F446648

General Info

Members Datasets Scaffolds Average Seq Length
450 343 900 140

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0251759|Ga0466970_0251759_205_624
Length 139
Sequence VNLLLDTNVLSEVQRPAPEPKVLEWLDAVDEDRVYVSVASIAELRRGIALMEGRRRTALAVWLAHDLPARFAERILPIDQEVAEHWGDLMAQSRRTGIALSAMDGFFAATALARNLTLVTRNTRDFAPFGVPTFNPWGE

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
53 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
54 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
125 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
126 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
223 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
224 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
225 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
226 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
227 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
228 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
229 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
230 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
233 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
234 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
235 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
236 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
237 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
238 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
239 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
240 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
241 2643221651 Afipia sp. Root123D2 Isolate Unclassified
242 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
243 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
244 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
245 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
246 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
247 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
248 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
249 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
250 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
251 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
252 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
253 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
254 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
255 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
256 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
257 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
258 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
259 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
260 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
261 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
262 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
263 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
264 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
265 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
266 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
267 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
268 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
269 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
270 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
271 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
272 2922368715
273 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
274 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
275 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
276 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
277 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
278 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
279 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
280 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
281 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
282 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
283 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
284 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
285 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
286 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
287 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
288 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
289 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
290 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
291 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
292 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
293 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
294 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
295 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
296 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
297 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
298 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
299 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
300 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
301 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
302 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
303 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
304 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
305 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
306 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
307 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
308 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
309 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
310 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
311 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
312 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
313 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
314 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
315 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
316 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
317 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
318 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
319 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
320 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
321 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
322 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
323 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
324 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
325 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
326 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
327 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
328 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
329 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
330 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
331 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
332 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
333 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
334 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
335 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
336 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
337 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
338 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
339 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
340 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
341 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
342 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
343 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.06
Metatranscriptomes 0
Isolates 24.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 20.89
Rhizoplane 6.89
Rhizosphere 44.89
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0251759 3300044765 Bacteria 990
2 JGI25153J46596_10002708 3300003215 Bacteria 10099
3 JGI25153J46596_10031184 3300003215 Bacteria 1799
4 JGI25153J46596_10043501 3300003215 Bacteria 1359
5 rootH2_10223574 3300003320 Bacteria 1004
6 Ga0070682_100510713 3300005337 Bacteria 933
7 Ga0068868_101414819 3300005338 Bacteria 649
8 Ga0070660_100422766 3300005339 Bacteria 1103
9 Ga0070660_101257723 3300005339 Bacteria 628
10 Ga0070661_100195583 3300005344 Bacteria 1543
11 Ga0070668_100246167 3300005347 Bacteria 1482
12 Ga0070668_101071563 3300005347 Bacteria 726
13 Ga0070674_100155454 3300005356 Bacteria 1730
14 Ga0070673_100617437 3300005364 Bacteria 990
15 Ga0070710_11479673 3300005437 Bacteria 510
16 Ga0070663_100576188 3300005455 Bacteria 944
17 Ga0070663_100706055 3300005455 Bacteria 857
18 Ga0070678_100259169 3300005456 Bacteria 1461
19 Ga0070678_100681377 3300005456 Bacteria 925
20 Ga0070662_100373940 3300005457 Bacteria 1172
21 Ga0068867_100141352 3300005459 Bacteria 1882
22 Ga0070706_100744614 3300005467 Bacteria 908
23 Ga0068853_100552734 3300005539 Bacteria 1091
24 Ga0068853_101298717 3300005539 Bacteria 703
25 Ga0070693_101129070 3300005547 Bacteria 599
26 Ga0070665_100013957 3300005548 Bacteria 8079
27 Ga0070665_100213512 3300005548 Bacteria 1930
28 Ga0068855_100356028 3300005563 Bacteria 1611
29 Ga0070664_101289077 3300005564 Bacteria 690
30 Ga0070664_102269772 3300005564 Bacteria 515
31 Ga0068852_100265633 3300005616 Bacteria 1649
32 Ga0068852_100896809 3300005616 Bacteria 903
33 Ga0068858_100242717 3300005842 Bacteria 1710
34 Ga0081540_1022219 3300005983 Bacteria 3748
35 Ga0070717_10603095 3300006028 Bacteria 996
36 Ga0075365_10005293 3300006038 Bacteria 6944
37 Ga0075365_10115398 3300006038 Bacteria 1848
38 Ga0075365_10998160 3300006038 Bacteria 590
39 Ga0070715_10285522 3300006163 Bacteria 877
40 Ga0070716_100042960 3300006173 Bacteria 2525
41 Ga0070716_100331514 3300006173 Bacteria 1070
42 Ga0070712_100116882 3300006175 Bacteria 2001
43 Ga0075369_10417780 3300006186 Bacteria 633
44 Ga0075369_10464007 3300006186 Bacteria 600
45 Ga0097621_101302784 3300006237 Bacteria 686
46 Ga0068871_101236942 3300006358 Bacteria 701
47 Ga0068865_100334948 3300006881 Bacteria 1221
48 Ga0068865_100485762 3300006881 Bacteria 1027
49 Ga0099794_10077813 3300007265 Bacteria 1633
50 Ga0105247_10166394 3300009101 Bacteria 1463
51 Ga0105243_10256495 3300009148 Bacteria 1564
52 Ga0105243_10901769 3300009148 Bacteria 879
53 Ga0105241_10062541 3300009174 Bacteria 2870
54 Ga0105237_10009834 3300009545 Bacteria 10226
55 Ga0105237_10181991 3300009545 Bacteria 2102
56 Ga0105237_10504054 3300009545 Bacteria 1217
57 Ga0105238_10256128 3300009551 Bacteria 1729
58 Ga0105238_10817595 3300009551 Bacteria 948
59 Ga0105249_10236613 3300009553 Bacteria 1804
60 Ga0105239_10028656 3300010375 Bacteria 6122
61 Ga0105239_10430833 3300010375 Bacteria 1495
62 Ga0105239_10631558 3300010375 Bacteria 1223
63 Ga0157370_11698691 3300013104 Bacteria 567
64 Ga0157374_11153746 3300013296 Unclassified 796
65 Ga0157378_10121688 3300013297 Bacteria 2406
66 Ga0157378_11108056 3300013297 Bacteria 829
67 Ga0163162_10236598 3300013306 Bacteria 1957
68 Ga0163162_11041106 3300013306 Bacteria 926
69 Ga0157375_10070304 3300013308 Bacteria 3510
70 Ga0163163_10054061 3300014325 Bacteria 3966
71 Ga0157380_11295585 3300014326 Bacteria 776
72 Ga0157379_10062010 3300014968 Bacteria 3344
73 Ga0157376_10145939 3300014969 Bacteria 2128
74 Ga0157376_10547801 3300014969 Bacteria 1144
75 Ga0157376_11154231 3300014969 Bacteria 802
76 Ga0163161_10206193 3300017792 Bacteria 1517
77 Ga0163161_10969527 3300017792 Bacteria 724
78 Ga0214544_1000136 3300021320 Bacteria 107814
79 Ga0214542_1000127 3300021321 Bacteria 107829
80 Ga0214545_1000063 3300021324 Bacteria 107829
81 Ga0214543_1029962 3300021327 Bacteria 2353
82 Ga0213876_10042673 3300021384 Bacteria 2396
83 Ga0213876_10198274 3300021384 Bacteria 1067
84 Ga0213875_10039320 3300021388 Bacteria 2228
85 Ga0209563_101169 3300025230 Bacteria 7372
86 Ga0209677_105727 3300025253 Bacteria 3158
87 Ga0209233_1001523 3300025261 Bacteria 9085
88 Ga0209758_1000455 3300025297 Bacteria 68279
89 Ga0209758_1003239 3300025297 Bacteria 15109
90 Ga0209758_1004498 3300025297 Bacteria 11570
91 Ga0209256_1050979 3300025299 Bacteria 1001
92 Ga0207642_10130867 3300025899 Bacteria 1309
93 Ga0207688_10086163 3300025901 Bacteria 1799
94 Ga0207680_10523557 3300025903 Bacteria 845
95 Ga0207647_10133739 3300025904 Bacteria 1456
96 Ga0207699_10175726 3300025906 Bacteria 1436
97 Ga0207699_10205455 3300025906 Bacteria 1337
98 Ga0207705_10129479 3300025909 Bacteria 1877
99 Ga0207654_10122903 3300025911 Bacteria 1633
100 Ga0207695_11319153 3300025913 Bacteria 602
101 Ga0207671_10101121 3300025914 Bacteria 2184
102 Ga0207671_10441400 3300025914 Bacteria 1036
103 Ga0207693_10011216 3300025915 Bacteria 7253
104 Ga0207663_10215124 3300025916 Bacteria 1395
105 Ga0207663_10512710 3300025916 Bacteria 933
106 Ga0207657_10367212 3300025919 Bacteria 1134
107 Ga0207657_10508472 3300025919 Bacteria 943
108 Ga0207649_10262502 3300025920 Bacteria 1248
109 Ga0207652_11373016 3300025921 Bacteria 610
110 Ga0207694_10139043 3300025924 Bacteria 1952
111 Ga0207694_10351688 3300025924 Bacteria 1220
112 Ga0207687_10708337 3300025927 Bacteria 855
113 Ga0207644_10489983 3300025931 Bacteria 1013
114 Ga0207706_10479154 3300025933 Bacteria 1075
115 Ga0207706_10900604 3300025933 Bacteria 747
116 Ga0207704_10362094 3300025938 Bacteria 1133
117 Ga0207665_10030419 3300025939 Bacteria 3567
118 Ga0207665_10194736 3300025939 Bacteria 1474
119 Ga0207667_10408802 3300025949 Bacteria 1382
120 Ga0207712_11612062 3300025961 Bacteria 582
121 Ga0207668_10066002 3300025972 Bacteria 2563
122 Ga0207677_11040220 3300026023 Bacteria 744
123 Ga0207639_10183601 3300026041 Bacteria 1781
124 Ga0207678_10303932 3300026067 Bacteria 1371
125 Ga0207678_10389019 3300026067 Bacteria 1206
126 Ga0207648_10336449 3300026089 Bacteria 1359
127 Ga0207674_10097215 3300026116 Bacteria 2928
128 Ga0207675_101864496 3300026118 Bacteria 620
129 Ga0207683_10670019 3300026121 Bacteria 961
130 Ga0207698_11033243 3300026142 Bacteria 833
131 Ga0268266_10012481 3300028379 Bacteria 7342
132 Ga0268266_10249254 3300028379 Bacteria 1642
133 Ga0268265_11405627 3300028380 Bacteria 700
134 Ga0265326_10006718 3300028558 Bacteria 3556
135 Ga0265323_10025367 3300028653 Bacteria 2245
136 Ga0265336_10000362 3300028666 Bacteria 29324
137 Ga0265338_10001385 3300028800 Bacteria 39441
138 Ga0307509_10042951 3300031507 Bacteria 4894
139 Ga0307516_10032907 3300031730 Bacteria 5221
140 Ga0307516_10053466 3300031730 Bacteria 3949
141 Ga0307414_11250746 3300032004 Bacteria 688
142 Ga0307510_10282290 3300033180 Bacteria 1130
143 Ga0373936_0351909 3300035113 Bacteria 671
144 Ga0373945_0040751 3300035116 Bacteria 1678
145 Ga0373946_0363270 3300035171 Bacteria 726
146 Ga0373927_0042908 3300035695 Bacteria 2930
147 Ga0373947_0086996 3300035725 Bacteria 1943
148 Ga0373925_0241414 3300037068 Bacteria 1447
149 Ga0373925_0994692 3300037068 Bacteria 691
150 Ga0395899_0096101 3300037312 Bacteria 2143
151 Ga0395900_0001409 3300037418 Bacteria 28756
152 Ga0395898_0016001 3300037466 Bacteria 7683
153 Ga0395898_0163265 3300037466 Bacteria 2131
154 Ga0395905_0029357 3300037471 Bacteria 5181
155 Ga0395905_0098939 3300037471 Bacteria 2739
156 Ga0395905_0246569 3300037471 Bacteria 1669
157 Ga0395905_0392697 3300037471 Bacteria 1282
158 Ga0436364_0891805 3300037853 Bacteria 2975
159 Ga0395901_0100595 3300038443 Bacteria 3032
160 Ga0395901_0132267 3300038443 Bacteria 2621
161 Ga0395901_0294312 3300038443 Bacteria 1684
162 Ga0436365_0167783 3300039437 Bacteria 30845
163 Ga0436365_1516651 3300039437 Bacteria 4451
164 Ga0436361_1145408 3300039447 Bacteria 4680
165 Ga0436363_0420587 3300039450 Unclassified 734
166 Ga0436363_0715384 3300039450 Bacteria 10341
167 Ga0436362_1154201 3300039453 Unclassified 1238
168 Ga0451789_0109670 3300041443 Bacteria 611
169 Ga0451793_0012123 3300041452 Bacteria 548
170 Ga0451795_0416028 3300041456 Bacteria 1934
171 Ga0451802_2064482 3300041460 Bacteria 921
172 Ga0451804_0935210 3300041463 Bacteria 559
173 Ga0451835_0584899 3300041492 Bacteria 799
174 Ga0451839_0589952 3300041496 Bacteria 655
175 Ga0451849_0111976 3300041505 Bacteria 1705
176 Ga0451843_1639297 3300041509 Bacteria 681
177 Ga0451853_1311526 3300041512 Bacteria 656
178 Ga0466972_0015855 3300044658 Bacteria 3767
179 Ga0466965_0236885 3300044683 Bacteria 976
180 Ga0466965_0662892 3300044683 Bacteria 596
181 Ga0466963_0004299 3300044694 Bacteria 8266
182 Ga0466963_0139251 3300044694 Bacteria 1680
183 Ga0466964_0137822 3300044706 Bacteria 1118
184 Ga0466964_0445235 3300044706 Bacteria 686
185 Ga0466968_0045172 3300044735 Bacteria 1868
186 Ga0466968_0075699 3300044735 Bacteria 1472
187 Ga0466970_0176705 3300044765 Bacteria 1184
188 Ga0466957_0072506 3300044842 Bacteria 2132
189 Ga0466960_0020021 3300044901 Bacteria 2957
190 Ga0466960_0109712 3300044901 Bacteria 1432
191 Ga0466960_0126913 3300044901 Bacteria 1342
192 Ga0466967_0029412 3300045976 Bacteria 4597
193 Ga0466967_0038270 3300045976 Bacteria 4112
194 Ga0466967_0400695 3300045976 Bacteria 1335
195 Ga0495603_0040021 3300046455 Bacteria 2807
196 Ga0495629_0006362 3300046459 Bacteria 8763
197 Ga0495629_0313245 3300046459 Bacteria 1073
198 Ga0495651_0441429 3300046462 Bacteria 842
199 Ga0495580_0209118 3300046472 Bacteria 1343
200 Ga0495605_0113495 3300046474 Bacteria 1234
201 Ga0495662_0080576 3300046476 Bacteria 1583
202 Ga0495585_0130374 3300046492 Bacteria 1324
203 Ga0495583_0098637 3300046506 Bacteria 1249
204 Ga0495606_0010770 3300046507 Bacteria 7536
205 Ga0495606_0189307 3300046507 Bacteria 1180
206 Ga0495606_0233937 3300046507 Bacteria 1028
207 Ga0495610_0156397 3300046512 Bacteria 967
208 Ga0495616_0223061 3300046513 Bacteria 820
209 Ga0495618_0093508 3300046514 Bacteria 1923
210 Ga0495631_0145566 3300046518 Bacteria 1017
211 Ga0495631_0329301 3300046518 Bacteria 650
212 Ga0495643_0194023 3300046522 Bacteria 979
213 Ga0495643_0424785 3300046522 Bacteria 582
214 Ga0495648_0079799 3300046524 Bacteria 1866
215 Ga0495648_0087216 3300046524 Bacteria 1758
216 Ga0495666_0048957 3300046526 Bacteria 2034
217 Ga0495652_0207045 3300046529 Bacteria 1484
218 Ga0495654_0336056 3300046530 Bacteria 610
219 Ga0495665_0199313 3300046531 Bacteria 1038
220 Ga0495587_0405072 3300046536 Bacteria 758
221 Ga0495598_0329531 3300046537 Bacteria 583
222 Ga0495622_0042336 3300046557 Bacteria 2117
223 Ga0495622_0239268 3300046557 Bacteria 800
224 Ga0495667_0518625 3300046559 Bacteria 746
225 Ga0495611_0131836 3300046648 Bacteria 1166
226 Ga0495625_0276258 3300046660 Bacteria 1082
227 Ga0495661_0333996 3300046665 Bacteria 750
228 Ga0495588_0093450 3300046674 Bacteria 1576
229 Ga0495657_0037391 3300046675 Bacteria 3347
230 Ga0495624_0041148 3300046690 Bacteria 2957
231 Ga0495671_0369545 3300046692 Bacteria 687
232 Ga0495649_0155244 3300046694 Bacteria 1201
233 Ga0495600_0033674 3300046809 Bacteria 3325
234 Ga0495660_0204822 3300046810 Bacteria 940
235 Ga0495581_0074940 3300047315 Bacteria 1958
236 Ga0495674_0434937 3300047319 Bacteria 1056
237 Ga0495672_0257541 3300047320 Bacteria 844
238 Ga0495683_0039530 3300047323 Bacteria 2384
239 Ga0495602_0508267 3300048088 Bacteria 841
240 Ga0496100_0137976 3300048903 Bacteria 1725
241 Ga0496100_0785072 3300048903 Bacteria 746
242 Ga0496101_0092202 3300048904 Bacteria 2255
243 Ga0496101_0169305 3300048904 Bacteria 1678
244 Ga0496101_0684762 3300048904 Bacteria 810
245 Ga0496101_0952097 3300048904 Bacteria 676
246 Ga0496102_0282041 3300048905 Bacteria 1566
247 Ga0496102_0562228 3300048905 Bacteria 1063
248 Ga0496103_0316847 3300048906 Bacteria 1003
249 Ga0496103_0551534 3300048906 Bacteria 736
250 Ga0496104_0011321 3300048907 Bacteria 7986
251 Ga0496104_0283192 3300048907 Bacteria 1570
252 Ga0496105_0043751 3300048908 Bacteria 3693
253 Ga0496105_0310710 3300048908 Bacteria 1265
254 Ga0496105_1190386 3300048908 Bacteria 561
255 Ga0496106_0002509 3300048909 Bacteria 13669
256 Ga0496106_0011320 3300048909 Bacteria 6603
257 Ga0496107_0050603 3300048910 Bacteria 2995
258 Ga0496110_0343588 3300048913 Bacteria 1359
259 Ga0496110_1232859 3300048913 Bacteria 657
260 Ga0496112_0645667 3300048915 Bacteria 988
261 Ga0496113_0209516 3300048916 Bacteria 1551
262 Ga0496113_0282628 3300048916 Bacteria 1327
263 Ga0496115_0107079 3300048918 Bacteria 2295
264 Ga0496115_0335675 3300048918 Bacteria 1234
265 Ga0496115_0475712 3300048918 Bacteria 1006
266 Ga0496116_0046844 3300048919 Bacteria 2915
267 Ga0496116_0138155 3300048919 Bacteria 1376
268 Ga0496117_0010649 3300048920 Bacteria 8340
269 Ga0496117_0031826 3300048920 Bacteria 4021
270 Ga0496117_0107015 3300048920 Bacteria 1753
271 Ga0496117_0209703 3300048920 Bacteria 1093
272 Ga0496117_0321375 3300048920 Bacteria 811
273 Ga0496118_0016690 3300048921 Bacteria 6725
274 Ga0496118_0040037 3300048921 Bacteria 3731
275 Ga0496118_0040616 3300048921 Bacteria 3696
276 Ga0496118_0299914 3300048921 Bacteria 883
277 Ga0496119_0018495 3300048922 Bacteria 5182
278 Ga0496119_0055786 3300048922 Bacteria 2398
279 Ga0496119_0186631 3300048922 Bacteria 1083
280 Ga0496120_0027117 3300048923 Bacteria 3529
281 Ga0496120_0167803 3300048923 Bacteria 1088
282 Ga0496121_0000099 3300048924 Bacteria 200160
283 Ga0496121_0070020 3300048924 Bacteria 2827
284 Ga0496121_0116824 3300048924 Bacteria 2022
285 Ga0496121_0477085 3300048924 Bacteria 797
286 Ga0496124_0049767 3300048927 Bacteria 3573
287 Ga0496124_0348911 3300048927 Bacteria 1048
288 Ga0496126_0023146 3300048929 Bacteria 6022
289 Ga0496126_0024171 3300048929 Bacteria 5870
290 Ga0496126_0116628 3300048929 Bacteria 2320
291 Ga0496126_0281891 3300048929 Bacteria 1376
292 Ga0496126_0550712 3300048929 Bacteria 915
293 Ga0496126_1013634 3300048929 Bacteria 622
294 Ga0495682_0077784 3300049460 Bacteria 1193
295 Ga0501043_0255375 3300049579 Bacteria 1349
296 Ga0501043_0377345 3300049579 Bacteria 1074
297 nmdc:mga0yw44_156504_c1 3300050492 Bacteria 1490
298 nmdc:mga0yw44_56593_c1 3300050492 Bacteria 2390
299 nmdc:mga0k408_662154_c1 3300050493 Bacteria 613
300 nmdc:mga07m45_191951_c1 3300050496 Bacteria 1188
301 nmdc:mga0sz30_62890_c1 3300050516 Bacteria 1588
302 Ga0495595_0202382 3300053084 Bacteria 989
303 Ga0500578_0078290 3300053086 Bacteria 2104
304 Ga0500578_0119362 3300053086 Bacteria 1658
305 Ga0500647_0199799 3300053091 Bacteria 907
306 Ga0500651_0009507 3300053093 Bacteria 5782
307 Ga0500651_0304906 3300053093 Bacteria 913
308 Ga0500566_0265000 3300053094 Bacteria 827
309 Ga0500641_0199368 3300053096 Bacteria 855
310 Ga0500650_0071439 3300053098 Bacteria 1622
311 Ga0500555_002881 3300053103 Bacteria 4927
312 Ga0500557_000006 3300053105 Bacteria 141252
313 Ga0500562_003612 3300053108 Bacteria 3882
314 Ga0500569_300270 3300053109 Bacteria 540
315 Ga0500595_010829 3300053119 Bacteria 3602
316 Ga0500595_014777 3300053119 Bacteria 2951
317 Ga0500642_0000686 3300053130 Bacteria 10021
318 Ga0500642_0002858 3300053130 Bacteria 5131
319 Ga0500652_000235 3300053131 Bacteria 21167
320 Ga0500559_0017862 3300053136 Bacteria 2998
321 Ga0500568_0045167 3300053139 Bacteria 1754
322 Ga0500568_0072601 3300053139 Bacteria 1316
323 Ga0500590_225688 3300053148 Bacteria 768
324 Ga0500604_0222603 3300053151 Bacteria 651
325 Ga0500616_0000390 3300053153 Bacteria 61067
326 Ga0500622_0195921 3300053156 Bacteria 922
327 Ga0500627_0015672 3300053158 Bacteria 2937
328 Ga0500638_265015 3300053162 Bacteria 683
329 Ga0500649_119381 3300053722 Bacteria 1007
330 Ga0500625_000351 3300053729 Bacteria 11670
331 Ga0500645_012109 3300053730 Bacteria 2794
332 Ga0500609_004753 3300053731 Bacteria 1869
333 Ga0500552_033134 3300053733 Bacteria 806
334 Ga0500596_039821 3300053735 Bacteria 747
335 Ga0500601_004060 3300053737 Bacteria 1588
336 Ga0500601_008635 3300053737 Bacteria 1134
337 Ga0466962_0425284 3300061719 Bacteria 667
338 2507507153 2507262055 Bacteria 8048963
339 2508693461 2508501042 Bacteria 8719808
340 2509148924 2508501128 Bacteria 8613869
341 2513627121 2513237092 Bacteria 8341956
342 2513651622 2513237095 Bacteria 8976980
343 2513703040 2513237102 Bacteria 7703324
344 2515628820 2515154112 Bacteria 8294334
345 2528851007 2528768022 Bacteria 10457665
346 2617377738 2617270741 Bacteria 8201522
347 2644291622 2643221651 Bacteria 4798932
348 2793065983 2791355196 Bacteria 7323613
349 2818243237 2816332527 Bacteria 8933356
350 2824622617 2824617872 Bacteria 8814715
351 2824631780 2824626560 Bacteria 8813858
352 2824638948 2824635225 Bacteria 8785348
353 2824648880 2824644064 Bacteria 8743947
354 2824667915 2824661429 Bacteria 9877870
355 2824707490 2824704595 Bacteria 9667483
356 2824721629 2824714736 Bacteria 8717648
357 2824731529 2824723954 Bacteria 8758240
358 2824736963 2824732956 Bacteria 7810675
359 2824746424 2824746037 Bacteria 7911610
360 2824759249 2824753945 Bacteria 9787441
361 2824769557 2824763712 Bacteria 9792355
362 2874596102 2874590934 Bacteria 8299676
363 2874625860 2874620515 Bacteria 8290088
364 2874650926 2874645413 Bacteria 8214782
365 2876776070 2876771140 Bacteria 8287509
366 2876816550 2876808645 Bacteria 8824342
367 2876820658 2876818435 Bacteria 8274608
368 2879080159 2879074833 Bacteria 8279565
369 2879100221 2879099564 Bacteria 10442239
370 2879117752 2879110137 Bacteria 8907982
371 2879129932 2879127579 Bacteria 8294491
372 2879147410 2879142872 Bacteria 8267021
373 2881367792 2881364244 Bacteria 7710352
374 2888386026 2888378607 Bacteria 9652610
375 2904673779 2904666416 Bacteria 8226587
376 2904717598 2904711408 Bacteria 9771557
377 2908782216 2908775508 Bacteria 8092255
378 2922376354
379 2929624010 2929615660 Bacteria 9193770
380 2929633151 2929624759 Bacteria 9339455
381 2932792680 2932784394 Bacteria 9704911
382 2932815230 2932809354 Bacteria 9135765
383 2932824491 2932818245 Bacteria 9955613
384 2932832109 2932828146 Bacteria 9745859
385 2933585911 2933577622 Bacteria 9116884
386 2935622048 2935616580 Bacteria 9032984
387 2935643942 2935638405 Bacteria 10015038
388 2935654330 2935648319 Bacteria 8801166
389 2935663210 2935656913 Bacteria 8965014
390 2935669143 2935665750 Bacteria 9571747
391 2935683299 2935675223 Bacteria 9928132
392 2935692240 2935684952 Bacteria 9590419
393 2935700589 2935694250 Bacteria 9291695
394 2935708782 2935703347 Bacteria 10242284
395 2935720522 2935713505 Bacteria 9608509
396 2935729803 2935722832 Bacteria 9608746
397 2935739215 2935732158 Bacteria 9706831
398 2935748244 2935741537 Bacteria 9707219
399 2935758447 2935750917 Bacteria 9590372
400 2935766126 2935760218 Bacteria 9817913
401 2935771005 2935769743 Bacteria 7878163
402 2935781174 2935777560 Bacteria 8077691
403 2935786294 2935785616 Bacteria 7962367
404 2935793909 2935793552 Bacteria 8012592
405 2935805859 2935801545 Bacteria 9301974
406 2935815582 2935810662 Bacteria 9401221
407 2935833194 2935827899 Bacteria 10038562
408 2935843236 2935837841 Bacteria 9454360
409 2935860295 2935855204 Bacteria 9035059
410 2935867692 2935864058 Bacteria 9784707
411 2935878498 2935873716 Bacteria 9632195
412 2935976027 2935975950 Bacteria 8347125
413 2935986482 2935984226 Bacteria 8302647
414 2935998618 2935992306 Bacteria 9802711
415 2936006925 2936002035 Bacteria 9362176
416 2936017366 2936011229 Bacteria 8801034
417 2936025868 2936019824 Bacteria 8804134
418 2936034724 2936028420 Bacteria 8965941
419 2936040820 2936037263 Bacteria 9446081
420 2936052781 2936046547 Bacteria 8903709
421 2936059976 2936055302 Bacteria 8785755
422 2940564351 2940556831 Bacteria 9590747
423 2941531732 2941531003 Bacteria 7653939
424 2941544782 2941538514 Bacteria 9402094
425 3005511517 3005506211 Bacteria 6943378
426 3005716320 3005710791 Bacteria 7622528
427 8016520057 8016511872 Bacteria 9921665
428 8016527976 8016522445 Bacteria 8156687
429 8016546334 8016539877 Bacteria 8155419
430 8016564142 8016557553 Bacteria 8154380
431 8016571415 8016566248 Bacteria 8158151
432 8016575673 8016575299 Bacteria 8154085
433 8016601845 8016595262 Bacteria 8149947
434 8016608405 8016603502 Bacteria 8731218
435 8016616462 8016613128 Bacteria 8794220
436 8016638164 8016630954 Bacteria 9217207
437 8017065497 8017057580 Bacteria 10023680
438 8019532899 8019530166 Bacteria 8155624
439 8019546954 8019538911 Bacteria 7872763
440 8019584900 8019576017 Bacteria 10049540
441 8019592852 8019586578 Bacteria 10212056
442 8019609771 8019608314 Bacteria 10042931
443 8019620354 8019619141 Bacteria 9218857
444 8019632746 8019629233 Bacteria 8687553
445 8019647185 8019638758 Bacteria 9062356
446 8019648082 8019638758 Bacteria 9062356
447 8019660612 8019659431 Bacteria 8577854
448 8019670030 8019668869 Bacteria 8791617
449 8019686071 8019678201 Bacteria 8863603
450 8055744518 8055742211 Bacteria 9226248
451 Ga0466970_0251759
452 JGI25153J46596_10002708
453 JGI25153J46596_10031184
454 JGI25153J46596_10043501
455 rootH2_10223574
456 Ga0070682_100510713
457 Ga0068868_101414819
458 Ga0070660_100422766
459 Ga0070660_101257723
460 Ga0070661_100195583
461 Ga0070668_100246167
462 Ga0070668_101071563
463 Ga0070674_100155454
464 Ga0070673_100617437
465 Ga0070710_11479673
466 Ga0070663_100576188
467 Ga0070663_100706055
468 Ga0070678_100259169
469 Ga0070678_100681377
470 Ga0070662_100373940
471 Ga0068867_100141352
472 Ga0070706_100744614
473 Ga0068853_100552734
474 Ga0068853_101298717
475 Ga0070693_101129070
476 Ga0070665_100013957
477 Ga0070665_100213512
478 Ga0068855_100356028
479 Ga0070664_101289077
480 Ga0070664_102269772
481 Ga0068852_100265633
482 Ga0068852_100896809
483 Ga0068858_100242717
484 Ga0081540_1022219
485 Ga0070717_10603095
486 Ga0075365_10005293
487 Ga0075365_10115398
488 Ga0075365_10998160
489 Ga0070715_10285522
490 Ga0070716_100042960
491 Ga0070716_100331514
492 Ga0070712_100116882
493 Ga0075369_10417780
494 Ga0075369_10464007
495 Ga0097621_101302784
496 Ga0068871_101236942
497 Ga0068865_100334948
498 Ga0068865_100485762
499 Ga0099794_10077813
500 Ga0105247_10166394
501 Ga0105243_10256495
502 Ga0105243_10901769
503 Ga0105241_10062541
504 Ga0105237_10009834
505 Ga0105237_10181991
506 Ga0105237_10504054
507 Ga0105238_10256128
508 Ga0105238_10817595
509 Ga0105249_10236613
510 Ga0105239_10028656
511 Ga0105239_10430833
512 Ga0105239_10631558
513 Ga0157370_11698691
514 Ga0157374_11153746
515 Ga0157378_10121688
516 Ga0157378_11108056
517 Ga0163162_10236598
518 Ga0163162_11041106
519 Ga0157375_10070304
520 Ga0163163_10054061
521 Ga0157380_11295585
522 Ga0157379_10062010
523 Ga0157376_10145939
524 Ga0157376_10547801
525 Ga0157376_11154231
526 Ga0163161_10206193
527 Ga0163161_10969527
528 Ga0214544_1000136
529 Ga0214542_1000127
530 Ga0214545_1000063
531 Ga0214543_1029962
532 Ga0213876_10042673
533 Ga0213876_10198274
534 Ga0213875_10039320
535 Ga0209563_101169
536 Ga0209677_105727
537 Ga0209233_1001523
538 Ga0209758_1000455
539 Ga0209758_1003239
540 Ga0209758_1004498
541 Ga0209256_1050979
542 Ga0207642_10130867
543 Ga0207688_10086163
544 Ga0207680_10523557
545 Ga0207647_10133739
546 Ga0207699_10175726
547 Ga0207699_10205455
548 Ga0207705_10129479
549 Ga0207654_10122903
550 Ga0207695_11319153
551 Ga0207671_10101121
552 Ga0207671_10441400
553 Ga0207693_10011216
554 Ga0207663_10215124
555 Ga0207663_10512710
556 Ga0207657_10367212
557 Ga0207657_10508472
558 Ga0207649_10262502
559 Ga0207652_11373016
560 Ga0207694_10139043
561 Ga0207694_10351688
562 Ga0207687_10708337
563 Ga0207644_10489983
564 Ga0207706_10479154
565 Ga0207706_10900604
566 Ga0207704_10362094
567 Ga0207665_10030419
568 Ga0207665_10194736
569 Ga0207667_10408802
570 Ga0207712_11612062
571 Ga0207668_10066002
572 Ga0207677_11040220
573 Ga0207639_10183601
574 Ga0207678_10303932
575 Ga0207678_10389019
576 Ga0207648_10336449
577 Ga0207674_10097215
578 Ga0207675_101864496
579 Ga0207683_10670019
580 Ga0207698_11033243
581 Ga0268266_10012481
582 Ga0268266_10249254
583 Ga0268265_11405627
584 Ga0265326_10006718
585 Ga0265323_10025367
586 Ga0265336_10000362
587 Ga0265338_10001385
588 Ga0307509_10042951
589 Ga0307516_10032907
590 Ga0307516_10053466
591 Ga0307414_11250746
592 Ga0307510_10282290
593 Ga0373936_0351909
594 Ga0373945_0040751
595 Ga0373946_0363270
596 Ga0373927_0042908
597 Ga0373947_0086996
598 Ga0373925_0241414
599 Ga0373925_0994692
600 Ga0395899_0096101
601 Ga0395900_0001409
602 Ga0395898_0016001
603 Ga0395898_0163265
604 Ga0395905_0029357
605 Ga0395905_0098939
606 Ga0395905_0246569
607 Ga0395905_0392697
608 Ga0436364_0891805
609 Ga0395901_0100595
610 Ga0395901_0132267
611 Ga0395901_0294312
612 Ga0436365_0167783
613 Ga0436365_1516651
614 Ga0436361_1145408
615 Ga0436363_0420587
616 Ga0436363_0715384
617 Ga0436362_1154201
618 Ga0451789_0109670
619 Ga0451793_0012123
620 Ga0451795_0416028
621 Ga0451802_2064482
622 Ga0451804_0935210
623 Ga0451835_0584899
624 Ga0451839_0589952
625 Ga0451849_0111976
626 Ga0451843_1639297
627 Ga0451853_1311526
628 Ga0466972_0015855
629 Ga0466965_0236885
630 Ga0466965_0662892
631 Ga0466963_0004299
632 Ga0466963_0139251
633 Ga0466964_0137822
634 Ga0466964_0445235
635 Ga0466968_0045172
636 Ga0466968_0075699
637 Ga0466970_0176705
638 Ga0466957_0072506
639 Ga0466960_0020021
640 Ga0466960_0109712
641 Ga0466960_0126913
642 Ga0466967_0029412
643 Ga0466967_0038270
644 Ga0466967_0400695
645 Ga0495603_0040021
646 Ga0495629_0006362
647 Ga0495629_0313245
648 Ga0495651_0441429
649 Ga0495580_0209118
650 Ga0495605_0113495
651 Ga0495662_0080576
652 Ga0495585_0130374
653 Ga0495583_0098637
654 Ga0495606_0010770
655 Ga0495606_0189307
656 Ga0495606_0233937
657 Ga0495610_0156397
658 Ga0495616_0223061
659 Ga0495618_0093508
660 Ga0495631_0145566
661 Ga0495631_0329301
662 Ga0495643_0194023
663 Ga0495643_0424785
664 Ga0495648_0079799
665 Ga0495648_0087216
666 Ga0495666_0048957
667 Ga0495652_0207045
668 Ga0495654_0336056
669 Ga0495665_0199313
670 Ga0495587_0405072
671 Ga0495598_0329531
672 Ga0495622_0042336
673 Ga0495622_0239268
674 Ga0495667_0518625
675 Ga0495611_0131836
676 Ga0495625_0276258
677 Ga0495661_0333996
678 Ga0495588_0093450
679 Ga0495657_0037391
680 Ga0495624_0041148
681 Ga0495671_0369545
682 Ga0495649_0155244
683 Ga0495600_0033674
684 Ga0495660_0204822
685 Ga0495581_0074940
686 Ga0495674_0434937
687 Ga0495672_0257541
688 Ga0495683_0039530
689 Ga0495602_0508267
690 Ga0496100_0137976
691 Ga0496100_0785072
692 Ga0496101_0092202
693 Ga0496101_0169305
694 Ga0496101_0684762
695 Ga0496101_0952097
696 Ga0496102_0282041
697 Ga0496102_0562228
698 Ga0496103_0316847
699 Ga0496103_0551534
700 Ga0496104_0011321
701 Ga0496104_0283192
702 Ga0496105_0043751
703 Ga0496105_0310710
704 Ga0496105_1190386
705 Ga0496106_0002509
706 Ga0496106_0011320
707 Ga0496107_0050603
708 Ga0496110_0343588
709 Ga0496110_1232859
710 Ga0496112_0645667
711 Ga0496113_0209516
712 Ga0496113_0282628
713 Ga0496115_0107079
714 Ga0496115_0335675
715 Ga0496115_0475712
716 Ga0496116_0046844
717 Ga0496116_0138155
718 Ga0496117_0010649
719 Ga0496117_0031826
720 Ga0496117_0107015
721 Ga0496117_0209703
722 Ga0496117_0321375
723 Ga0496118_0016690
724 Ga0496118_0040037
725 Ga0496118_0040616
726 Ga0496118_0299914
727 Ga0496119_0018495
728 Ga0496119_0055786
729 Ga0496119_0186631
730 Ga0496120_0027117
731 Ga0496120_0167803
732 Ga0496121_0000099
733 Ga0496121_0070020
734 Ga0496121_0116824
735 Ga0496121_0477085
736 Ga0496124_0049767
737 Ga0496124_0348911
738 Ga0496126_0023146
739 Ga0496126_0024171
740 Ga0496126_0116628
741 Ga0496126_0281891
742 Ga0496126_0550712
743 Ga0496126_1013634
744 Ga0495682_0077784
745 Ga0501043_0255375
746 Ga0501043_0377345
747 nmdc:mga0yw44_156504_c1
748 nmdc:mga0yw44_56593_c1
749 nmdc:mga0k408_662154_c1
750 nmdc:mga07m45_191951_c1
751 nmdc:mga0sz30_62890_c1
752 Ga0495595_0202382
753 Ga0500578_0078290
754 Ga0500578_0119362
755 Ga0500647_0199799
756 Ga0500651_0009507
757 Ga0500651_0304906
758 Ga0500566_0265000
759 Ga0500641_0199368
760 Ga0500650_0071439
761 Ga0500555_002881
762 Ga0500557_000006
763 Ga0500562_003612
764 Ga0500569_300270
765 Ga0500595_010829
766 Ga0500595_014777
767 Ga0500642_0000686
768 Ga0500642_0002858
769 Ga0500652_000235
770 Ga0500559_0017862
771 Ga0500568_0045167
772 Ga0500568_0072601
773 Ga0500590_225688
774 Ga0500604_0222603
775 Ga0500616_0000390
776 Ga0500622_0195921
777 Ga0500627_0015672
778 Ga0500638_265015
779 Ga0500649_119381
780 Ga0500625_000351
781 Ga0500645_012109
782 Ga0500609_004753
783 Ga0500552_033134
784 Ga0500596_039821
785 Ga0500601_004060
786 Ga0500601_008635
787 Ga0466962_0425284
788 2507507153
789 2508693461
790 2509148924
791 2513627121
792 2513651622
793 2513703040
794 2515628820
795 2528851007
796 2617377738
797 2644291622
798 2793065983
799 2818243237
800 2824622617
801 2824631780
802 2824638948
803 2824648880
804 2824667915
805 2824707490
806 2824721629
807 2824731529
808 2824736963
809 2824746424
810 2824759249
811 2824769557
812 2874596102
813 2874625860
814 2874650926
815 2876776070
816 2876816550
817 2876820658
818 2879080159
819 2879100221
820 2879117752
821 2879129932
822 2879147410
823 2881367792
824 2888386026
825 2904673779
826 2904717598
827 2908782216
828 2922376354
829 2929624010
830 2929633151
831 2932792680
832 2932815230
833 2932824491
834 2932832109
835 2933585911
836 2935622048
837 2935643942
838 2935654330
839 2935663210
840 2935669143
841 2935683299
842 2935692240
843 2935700589
844 2935708782
845 2935720522
846 2935729803
847 2935739215
848 2935748244
849 2935758447
850 2935766126
851 2935771005
852 2935781174
853 2935786294
854 2935793909
855 2935805859
856 2935815582
857 2935833194
858 2935843236
859 2935860295
860 2935867692
861 2935878498
862 2935976027
863 2935986482
864 2935998618
865 2936006925
866 2936017366
867 2936025868
868 2936034724
869 2936040820
870 2936052781
871 2936059976
872 2940564351
873 2941531732
874 2941544782
875 3005511517
876 3005716320
877 8016520057
878 8016527976
879 8016546334
880 8016564142
881 8016571415
882 8016575673
883 8016601845
884 8016608405
885 8016616462
886 8016638164
887 8017065497
888 8019532899
889 8019546954
890 8019584900
891 8019592852
892 8019609771
893 8019620354
894 8019632746
895 8019647185
896 8019648082
897 8019660612
898 8019670030
899 8019686071
900 8055744518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

3

130

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9419 3 140
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9385 3 141
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.929 3 140
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9197 3 141
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.8674 1 137
ID Description Score Start End Superfamily
2w43A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9539 80 116 1.10.150.240
2w43B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9513 80 116 1.10.150.240
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9385 3 141 3.40.50.1010
2w11A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9316 80 116 1.10.150.240
2w11B02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9314 80 116 1.10.150.240
ID Description Score Start End GO Terms
AF-A0A6J4IYK6-F1-model_v4 PIN domain-containing protein 0.9872 1 93 GO:0004518
GO:0046872
AF-A0A5D3KW96-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9852 1 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A527I003-F1-model_v4 deleted 0.9837 1 117
AF-A0A4Y3WDQ8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9812 1 139 GO:0000287
GO:0004540
GO:0090729
AF-A0A0S3PQH3-F1-model_v4 Toxin FitB (EC 3.1.-.-) 0.976 1 88 GO:0004518
GO:0046872

Map