013296 Bacteria 5942
168 Ga0157378_10320658 3300013297 Bacteria 1505
169 Ga0157378_11727368 3300013297 Unclassified 673
170 Ga0157378_11994228 3300013297 Bacteria 630
171 Ga0157378_12328437 3300013297 Unclassified 587
172 Ga0163162_10068663 3300013306 Bacteria 3596
173 Ga0157372_10140573 3300013307 Bacteria 2781
174 Ga0157375_10069489 3300013308 Bacteria 3529
175 Ga0163163_10257565 3300014325 Unclassified 1795
176 Ga0163163_10558673 3300014325 Bacteria 1207
177 Ga0157380_10030444 3300014326 Unclassified 4133
178 Ga0157380_10107636 3300014326 Bacteria 2335
179 Ga0157380_12591810 3300014326 Unclassified 573
180 Ga0157377_10211248 3300014745 Bacteria 1237
181 Ga0157379_10034438 3300014968 Bacteria 4516
182 Ga0157376_10012426 3300014969 Bacteria 6320
183 Ga0157376_10764009 3300014969 Bacteria 977
184 Ga0182007_10145068 3300015262 Bacteria 805
185 Ga0207673_1031349 3300025290 Bacteria 737
186 Ga0207697_10006881 3300025315 Bacteria 5101
187 Ga0207682_10173301 3300025893 Bacteria 982
188 Ga0207688_10094290 3300025901 Bacteria 1722
189 Ga0207680_10185259 3300025903 Unclassified 1410
190 Ga0207647_10365377 3300025904 Bacteria 816
191 Ga0207647_10637535 3300025904 Bacteria 585
192 Ga0207645_10002584 3300025907 Bacteria 14113
193 Ga0207643_10341687 3300025908 Unclassified 938
194 Ga0207705_10157696 3300025909 Bacteria 1703
195 Ga0207707_10020281 3300025912 Bacteria 5803
196 Ga0207707_10085168 3300025912 Bacteria 2761
197 Ga0207707_10526683 3300025912 Bacteria 1006
198 Ga0207695_11475773 3300025913 Unclassified 560
199 Ga0207671_10086979 3300025914 Bacteria 2350
200 Ga0207660_10054006 3300025917 Bacteria 2865
201 Ga0207660_10903816 3300025917 Bacteria 720
202 Ga0207662_10293846 3300025918 Bacteria 1078
203 Ga0207662_11091726 3300025918 Bacteria 567
204 Ga0207657_10002787 3300025919 Bacteria 18798
205 Ga0207649_10582241 3300025920 Bacteria 859
206 Ga0207652_10077623 3300025921 Unclassified 2898
207 Ga0207652_10175850 3300025921 Bacteria 1922
208 Ga0207681_11036615 3300025923 Bacteria 688
209 Ga0207681_11207508 3300025923 Unclassified 635
210 Ga0207650_10042361 3300025925 Bacteria 3340
211 Ga0207659_10173996 3300025926 Bacteria 1700
212 Ga0207659_10905605 3300025926 Bacteria 758
213 Ga0207644_10183934 3300025931 Bacteria 1639
214 Ga0207690_10053785 3300025932 Bacteria 2703
215 Ga0207706_10038000 3300025933 Bacteria 4272
216 Ga0207706_10333648 3300025933 Unclassified 1319
217 Ga0207686_10033683 3300025934 Unclassified 3059
218 Ga0207686_10459792 3300025934 Bacteria 981
219 Ga0207670_10264726 3300025936 Unclassified 1334
220 Ga0207704_10280241 3300025938 Bacteria 1267
221 Ga0207665_10740450 3300025939 Unclassified 774
222 Ga0207691_10017033 3300025940 Bacteria 6897
223 Ga0207691_10788067 3300025940 Unclassified 799
224 Ga0207711_11791440 3300025941 Unclassified 557
225 Ga0207679_10286415 3300025945 Bacteria 1415
226 Ga0207679_10401215 3300025945 Unclassified 1206
227 Ga0207667_10050101 3300025949 Bacteria 4407
228 Ga0207651_10044491 3300025960 Bacteria 2972
229 Ga0207651_10841571 3300025960 Unclassified 815
230 Ga0207712_11353541 3300025961 Bacteria 637
231 Ga0207712_11533120 3300025961 Unclassified 597
232 Ga0207712_11623984 3300025961 Unclassified 579
233 Ga0207668_11330381 3300025972 Bacteria 647
234 Ga0207640_10100744 3300025981 Bacteria 2025
235 Ga0207658_10230204 3300025986 Bacteria 1564
236 Ga0207677_10344647 3300026023 Bacteria 1246
237 Ga0207677_11162648 3300026023 Unclassified 705
238 Ga0207678_10020541 3300026067 Bacteria 5789
239 Ga0207702_10028811 3300026078 Bacteria 4618
240 Ga0207648_10092985 3300026089 Bacteria 2637
241 Ga0207674_10157448 3300026116 Bacteria 2226
242 Ga0207674_11482705 3300026116 Bacteria 647
243 Ga0207674_11589913 3300026116 Bacteria 622
244 Ga0207675_100263865 3300026118 Bacteria 1670
245 Ga0207683_10013444 3300026121 Bacteria 6983
246 Ga0207683_10204410 3300026121 Bacteria 1796
247 Ga0207698_11588904 3300026142 Unclassified 669
248 Ga0209974_10422352 3300027876 Bacteria 526
249 Ga0207428_10061861 3300027907 Bacteria 2962
250 Ga0207428_10063228 3300027907 Bacteria 2924
251 Ga0207428_10725890 3300027907 Bacteria 709
252 Ga0268266_12114153 3300028379 Unclassified 536
253 Ga0268265_11137738 3300028380 Unclassified 776
254 Ga0268265_12048334 3300028380 Bacteria 579
255 Ga0307408_100081611 3300031548 Bacteria 2418
256 Ga0316579_10348822 3300031691 Bacteria 716
257 Ga0316576_10225575 3300031727 Bacteria 1409
258 Ga0307405_10358282 3300031731 Unclassified 1128
259 Ga0307405_10620434 3300031731 Unclassified 885
260 Ga0307413_10001823 3300031824 Bacteria 8370
261 Ga0307413_10133281 3300031824 Bacteria 1704
262 Ga0307413_10543361 3300031824 Unclassified 941
263 Ga0307410_10001965 3300031852 Bacteria 9656
264 Ga0307410_10012664 3300031852 Unclassified 4887
265 Ga0307410_10480387 3300031852 Unclassified 1019
266 Ga0307410_10622197 3300031852 Bacteria 903
267 Ga0307406_10012210 3300031901 Bacteria 4894
268 Ga0307406_10631557 3300031901 Bacteria 887
269 Ga0307406_11902446 3300031901 Unclassified 530
270 Ga0307407_10000184 3300031903 Bacteria 18812
271 Ga0307407_11437760 3300031903 Bacteria 544
272 Ga0307412_10005040 3300031911 Bacteria 7384
273 Ga0307412_10992334 3300031911 Unclassified 741
274 Ga0307412_11544678 3300031911 Unclassified 605
275 Ga0307409_100001367 3300031995 Bacteria 11903
276 Ga0307409_100028723 3300031995 Bacteria 3968
277 Ga0307409_100254223 3300031995 Unclassified 1608
278 Ga0307409_100537421 3300031995 Bacteria 1145
279 Ga0307409_101079646 3300031995 Bacteria 823
280 Ga0307409_101117257 3300031995 Bacteria 810
281 Ga0307416_100044184 3300032002 Bacteria 3496
282 Ga0307416_100122228 3300032002 Bacteria 2323
283 Ga0307416_100781750 3300032002 Bacteria 1049
284 Ga0307416_100806505 3300032002 Unclassified 1035
285 Ga0307416_101627452 3300032002 Bacteria 751
286 Ga0307414_10023717 3300032004 Bacteria 3897
287 Ga0307414_10164239 3300032004 Bacteria 1768
288 Ga0307414_11216244 3300032004 Unclassified 698
289 Ga0307411_10000372 3300032005 Bacteria 15249
290 Ga0307411_10668409 3300032005 Bacteria 901
291 Ga0307411_11863304 3300032005 Unclassified 559
292 Ga0307415_100257126 3300032126 Bacteria 1422
293 Ga0307415_100529739 3300032126 Bacteria 1036
294 Ga0373958_0075700 3300034819 Unclassified 754
295 Ga0373931_0025348 3300035691 Unclassified 3012
296 Ga0373947_0158820 3300035725 Unclassified 1461
297 Ga0373937_1172867 3300036401 Bacteria 717
298 Ga0316582_0003062 3300036647 Bacteria 8075
299 Ga0316582_0296995 3300036647 Bacteria 1110
300 Ga0316582_0481929 3300036647 Bacteria 855
301 Ga0316584_0019519 3300036712 Bacteria 4901
302 Ga0316584_0209230 3300036712 Bacteria 1436
303 Ga0373925_1116779 3300037068 Unclassified 648
304 Ga0316581_0062985 3300037588 Bacteria 1138
305 Ga0439466_0134821 3300041411 Bacteria 759
306 Ga0439456_162732 3300042013 Unclassified 522
307 Ga0439435_0123037 3300042436 Unclassified 814
308 Ga0439435_0298152 3300042436 Unclassified 552
309 Ga0453684_0969185 3300044712 Bacteria 906
310 Ga0451576_1649955 3300045051 Unclassified 664
311 Ga0495662_0150840 3300046476 Bacteria 1145
312 Ga0496100_0757329 3300048903 Bacteria 760
313 Ga0496101_0950424 3300048904 Unclassified 676
314 Ga0496102_0327246 3300048905 Unclassified 1444
315 Ga0496102_1095589 3300048905 Bacteria 716
316 Ga0496103_0872899 3300048906 Unclassified 565
317 Ga0496104_0943433 3300048907 Bacteria 767
318 Ga0496106_0183849 3300048909 Unclassified 1660
319 Ga0496108_0507028 3300048911 Bacteria 1054
320 Ga0496109_0263113 3300048912 Unclassified 1625
321 Ga0496110_0394718 3300048913 Unclassified 1261
322 Ga0501290_094254 3300049513 Unclassified 525
323 Ga0501292_007211 3300049515 Bacteria 1602
324 Ga0501292_057897 3300049515 Unclassified 698
325 Ga0501296_003737 3300049519 Bacteria 1635
326 Ga0501031_0025338 3300049568 Bacteria 3870
327 Ga0501031_0031236 3300049568 Bacteria 3474
328 Ga0501032_0204038 3300049569 Bacteria 1290
329 Ga0501033_0461518 3300049570 Unclassified 881
330 Ga0501033_0867365 3300049570 Bacteria 608
331 Ga0501036_0135899 3300049572 Bacteria 2075
332 Ga0501036_1264377 3300049572 Unclassified 600
333 Ga0501037_0513224 3300049573 Unclassified 812
334 Ga0501037_0909620 3300049573 Unclassified 576
335 Ga0501039_0007215 3300049575 Bacteria 8469
336 Ga0501039_0260690 3300049575 Bacteria 1362
337 Ga0501040_0001075 3300049576 Bacteria 17284
338 Ga0501040_0004289 3300049576 Bacteria 9267
339 Ga0501040_0890578 3300049576 Unclassified 645
340 Ga0501041_0000212 3300049577 Bacteria 26965
341 Ga0501041_0002557 3300049577 Bacteria 10367
342 Ga0501041_0139701 3300049577 Bacteria 1510
343 Ga0501042_0004744 3300049578 Bacteria 8677
344 Ga0501042_0010253 3300049578 Bacteria 6272
345 Ga0501043_0134141 3300049579 Bacteria 1940
346 Ga0501043_0277592 3300049579 Bacteria 1285
347 Ga0501046_0049175 3300049580 Bacteria 3336
348 Ga0501046_0077624 3300049580 Bacteria 2571
349 Ga0501046_1064392 3300049580 Bacteria 560
350 Ga0501047_0511012 3300049581 Bacteria 1028
351 Ga0501047_0628059 3300049581 Bacteria 895
352 Ga0501048_0006152 3300049582 Bacteria 9137
353 Ga0501048_1379389 3300049582 Bacteria 507
354 Ga0501070_0450001 3300049586 Bacteria 1038
355 Ga0501071_0000452 3300049587 Bacteria 20662
356 Ga0501071_0119803 3300049587 Bacteria 1950
357 Ga0501071_0173975 3300049587 Bacteria 1612
358 Ga0501072_0000380 3300049588 Bacteria 31765
359 Ga0501072_0119211 3300049588 Bacteria 2102
360 Ga0501072_0804267 3300049588 Unclassified 736
361 Ga0501073_0788776 3300049589 Bacteria 655
362 Ga0501074_0002770 3300049590 Bacteria 12261
363 Ga0501074_0170329 3300049590 Bacteria 1554
364 Ga0501075_0000095 3300049591 Bacteria 40804
365 Ga0501075_0284578 3300049591 Bacteria 1259
366 Ga0501076_0104681 3300049592 Bacteria 2283
367 Ga0501076_0585229 3300049592 Bacteria 920
368 Ga0501076_0795138 3300049592 Bacteria 780
369 Ga0501076_0808748 3300049592 Bacteria 773
370 Ga0501077_0000279 3300049593 Bacteria 30357
371 Ga0501077_0004012 3300049593 Bacteria 8878
372 Ga0501209_029939 3300049656 Bacteria 1372
373 Ga0501217_006941 3300049661 Unclassified 2419
374 Ga0501217_137601 3300049661 Unclassified 721
375 Ga0501223_010027 3300049663 Bacteria 1911
376 Ga0501235_045552 3300049669 Unclassified 1009
377 Ga0501249_009457 3300049679 Unclassified 2028
378 Ga0501259_015247 3300049688 Bacteria 1311
379 Ga0501261_031291 3300049690 Unclassified 805
380 Ga0501225_0047354 3300049705 Unclassified 1193
381 Ga0501225_0058122 3300049705 Unclassified 1085
382 Ga0501229_049129 3300049706 Unclassified 619
383 Ga0501234_092853 3300049707 Bacteria 543
384 Ga0501079_0003344 3300049741 Bacteria 11761
385 Ga0501079_0009369 3300049741 Bacteria 7420
386 Ga0501079_0440510 3300049741 Bacteria 1023
387 Ga0501079_0934862 3300049741 Bacteria 683
388 Ga0501080_0066421 3300049742 Bacteria 3354
389 Ga0501080_0513432 3300049742 Bacteria 1070
390 Ga0501081_0000063 3300049743 Bacteria 41530
391 Ga0501081_0119908 3300049743 Bacteria 1873
392 Ga0501081_0441155 3300049743 Bacteria 966
393 Ga0501083_0035354 3300049744 Bacteria 3414
394 Ga0501083_0472252 3300049744 Unclassified 816
395 Ga0501241_041656 3300049758 Bacteria 891
396 Ga0501270_015244 3300049767 Unclassified 1094
397 Ga0501283_080816 3300049779 Bacteria 611
398 Ga0501035_0024662 3300049822 Bacteria 5514
399 Ga0501045_0007504 3300049824 Bacteria 7578
400 Ga0501045_0069589 3300049824 Bacteria 2587
401 Ga0501045_0127684 3300049824 Bacteria 1889
402 Ga0501226_037098 3300049853 Unclassified 560
403 nmdc:mga05p37_1478593_c1 3300050507 Unclassified 678
404 nmdc:mga05p37_422231_c1 3300050507 Bacteria 1551
405 nmdc:mga05p37_505661_c1 3300050507 Bacteria 1386
406 nmdc:mga09592_246050_c1 3300050508 Unclassified 1550
407 nmdc:mga09592_492322_c1 3300050508 Bacteria 1056
408 nmdc:mga09592_73510_c1 3300050508 Bacteria 2905
409 nmdc:mga09592_924246_c1 3300050508 Unclassified 732
410 nmdc:mga0qj67_154367_c1 3300050509 Unclassified 1863
411 nmdc:mga0qj67_155622_c1 3300050509 Bacteria 1855
412 nmdc:mga0qj67_265593_c1 3300050509 Bacteria 1392
413 nmdc:mga0qj67_469697_c1 3300050509 Unclassified 1013
414 nmdc:mga06r32_146952_c1 3300050510 Unclassified 2334
415 nmdc:mga06r32_209648_c1 3300050510 Bacteria 1936
416 nmdc:mga06r32_224506_c1 3300050510 Unclassified 1867
417 nmdc:mga06r32_330946_c1 3300050510 Bacteria 1508
418 nmdc:mga08y16_1405483_c1 3300050511 Bacteria 661
419 nmdc:mga08y16_357599_c1 3300050511 Bacteria 1499
420 nmdc:mga08y16_74155_c1 3300050511 Bacteria 3545
421 nmdc:mga08y16_8579_c1 3300050511 Bacteria 10709
422 nmdc:mga0n895_126739_c1 3300050512 Bacteria 2577
423 nmdc:mga0n895_20748_c1 3300050512 Bacteria 6134
424 nmdc:mga0n895_62571_c1 3300050512 Unclassified 3679
425 nmdc:mga0n895_63896_c1 3300050512 Unclassified 3640
426 nmdc:mga0n895_6559_c1 3300050512 Bacteria 9904
427 nmdc:mga0rr50_1610676_c1 3300050513 Bacteria 548
428 nmdc:mga0rr50_25034_c1 3300050513 Bacteria 4144
429 nmdc:mga0rr50_532681_c1 3300050513 Unclassified 1000
430 nmdc:mga08x19_164917_c1 3300050514 Unclassified 1506
431 nmdc:mga08x19_621204_c1 3300050514 Bacteria 766
432 nmdc:mga08x19_66408_c1 3300050514 Bacteria 2344
433 nmdc:mga0a205_1103854_c1 3300050515 Unclassified 641
434 nmdc:mga0a205_189468_c1 3300050515 Unclassified 1949
435 nmdc:mga0a205_25209_c1 3300050515 Bacteria 4329
436 nmdc:mga0a205_80208_c1 3300050515 Unclassified 3154
437 Ga0501084_0004572 3300054114 Bacteria 11310
438 Ga0501084_0004990 3300054114 Bacteria 10857
439 Ga0501084_0262384 3300054114 Bacteria 1458
440 Ga0501084_0971701 3300054114 Unclassified 714
441 Ga0501084_1106301 3300054114 Bacteria 665
442 Ga0590074_016214 3300059423 Bacteria 1268
443 Ga0501082_0007243 3300060353 Bacteria 9568
444 Ga0501082_0149341 3300060353 Bacteria 2029
445 Ga0501082_0837259 3300060353 Unclassified 805
446 Ga0501082_1132420 3300060353 Bacteria 684
447 Ga0530510_0002993 3300061734 Bacteria 11589
448 Ga0530510_0019275 3300061734 Bacteria 4842
449 Ga0530510_0380426 3300061734 Bacteria 1062
450 Ga0530510_0513648 3300061734 Bacteria 908
451 Ga0530510_0706080 3300061734 Unclassified 768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_101448675 Ga0075428_1014486752 77
2 3300006846 Ga0075430_100737785 Ga0075430_1007377852 77
3 3300009094 Ga0111539_10036555 Ga0111539_100365555 77
4 3300025926 Ga0207659_10905605 Ga0207659_109056052 77
5 3300027907 Ga0207428_10061861 Ga0207428_100618613 77
6 3300049589 Ga0501073_0788776 Ga0501073_0788776_254_529 77
7 3300050511 nmdc:mga08y16_8579_c1 nmdc:mga08y16_8579_c1_4662_4937 77
8 3300031727 Ga0316576_10225575 Ga0316576_102255752 84
9 3300005333 Ga0070677_10384355 Ga0070677_103843552 85
10 3300050508 nmdc:mga09592_246050_c1 nmdc:mga09592_246050_c1_212_469 85
11 3300050510 nmdc:mga06r32_209648_c1 nmdc:mga06r32_209648_c1_820_1077 85
12 3300001990 JGI24737J22298_10201178 JGI24737J22298_102011782 89
13 3300005289 Ga0065704_10406542 Ga0065704_104065422 89
14 3300005289 Ga0065704_10693806 Ga0065704_106938061 89
15 3300005290 Ga0065712_10006790 Ga0065712_100067905 89
16 3300005293 Ga0065715_10006755 Ga0065715_100067553 89
17 3300005293 Ga0065715_10014542 Ga0065715_100145424 89
18 3300005295 Ga0065707_10137096 Ga0065707_101370961 89
19 3300005328 Ga0070676_10014318 Ga0070676_100143184 89
20 3300005330 Ga0070690_100708704 Ga0070690_1007087041 89
21 3300005331 Ga0070670_100001204 Ga0070670_1000012044 89
22 3300005333 Ga0070677_10027089 Ga0070677_100270892 89
23 3300005335 Ga0070666_10349041 Ga0070666_103490412 89
24 3300005336 Ga0070680_100010224 Ga0070680_1000102245 89
25 3300005336 Ga0070680_100383553 Ga0070680_1003835533 89
26 3300005338 Ga0068868_100168962 Ga0068868_1001689621 89
27 3300005339 Ga0070660_100070931 Ga0070660_1000709313 89
28 3300005340 Ga0070689_100086382 Ga0070689_1000863822 89
29 3300005341 Ga0070691_10010878 Ga0070691_100108784 89
30 3300005344 Ga0070661_100010018 Ga0070661_1000100186 89
31 3300005353 Ga0070669_100337992 Ga0070669_1003379922 89
32 3300005353 Ga0070669_100719393 Ga0070669_1007193932 89
33 3300005354 Ga0070675_100522126 Ga0070675_1005221262 89
34 3300005356 Ga0070674_100834319 Ga0070674_1008343192 89
35 3300005356 Ga0070674_101960324 Ga0070674_1019603242 89
36 3300005364 Ga0070673_100704187 Ga0070673_1007041873 89
37 3300005365 Ga0070688_100112597 Ga0070688_1001125971 89
38 3300005365 Ga0070688_101548102 Ga0070688_1015481022 89
39 3300005366 Ga0070659_100042157 Ga0070659_1000421572 89
40 3300005367 Ga0070667_100351502 Ga0070667_1003515023 89
41 3300005440 Ga0070705_100077889 Ga0070705_1000778891 89
42 3300005441 Ga0070700_100139417 Ga0070700_1001394171 89
43 3300005444 Ga0070694_100019641 Ga0070694_1000196415 89
44 3300005444 Ga0070694_100753170 Ga0070694_1007531701 89
45 3300005455 Ga0070663_100050881 Ga0070663_1000508812 89
46 3300005456 Ga0070678_100104013 Ga0070678_1001040132 89
47 3300005457 Ga0070662_100146698 Ga0070662_1001466983 89
48 3300005457 Ga0070662_100440453 Ga0070662_1004404533 89
49 3300005458 Ga0070681_10018226 Ga0070681_100182266 89
50 3300005458 Ga0070681_10210891 Ga0070681_102108913 89
51 3300005466 Ga0070685_10216015 Ga0070685_102160153 89
52 3300005518 Ga0070699_100606725 Ga0070699_1006067251 89
53 3300005518 Ga0070699_101253320 Ga0070699_1012533202 89
54 3300005530 Ga0070679_100006428 Ga0070679_10000642810 89
55 3300005530 Ga0070679_100074523 Ga0070679_1000745233 89
56 3300005536 Ga0070697_100074585 Ga0070697_1000745853 89
57 3300005536 Ga0070697_100735678 Ga0070697_1007356782 89
58 3300005543 Ga0070672_100664899 Ga0070672_1006648992 89
59 3300005545 Ga0070695_100084226 Ga0070695_1000842261 89
60 3300005545 Ga0070695_101002112 Ga0070695_1010021122 89
61 3300005545 Ga0070695_101075070 Ga0070695_1010750702 89
62 3300005546 Ga0070696_100127386 Ga0070696_1001273862 89
63 3300005546 Ga0070696_100155309 Ga0070696_1001553091 89
64 3300005547 Ga0070693_100050694 Ga0070693_1000506942 89
65 3300005548 Ga0070665_100736557 Ga0070665_1007365573 89
66 3300005548 Ga0070665_101695148 Ga0070665_1016951482 89
67 3300005549 Ga0070704_100231841 Ga0070704_1002318412 89
68 3300005549 Ga0070704_100245716 Ga0070704_1002457162 89
69 3300005563 Ga0068855_100061205 Ga0068855_1000612054 89
70 3300005564 Ga0070664_100465737 Ga0070664_1004657372 89
71 3300005577 Ga0068857_100466011 Ga0068857_1004660113 89
72 3300005578 Ga0068854_100080159 Ga0068854_1000801594 89
73 3300005614 Ga0068856_101819609 Ga0068856_1018196092 89
74 3300005615 Ga0070702_100025913 Ga0070702_1000259134 89
75 3300005616 Ga0068852_102476049 Ga0068852_1024760491 89
76 3300005617 Ga0068859_100199144 Ga0068859_1001991442 89
77 3300005618 Ga0068864_101673833 Ga0068864_1016738332 89
78 3300005718 Ga0068866_11369839 Ga0068866_113698392 89
79 3300005719 Ga0068861_102162235 Ga0068861_1021622352 89
80 3300005719 Ga0068861_102487641 Ga0068861_1024876411 89
81 3300005841 Ga0068863_101071127 Ga0068863_1010711271 89
82 3300005843 Ga0068860_100861154 Ga0068860_1008611541 89
83 3300005937 Ga0081455_10000235 Ga0081455_1000023514 89
84 3300005937 Ga0081455_10278057 Ga0081455_102780572 89
85 3300005937 Ga0081455_10537479 Ga0081455_105374792 89
86 3300006173 Ga0070716_100638328 Ga0070716_1006383282 89
87 3300006237 Ga0097621_100071620 Ga0097621_1000716203 89
88 3300006358 Ga0068871_101303526 Ga0068871_1013035262 89
89 3300006844 Ga0075428_100114265 Ga0075428_1001142654 89
90 3300006844 Ga0075428_100574149 Ga0075428_1005741492 89
91 3300006844 Ga0075428_100751193 Ga0075428_1007511932 89
92 3300006846 Ga0075430_100086083 Ga0075430_1000860832 89
93 3300006846 Ga0075430_100120034 Ga0075430_1001200344 89
94 3300006847 Ga0075431_100796192 Ga0075431_1007961922 89
95 3300006852 Ga0075433_10014604 Ga0075433_1001460410 89
96 3300006852 Ga0075433_10042696 Ga0075433_100426964 89
97 3300006852 Ga0075433_10077508 Ga0075433_100775082 89
98 3300006852 Ga0075433_10319099 Ga0075433_103190993 89
99 3300006852 Ga0075433_11382291 Ga0075433_113822912 89
100 3300006871 Ga0075434_100006851 Ga0075434_1000068516 89
101 3300006871 Ga0075434_100182908 Ga0075434_1001829083 89
102 3300006871 Ga0075434_100228147 Ga0075434_1002281473 89
103 3300006881 Ga0068865_100661782 Ga0068865_1006617822 89
104 3300006914 Ga0075436_100100729 Ga0075436_1001007292 89
105 3300006914 Ga0075436_100516598 Ga0075436_1005165982 89
106 3300006931 Ga0097620_100199143 Ga0097620_1001991432 89
107 3300007076 Ga0075435_100063103 Ga0075435_1000631033 89
108 3300007076 Ga0075435_100082755 Ga0075435_1000827552 89
109 3300007076 Ga0075435_101727991 Ga0075435_1017279912 89
110 3300009094 Ga0111539_10125511 Ga0111539_101255113 89
111 3300009094 Ga0111539_10192672 Ga0111539_101926722 89
112 3300009094 Ga0111539_11105883 Ga0111539_111058832 89
113 3300009147 Ga0114129_11435494 Ga0114129_114354942 89
114 3300009147 Ga0114129_12079472 Ga0114129_120794722 89
115 3300009148 Ga0105243_12721419 Ga0105243_127214192 89
116 3300009174 Ga0105241_10133021 Ga0105241_101330212 89
117 3300009176 Ga0105242_12182739 Ga0105242_121827391 89
118 3300009177 Ga0105248_10701359 Ga0105248_107013593 89
119 3300009545 Ga0105237_10479013 Ga0105237_104790132 89
120 3300009553 Ga0105249_11216014 Ga0105249_112160142 89
121 3300010375 Ga0105239_10083873 Ga0105239_100838734 89
122 3300011119 Ga0105246_10146214 Ga0105246_101462141 89
123 3300012506 Ga0157324_1008614 Ga0157324_10086141 89
124 3300013100 Ga0157373_10045421 Ga0157373_100454213 89
125 3300013100 Ga0157373_10149412 Ga0157373_101494122 89
126 3300013102 Ga0157371_10016353 Ga0157371_100163535 89
127 3300013296 Ga0157374_10019947 Ga0157374_100199473 89
128 3300013297 Ga0157378_11727368 Ga0157378_117273681 89
129 3300013297 Ga0157378_11994228 Ga0157378_119942282 89
130 3300013297 Ga0157378_12328437 Ga0157378_123284372 89
131 3300013306 Ga0163162_10068663 Ga0163162_100686633 89
132 3300013307 Ga0157372_10140573 Ga0157372_101405732 89
133 3300013308 Ga0157375_10069489 Ga0157375_100694894 89
134 3300014325 Ga0163163_10558673 Ga0163163_105586731 89
135 3300014745 Ga0157377_10211248 Ga0157377_102112481 89
136 3300014968 Ga0157379_10034438 Ga0157379_100344384 89
137 3300014969 Ga0157376_10012426 Ga0157376_100124266 89
138 3300014969 Ga0157376_10764009 Ga0157376_107640093 89
139 3300025290 Ga0207673_1031349 Ga0207673_10313492 89
140 3300025315 Ga0207697_10006881 Ga0207697_100068814 89
141 3300025901 Ga0207688_10094290 Ga0207688_100942903 89
142 3300025903 Ga0207680_10185259 Ga0207680_101852592 89
143 3300025904 Ga0207647_10365377 Ga0207647_103653773 89
144 3300025907 Ga0207645_10002584 Ga0207645_100025848 89
145 3300025909 Ga0207705_10157696 Ga0207705_101576962 89
146 3300025912 Ga0207707_10020281 Ga0207707_100202816 89
147 3300025912 Ga0207707_10085168 Ga0207707_100851682 89
148 3300025913 Ga0207695_11475773 Ga0207695_114757731 89
149 3300025914 Ga0207671_10086979 Ga0207671_100869793 89
150 3300025917 Ga0207660_10054006 Ga0207660_100540064 89
151 3300025918 Ga0207662_10293846 Ga0207662_102938461 89
152 3300025919 Ga0207657_10002787 Ga0207657_100027873 89
153 3300025920 Ga0207649_10582241 Ga0207649_105822411 89
154 3300025921 Ga0207652_10077623 Ga0207652_100776233 89
155 3300025921 Ga0207652_10175850 Ga0207652_101758502 89
156 3300025923 Ga0207681_11036615 Ga0207681_110366152 89
157 3300025923 Ga0207681_11207508 Ga0207681_112075082 89
158 3300025925 Ga0207650_10042361 Ga0207650_100423614 89
159 3300025926 Ga0207659_10173996 Ga0207659_101739963 89
160 3300025931 Ga0207644_10183934 Ga0207644_101839342 89
161 3300025932 Ga0207690_10053785 Ga0207690_100537853 89
162 3300025933 Ga0207706_10333648 Ga0207706_103336483 89
163 3300025934 Ga0207686_10459792 Ga0207686_104597921 89
164 3300025936 Ga0207670_10264726 Ga0207670_102647261 89
165 3300025938 Ga0207704_10280241 Ga0207704_102802411 89
166 3300025939 Ga0207665_10740450 Ga0207665_107404502 89
167 3300025940 Ga0207691_10017033 Ga0207691_100170336 89
168 3300025945 Ga0207679_10286415 Ga0207679_102864152 89
169 3300025945 Ga0207679_10401215 Ga0207679_104012152 89
170 3300025949 Ga0207667_10050101 Ga0207667_100501013 89
171 3300025960 Ga0207651_10841571 Ga0207651_108415711 89
172 3300025961 Ga0207712_11353541 Ga0207712_113535411 89
173 3300025972 Ga0207668_11330381 Ga0207668_113303812 89
174 3300025986 Ga0207658_10230204 Ga0207658_102302042 89
175 3300026023 Ga0207677_10344647 Ga0207677_103446473 89
176 3300026067 Ga0207678_10020541 Ga0207678_100205416 89
177 3300026078 Ga0207702_10028811 Ga0207702_100288112 89
178 3300026116 Ga0207674_11482705 Ga0207674_114827052 89
179 3300026118 Ga0207675_100263865 Ga0207675_1002638653 89
180 3300026121 Ga0207683_10013444 Ga0207683_100134443 89
181 3300026142 Ga0207698_11588904 Ga0207698_115889041 89
182 3300027876 Ga0209974_10422352 Ga0209974_104223522 89
183 3300027907 Ga0207428_10063228 Ga0207428_100632282 89
184 3300027907 Ga0207428_10725890 Ga0207428_107258902 89
185 3300031548 Ga0307408_100081611 Ga0307408_1000816113 89
186 3300031691 Ga0316579_10348822 Ga0316579_103488222 89
187 3300031731 Ga0307405_10620434 Ga0307405_106204341 89
188 3300031824 Ga0307413_10133281 Ga0307413_101332813 89
189 3300031824 Ga0307413_10543361 Ga0307413_105433612 89
190 3300031852 Ga0307410_10012664 Ga0307410_100126643 89
191 3300031901 Ga0307406_11902446 Ga0307406_119024462 89
192 3300031911 Ga0307412_10992334 Ga0307412_109923342 89
193 3300031995 Ga0307409_100028723 Ga0307409_1000287234 89
194 3300031995 Ga0307409_100254223 Ga0307409_1002542232 89
195 3300032002 Ga0307416_100122228 Ga0307416_1001222283 89
196 3300032002 Ga0307416_100781750 Ga0307416_1007817503 89
197 3300032004 Ga0307414_10023717 Ga0307414_100237174 89
198 3300032004 Ga0307414_10164239 Ga0307414_101642393 89
199 3300032005 Ga0307411_10668409 Ga0307411_106684092 89
200 3300032126 Ga0307415_100257126 Ga0307415_1002571262 89
201 3300034819 Ga0373958_0075700 Ga0373958_0075700_119_391 89
202 3300035691 Ga0373931_0025348 Ga0373931_0025348_1068_1340 89
203 3300035725 Ga0373947_0158820 Ga0373947_0158820_532_804 89
204 3300036647 Ga0316582_0003062 Ga0316582_0003062_1089_1361 89
205 3300036647 Ga0316582_0296995 Ga0316582_0296995_210_482 89
206 3300036647 Ga0316582_0481929 Ga0316582_0481929_143_415 89
207 3300036712 Ga0316584_0019519 Ga0316584_0019519_61_333 89
208 3300036712 Ga0316584_0209230 Ga0316584_0209230_435_707 89
209 3300037068 Ga0373925_1116779 Ga0373925_1116779_212_484 89
210 3300037588 Ga0316581_0062985 Ga0316581_0062985_624_896 89
211 3300042436 Ga0439435_0123037 Ga0439435_0123037_328_600 89
212 3300044712 Ga0453684_0969185 Ga0453684_0969185_284_556 89
213 3300045051 Ga0451576_1649955 Ga0451576_1649955_344_616 89
214 3300048903 Ga0496100_0757329 Ga0496100_0757329_415_687 89
215 3300048904 Ga0496101_0950424 Ga0496101_0950424_84_356 89
216 3300048905 Ga0496102_0327246 Ga0496102_0327246_1134_1406 89
217 3300048905 Ga0496102_1095589 Ga0496102_1095589_278_550 89
218 3300048906 Ga0496103_0872899 Ga0496103_0872899_229_501 89
219 3300048907 Ga0496104_0943433 Ga0496104_0943433_121_393 89
220 3300048909 Ga0496106_0183849 Ga0496106_0183849_166_438 89
221 3300048911 Ga0496108_0507028 Ga0496108_0507028_477_749 89
222 3300048912 Ga0496109_0263113 Ga0496109_0263113_768_1040 89
223 3300048913 Ga0496110_0394718 Ga0496110_0394718_762_1034 89
224 3300049513 Ga0501290_094254 Ga0501290_094254_47_319 89
225 3300049515 Ga0501292_057897 Ga0501292_057897_182_454 89
226 3300049519 Ga0501296_003737 Ga0501296_003737_768_1040 89
227 3300049568 Ga0501031_0025338 Ga0501031_0025338_1528_1800 89
228 3300049568 Ga0501031_0031236 Ga0501031_0031236_768_1043 89
229 3300049569 Ga0501032_0204038 Ga0501032_0204038_442_717 89
230 3300049570 Ga0501033_0461518 Ga0501033_0461518_576_851 89
231 3300049570 Ga0501033_0867365 Ga0501033_0867365_305_577 89
232 3300049572 Ga0501036_0135899 Ga0501036_0135899_309_584 89
233 3300049572 Ga0501036_1264377 Ga0501036_1264377_226_498 89
234 3300049573 Ga0501037_0513224 Ga0501037_0513224_233_505 89
235 3300049573 Ga0501037_0909620 Ga0501037_0909620_161_436 89
236 3300049575 Ga0501039_0007215 Ga0501039_0007215_315_587 89
237 3300049575 Ga0501039_0260690 Ga0501039_0260690_792_1067 89
238 3300049576 Ga0501040_0001075 Ga0501040_0001075_7150_7422 89
239 3300049576 Ga0501040_0004289 Ga0501040_0004289_1056_1331 89
240 3300049577 Ga0501041_0000212 Ga0501041_0000212_26415_26687 89
241 3300049577 Ga0501041_0002557 Ga0501041_0002557_1021_1296 89
242 3300049577 Ga0501041_0139701 Ga0501041_0139701_984_1259 89
243 3300049578 Ga0501042_0004744 Ga0501042_0004744_342_617 89
244 3300049578 Ga0501042_0010253 Ga0501042_0010253_5726_5998 89
245 3300049579 Ga0501043_0134141 Ga0501043_0134141_806_1081 89
246 3300049579 Ga0501043_0277592 Ga0501043_0277592_768_1040 89
247 3300049580 Ga0501046_0049175 Ga0501046_0049175_1478_1753 89
248 3300049580 Ga0501046_0077624 Ga0501046_0077624_2196_2468 89
249 3300049580 Ga0501046_1064392 Ga0501046_1064392_59_331 89
250 3300049581 Ga0501047_0511012 Ga0501047_0511012_334_606 89
251 3300049581 Ga0501047_0628059 Ga0501047_0628059_442_717 89
252 3300049582 Ga0501048_0006152 Ga0501048_0006152_374_646 89
253 3300049582 Ga0501048_1379389 Ga0501048_1379389_115_387 89
254 3300049586 Ga0501070_0450001 Ga0501070_0450001_282_554 89
255 3300049587 Ga0501071_0000452 Ga0501071_0000452_20253_20525 89
256 3300049587 Ga0501071_0119803 Ga0501071_0119803_855_1130 89
257 3300049587 Ga0501071_0173975 Ga0501071_0173975_379_651 89
258 3300049588 Ga0501072_0000380 Ga0501072_0000380_20492_20764 89
259 3300049588 Ga0501072_0119211 Ga0501072_0119211_357_632 89
260 3300049588 Ga0501072_0804267 Ga0501072_0804267_161_436 89
261 3300049590 Ga0501074_0002770 Ga0501074_0002770_6054_6326 89
262 3300049590 Ga0501074_0170329 Ga0501074_0170329_883_1158 89
263 3300049591 Ga0501075_0000095 Ga0501075_0000095_40301_40573 89
264 3300049591 Ga0501075_0284578 Ga0501075_0284578_640_915 89
265 3300049592 Ga0501076_0104681 Ga0501076_0104681_315_587 89
266 3300049592 Ga0501076_0585229 Ga0501076_0585229_309_584 89
267 3300049592 Ga0501076_0795138 Ga0501076_0795138_10_282 89
268 3300049592 Ga0501076_0808748 Ga0501076_0808748_24_299 89
269 3300049593 Ga0501077_0000279 Ga0501077_0000279_226_498 89
270 3300049593 Ga0501077_0004012 Ga0501077_0004012_7581_7856 89
271 3300049656 Ga0501209_029939 Ga0501209_029939_1042_1314 89
272 3300049661 Ga0501217_137601 Ga0501217_137601_227_499 89
273 3300049688 Ga0501259_015247 Ga0501259_015247_340_612 89
274 3300049690 Ga0501261_031291 Ga0501261_031291_496_768 89
275 3300049705 Ga0501225_0058122 Ga0501225_0058122_172_444 89
276 3300049706 Ga0501229_049129 Ga0501229_049129_189_461 89
277 3300049741 Ga0501079_0003344 Ga0501079_0003344_3550_3825 89
278 3300049741 Ga0501079_0009369 Ga0501079_0009369_6868_7140 89
279 3300049741 Ga0501079_0440510 Ga0501079_0440510_377_649 89
280 3300049741 Ga0501079_0934862 Ga0501079_0934862_252_524 89
281 3300049742 Ga0501080_0066421 Ga0501080_0066421_303_578 89
282 3300049742 Ga0501080_0513432 Ga0501080_0513432_325_597 89
283 3300049743 Ga0501081_0000063 Ga0501081_0000063_316_588 89
284 3300049743 Ga0501081_0441155 Ga0501081_0441155_59_334 89
285 3300049744 Ga0501083_0035354 Ga0501083_0035354_2828_3100 89
286 3300049744 Ga0501083_0472252 Ga0501083_0472252_59_334 89
287 3300049822 Ga0501035_0024662 Ga0501035_0024662_5050_5322 89
288 3300049824 Ga0501045_0007504 Ga0501045_0007504_354_626 89
289 3300049824 Ga0501045_0069589 Ga0501045_0069589_227_502 89
290 3300049824 Ga0501045_0127684 Ga0501045_0127684_575_850 89
291 3300049853 Ga0501226_037098 Ga0501226_037098_126_398 89
292 3300050507 nmdc:mga05p37_1478593_c1 nmdc:mga05p37_1478593_c1_20_292 89
293 3300050507 nmdc:mga05p37_505661_c1 nmdc:mga05p37_505661_c1_962_1234 89
294 3300050508 nmdc:mga09592_492322_c1 nmdc:mga09592_492322_c1_103_375 89
295 3300050508 nmdc:mga09592_924246_c1 nmdc:mga09592_924246_c1_138_410 89
296 3300050509 nmdc:mga0qj67_155622_c1 nmdc:mga0qj67_155622_c1_376_648 89
297 3300050509 nmdc:mga0qj67_265593_c1 nmdc:mga0qj67_265593_c1_302_574 89
298 3300050509 nmdc:mga0qj67_469697_c1 nmdc:mga0qj67_469697_c1_221_493 89
299 3300050510 nmdc:mga06r32_146952_c1 nmdc:mga06r32_146952_c1_439_711 89
300 3300050511 nmdc:mga08y16_1405483_c1 nmdc:mga08y16_1405483_c1_77_349 89
301 3300050511 nmdc:mga08y16_357599_c1 nmdc:mga08y16_357599_c1_102_374 89
302 3300050511 nmdc:mga08y16_74155_c1 nmdc:mga08y16_74155_c1_2304_2576 89
303 3300050512 nmdc:mga0n895_126739_c1 nmdc:mga0n895_126739_c1_631_903 89
304 3300050512 nmdc:mga0n895_20748_c1 nmdc:mga0n895_20748_c1_2830_3102 89
305 3300050512 nmdc:mga0n895_62571_c1 nmdc:mga0n895_62571_c1_2423_2695 89
306 3300050512 nmdc:mga0n895_63896_c1 nmdc:mga0n895_63896_c1_474_746 89
307 3300050512 nmdc:mga0n895_6559_c1 nmdc:mga0n895_6559_c1_4278_4550 89
308 3300050513 nmdc:mga0rr50_1610676_c1 nmdc:mga0rr50_1610676_c1_233_520 89
309 3300050513 nmdc:mga0rr50_25034_c1 nmdc:mga0rr50_25034_c1_1159_1431 89
310 3300050513 nmdc:mga0rr50_532681_c1 nmdc:mga0rr50_532681_c1_323_595 89
311 3300050514 nmdc:mga08x19_164917_c1 nmdc:mga08x19_164917_c1_919_1206 89
312 3300050514 nmdc:mga08x19_621204_c1 nmdc:mga08x19_621204_c1_446_718 89
313 3300050514 nmdc:mga08x19_66408_c1 nmdc:mga08x19_66408_c1_1548_1820 89
314 3300050515 nmdc:mga0a205_1103854_c1 nmdc:mga0a205_1103854_c1_304_576 89
315 3300050515 nmdc:mga0a205_189468_c1 nmdc:mga0a205_189468_c1_95_367 89
316 3300050515 nmdc:mga0a205_25209_c1 nmdc:mga0a205_25209_c1_3340_3612 89
317 3300050515 nmdc:mga0a205_80208_c1 nmdc:mga0a205_80208_c1_2360_2632 89
318 3300054114 Ga0501084_0004572 Ga0501084_0004572_10886_11158 89
319 3300054114 Ga0501084_0004990 Ga0501084_0004990_3349_3624 89
320 3300054114 Ga0501084_0971701 Ga0501084_0971701_430_702 89
321 3300054114 Ga0501084_1106301 Ga0501084_1106301_118_390 89
322 3300059423 Ga0590074_016214 Ga0590074_016214_892_1164 89
323 3300060353 Ga0501082_0007243 Ga0501082_0007243_300_572 89
324 3300060353 Ga0501082_0149341 Ga0501082_0149341_1124_1399 89
325 3300060353 Ga0501082_0837259 Ga0501082_0837259_482_754 89
326 3300060353 Ga0501082_1132420 Ga0501082_1132420_92_364 89
327 3300061734 Ga0530510_0002993 Ga0530510_0002993_11003_11275 89
328 3300061734 Ga0530510_0380426 Ga0530510_0380426_424_696 89
329 3300061734 Ga0530510_0513648 Ga0530510_0513648_510_782 89
330 3300061734 Ga0530510_0706080 Ga0530510_0706080_198_473 89
331 3300000532 CNAas_1000393 CNAas_10003932 90
332 3300001990 JGI24737J22298_10125478 JGI24737J22298_101254782 90
333 3300005293 Ga0065715_10280347 Ga0065715_102803472 90
334 3300005295 Ga0065707_10122232 Ga0065707_101222322 90
335 3300005330 Ga0070690_100351667 Ga0070690_1003516672 90
336 3300005333 Ga0070677_10094979 Ga0070677_100949792 90
337 3300005335 Ga0070666_11250894 Ga0070666_112508941 90
338 3300005338 Ga0068868_101205881 Ga0068868_1012058811 90
339 3300005341 Ga0070691_10907857 Ga0070691_109078572 90
340 3300005364 Ga0070673_100045290 Ga0070673_1000452903 90
341 3300005438 Ga0070701_10008841 Ga0070701_100088416 90
342 3300005440 Ga0070705_101085871 Ga0070705_1010858712 90
343 3300005440 Ga0070705_101858779 Ga0070705_1018587791 90
344 3300005440 Ga0070705_101912797 Ga0070705_1019127971 90
345 3300005441 Ga0070700_100002407 Ga0070700_10000240713 90
346 3300005444 Ga0070694_100079252 Ga0070694_1000792522 90
347 3300005457 Ga0070662_100012982 Ga0070662_1000129825 90
348 3300005467 Ga0070706_101504858 Ga0070706_1015048581 90
349 3300005536 Ga0070697_100009028 Ga0070697_1000090286 90
350 3300005546 Ga0070696_100039980 Ga0070696_1000399802 90
351 3300005547 Ga0070693_100199021 Ga0070693_1001990213 90
352 3300005578 Ga0068854_100142597 Ga0068854_1001425972 90
353 3300005617 Ga0068859_100449731 Ga0068859_1004497311 90
354 3300005719 Ga0068861_100471500 Ga0068861_1004715002 90
355 3300005840 Ga0068870_10023409 Ga0068870_100234092 90
356 3300005844 Ga0068862_100178375 Ga0068862_1001783752 90
357 3300005844 Ga0068862_101179898 Ga0068862_1011798981 90
358 3300006844 Ga0075428_100505351 Ga0075428_1005053512 90
359 3300006844 Ga0075428_101390121 Ga0075428_1013901211 90
360 3300006846 Ga0075430_100119155 Ga0075430_1001191552 90
361 3300006846 Ga0075430_100514768 Ga0075430_1005147682 90
362 3300006847 Ga0075431_100132674 Ga0075431_1001326741 90
363 3300006847 Ga0075431_100284939 Ga0075431_1002849392 90
364 3300006880 Ga0075429_100092640 Ga0075429_1000926402 90
365 3300006880 Ga0075429_100223985 Ga0075429_1002239852 90
366 3300006880 Ga0075429_100530387 Ga0075429_1005303872 90
367 3300006881 Ga0068865_101160924 Ga0068865_1011609241 90
368 3300006931 Ga0097620_100449730 Ga0097620_1004497301 90
369 3300007788 Ga0099795_10516654 Ga0099795_105166541 90
370 3300009094 Ga0111539_10728224 Ga0111539_107282241 90
371 3300009147 Ga0114129_11156273 Ga0114129_111562732 90
372 3300009147 Ga0114129_11273124 Ga0114129_112731242 90
373 3300009147 Ga0114129_11569963 Ga0114129_115699632 90
374 3300009553 Ga0105249_10818489 Ga0105249_108184892 90
375 3300009553 Ga0105249_13287028 Ga0105249_132870282 90
376 3300013100 Ga0157373_10383288 Ga0157373_103832882 90
377 3300013100 Ga0157373_10472864 Ga0157373_104728642 90
378 3300013297 Ga0157378_10320658 Ga0157378_103206582 90
379 3300014325 Ga0163163_10257565 Ga0163163_102575652 90
380 3300014326 Ga0157380_10030444 Ga0157380_100304443 90
381 3300014326 Ga0157380_10107636 Ga0157380_101076362 90
382 3300014326 Ga0157380_12591810 Ga0157380_125918101 90
383 3300015262 Ga0182007_10145068 Ga0182007_101450682 90
384 3300025893 Ga0207682_10173301 Ga0207682_101733011 90
385 3300025904 Ga0207647_10637535 Ga0207647_106375351 90
386 3300025908 Ga0207643_10341687 Ga0207643_103416872 90
387 3300025912 Ga0207707_10526683 Ga0207707_105266832 90
388 3300025917 Ga0207660_10903816 Ga0207660_109038162 90
389 3300025918 Ga0207662_11091726 Ga0207662_110917262 90
390 3300025933 Ga0207706_10038000 Ga0207706_100380002 90
391 3300025934 Ga0207686_10033683 Ga0207686_100336832 90
392 3300025940 Ga0207691_10788067 Ga0207691_107880672 90
393 3300025941 Ga0207711_11791440 Ga0207711_117914402 90
394 3300025960 Ga0207651_10044491 Ga0207651_100444912 90
395 3300025961 Ga0207712_11533120 Ga0207712_115331201 90
396 3300025961 Ga0207712_11623984 Ga0207712_116239842 90
397 3300025981 Ga0207640_10100744 Ga0207640_101007442 90
398 3300026023 Ga0207677_11162648 Ga0207677_111626481 90
399 3300026089 Ga0207648_10092985 Ga0207648_100929852 90
400 3300026116 Ga0207674_10157448 Ga0207674_101574482 90
401 3300026116 Ga0207674_11589913 Ga0207674_115899131 90
402 3300026121 Ga0207683_10204410 Ga0207683_102044103 90
403 3300028379 Ga0268266_12114153 Ga0268266_121141532 90
404 3300028380 Ga0268265_11137738 Ga0268265_111377382 90
405 3300028380 Ga0268265_12048334 Ga0268265_120483341 90
406 3300031731 Ga0307405_10358282 Ga0307405_103582822 90
407 3300031824 Ga0307413_10001823 Ga0307413_100018239 90
408 3300031852 Ga0307410_10001965 Ga0307410_100019657 90
409 3300031852 Ga0307410_10480387 Ga0307410_104803871 90
410 3300031852 Ga0307410_10622197 Ga0307410_106221972 90
411 3300031901 Ga0307406_10012210 Ga0307406_100122102 90
412 3300031901 Ga0307406_10631557 Ga0307406_106315572 90
413 3300031903 Ga0307407_10000184 Ga0307407_100001843 90
414 3300031903 Ga0307407_11437760 Ga0307407_114377601 90
415 3300031911 Ga0307412_10005040 Ga0307412_100050405 90
416 3300031911 Ga0307412_11544678 Ga0307412_115446781 90
417 3300031995 Ga0307409_100001367 Ga0307409_1000013672 90
418 3300031995 Ga0307409_100537421 Ga0307409_1005374212 90
419 3300031995 Ga0307409_101079646 Ga0307409_1010796462 90
420 3300031995 Ga0307409_101117257 Ga0307409_1011172572 90
421 3300032002 Ga0307416_100044184 Ga0307416_1000441843 90
422 3300032002 Ga0307416_100806505 Ga0307416_1008065052 90
423 3300032002 Ga0307416_101627452 Ga0307416_1016274521 90
424 3300032004 Ga0307414_11216244 Ga0307414_112162442 90
425 3300032005 Ga0307411_10000372 Ga0307411_100003727 90
426 3300032005 Ga0307411_11863304 Ga0307411_118633041 90
427 3300032126 Ga0307415_100529739 Ga0307415_1005297391 90
428 3300036401 Ga0373937_1172867 Ga0373937_1172867_333_644 90
429 3300041411 Ga0439466_0134821 Ga0439466_0134821_248_520 90
430 3300042013 Ga0439456_162732 Ga0439456_162732_195_467 90
431 3300042436 Ga0439435_0298152 Ga0439435_0298152_218_490 90
432 3300046476 Ga0495662_0150840 Ga0495662_0150840_32_343 90
433 3300049515 Ga0501292_007211 Ga0501292_007211_182_454 90
434 3300049576 Ga0501040_0890578 Ga0501040_0890578_338_610 90
435 3300049661 Ga0501217_006941 Ga0501217_006941_1438_1710 90
436 3300049663 Ga0501223_010027 Ga0501223_010027_1521_1793 90
437 3300049669 Ga0501235_045552 Ga0501235_045552_216_488 90
438 3300049679 Ga0501249_009457 Ga0501249_009457_131_403 90
439 3300049705 Ga0501225_0047354 Ga0501225_0047354_16_288 90
440 3300049707 Ga0501234_092853 Ga0501234_092853_207_479 90
441 3300049743 Ga0501081_0119908 Ga0501081_0119908_914_1186 90
442 3300049758 Ga0501241_041656 Ga0501241_041656_100_372 90
443 3300049767 Ga0501270_015244 Ga0501270_015244_532_804 90
444 3300049779 Ga0501283_080816 Ga0501283_080816_296_568 90
445 3300050507 nmdc:mga05p37_422231_c1 nmdc:mga05p37_422231_c1_488_760 90
446 3300050508 nmdc:mga09592_73510_c1 nmdc:mga09592_73510_c1_2130_2402 90
447 3300050509 nmdc:mga0qj67_154367_c1 nmdc:mga0qj67_154367_c1_1293_1565 90
448 3300050510 nmdc:mga06r32_224506_c1 nmdc:mga06r32_224506_c1_99_371 90
449 3300050510 nmdc:mga06r32_330946_c1 nmdc:mga06r32_330946_c1_527_799 90
450 3300054114 Ga0501084_0262384 Ga0501084_0262384_77_349 90
451 3300061734 Ga0530510_0019275 Ga0530510_0019275_3283_3555 90

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01169

UPF0016

Uncharacterized protein family UPF0016

20

96

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7e-assembly2.cif.gz_B a structural basis for the unique binding features of the human vitamin d-binding protein 0.724 21 51
8apk-assembly1.cif.gz_X1 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6031 1 56
3im3-assembly1.cif.gz_A-2 crystal structure of pka ri alpha dimerization/docking domain 0.545 2 52
3im3-assembly1.cif.gz_A-2 crystal structure of pka ri alpha dimerization/docking domain 0.53 2 52
8apk-assembly1.cif.gz_X1 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.4416 1 56
ID Description Score Start End Superfamily
af_C7G025_232_430_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.7152 25 56 1.20.1540.10
3fpeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6865 14 40 3.40.50.150
af_Q499S9_628_790_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.6836 22 54 1.20.1540.10
af_A4I2Y4_69_433_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6709 7 47 1.10.510.10
af_B0UYE4_168_517_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.603 2 54 1.20.120.550
ID Description Score Start End GO Terms
AF-A9BAI3-F1-model_v4 GDT1 family protein 0.9162 4 89 GO:0016020
GO:0046873
AF-A0A6F8Y3W6-F1-model_v4 GDT1 family protein 0.9162 2 89 GO:0016020
GO:0046873
AF-A0A7C6ITY1-F1-model_v4 GDT1 family protein 0.9129 1 89 GO:0016020
GO:0046873
AF-A0A1F5UJ86-F1-model_v4 GDT1 family protein 0.902 1 89 GO:0016020
GO:0046873
AF-B1XML3-F1-model_v4 GDT1 family protein 0.8988 1 86 GO:0016020
GO:0046873

Feature Viewer

pLDDT pTM Quality
83.37 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map