F446326
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 245 | 448 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100338456|Ga0070707_1003384561 |
| Length | 253 |
| Sequence | MGIEAGMAEAIRKTSEAQSIPERIEALDWKSVGESLSQRGYAVTAQVLSSAECARLVALYKDASRFRSEIIMERYRFGIGDYKYFGHPLPEIVTSLRTYAYPHLADVANQWAETLGETSPRFPRDHAAFLKICHKAGQTKPTPLLLHYEAGGYNCLHQDIYGDVSFPLQMVFLLGQQGRDWEGGEFLLVEQQPRAQSKGEVIRPDQGQAIVFTTRYRPVRGTRGYYRVNMRHGVSRVHRGTRYTLGIIFHDAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 159 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 206 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 210 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.89 |
| Metatranscriptomes | 0.89 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0 |
| Rhizoplane | 4.01 |
| Rhizosphere | 92.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5305914 | 2162886012 | Bacteria | 1471 |
| 2 | JGI24744J21845_10003244 | 3300002077 | Bacteria | 3339 |
| 3 | Ga0065715_10134717 | 3300005293 | Bacteria | 1918 |
| 4 | Ga0070658_10051737 | 3300005327 | Bacteria | 3329 |
| 5 | Ga0070676_10000619 | 3300005328 | Bacteria | 17345 |
| 6 | Ga0070683_100101853 | 3300005329 | Bacteria | 2704 |
| 7 | Ga0070683_100196908 | 3300005329 | Bacteria | 1913 |
| 8 | Ga0068869_100019015 | 3300005334 | Bacteria | 4686 |
| 9 | Ga0070666_10175325 | 3300005335 | Bacteria | 1503 |
| 10 | Ga0070680_100132565 | 3300005336 | Bacteria | 2085 |
| 11 | Ga0068868_100019537 | 3300005338 | Bacteria | 5077 |
| 12 | Ga0068868_100116604 | 3300005338 | Bacteria | 2175 |
| 13 | Ga0070660_100116205 | 3300005339 | Bacteria | 2133 |
| 14 | Ga0070661_100083642 | 3300005344 | Bacteria | 2357 |
| 15 | Ga0070692_10052401 | 3300005345 | Bacteria | 2125 |
| 16 | Ga0070669_100132987 | 3300005353 | Bacteria | 1911 |
| 17 | Ga0070675_100309106 | 3300005354 | Bacteria | 1394 |
| 18 | Ga0070671_100006354 | 3300005355 | Bacteria | 9431 |
| 19 | Ga0070673_100007135 | 3300005364 | Bacteria | 7339 |
| 20 | Ga0070659_100041895 | 3300005366 | Bacteria | 3580 |
| 21 | Ga0070667_100008627 | 3300005367 | Bacteria | 8448 |
| 22 | Ga0070703_10088170 | 3300005406 | Bacteria | 1071 |
| 23 | Ga0070709_10000103 | 3300005434 | Bacteria | 60237 |
| 24 | Ga0070709_10034804 | 3300005434 | Bacteria | 3057 |
| 25 | Ga0070714_100076396 | 3300005435 | Bacteria | 2908 |
| 26 | Ga0070713_100014552 | 3300005436 | Bacteria | 5850 |
| 27 | Ga0070713_100102199 | 3300005436 | Bacteria | 2485 |
| 28 | Ga0070713_100124330 | 3300005436 | Bacteria | 2267 |
| 29 | Ga0070711_100130101 | 3300005439 | Bacteria | 1873 |
| 30 | Ga0070694_100157141 | 3300005444 | Bacteria | 1665 |
| 31 | Ga0070708_100001533 | 3300005445 | Bacteria | 17655 |
| 32 | Ga0070708_100001851 | 3300005445 | Bacteria | 16232 |
| 33 | Ga0070708_100030962 | 3300005445 | Bacteria | 4628 |
| 34 | Ga0070708_100650092 | 3300005445 | Bacteria | 994 |
| 35 | Ga0070708_100741111 | 3300005445 | Bacteria | 924 |
| 36 | Ga0070662_100005626 | 3300005457 | Bacteria | 8016 |
| 37 | Ga0070681_10087352 | 3300005458 | Bacteria | 3071 |
| 38 | Ga0070681_10126006 | 3300005458 | Bacteria | 2494 |
| 39 | Ga0070681_10181981 | 3300005458 | Unclassified | 2023 |
| 40 | Ga0068867_100007963 | 3300005459 | Bacteria | 7486 |
| 41 | Ga0068867_100100516 | 3300005459 | Bacteria | 2208 |
| 42 | Ga0070706_100000003 | 3300005467 | Bacteria | 284182 |
| 43 | Ga0070706_100001737 | 3300005467 | Bacteria | 22580 |
| 44 | Ga0070706_100117989 | 3300005467 | Bacteria | 2472 |
| 45 | Ga0070706_100149388 | 3300005467 | Bacteria | 2181 |
| 46 | Ga0070706_100310707 | 3300005467 | Bacteria | 1470 |
| 47 | Ga0070707_100006616 | 3300005468 | Bacteria | 10747 |
| 48 | Ga0070707_100007093 | 3300005468 | Bacteria | 10389 |
| 49 | Ga0070707_100008529 | 3300005468 | Bacteria | 9523 |
| 50 | Ga0070707_100089024 | 3300005468 | Bacteria | 2986 |
| 51 | Ga0070707_100189515 | 3300005468 | Bacteria | 2005 |
| 52 | Ga0070707_100338456 | 3300005468 | Bacteria | 1462 |
| 53 | Ga0070698_100008343 | 3300005471 | Bacteria | 11196 |
| 54 | Ga0070698_100025761 | 3300005471 | Bacteria | 6128 |
| 55 | Ga0070698_100048778 | 3300005471 | Bacteria | 4326 |
| 56 | Ga0070698_100171452 | 3300005471 | Bacteria | 2111 |
| 57 | Ga0070698_100301285 | 3300005471 | Unclassified | 1533 |
| 58 | Ga0070699_100006289 | 3300005518 | Bacteria | 10360 |
| 59 | Ga0070699_100017797 | 3300005518 | Bacteria | 6102 |
| 60 | Ga0070699_100056848 | 3300005518 | Bacteria | 3388 |
| 61 | Ga0070699_100073066 | 3300005518 | Bacteria | 2984 |
| 62 | Ga0070699_100290657 | 3300005518 | Bacteria | 1465 |
| 63 | Ga0070679_100013169 | 3300005530 | Bacteria | 7920 |
| 64 | Ga0070679_100041420 | 3300005530 | Bacteria | 4584 |
| 65 | Ga0070684_100199728 | 3300005535 | Unclassified | 1821 |
| 66 | Ga0070697_100002968 | 3300005536 | Bacteria | 13045 |
| 67 | Ga0070697_100005220 | 3300005536 | Bacteria | 9978 |
| 68 | Ga0070697_100005819 | 3300005536 | Bacteria | 9514 |
| 69 | Ga0070697_100033336 | 3300005536 | Bacteria | 4147 |
| 70 | Ga0070697_100180195 | 3300005536 | Bacteria | 1791 |
| 71 | Ga0070697_100325232 | 3300005536 | Bacteria | 1325 |
| 72 | Ga0068853_100021383 | 3300005539 | Bacteria | 5394 |
| 73 | Ga0068853_100187186 | 3300005539 | Bacteria | 1880 |
| 74 | Ga0068853_100208085 | 3300005539 | Unclassified | 1782 |
| 75 | Ga0070686_100032952 | 3300005544 | Bacteria | 3180 |
| 76 | Ga0070695_100001936 | 3300005545 | Bacteria | 11732 |
| 77 | Ga0070695_100020213 | 3300005545 | Unclassified | 4064 |
| 78 | Ga0070695_100049712 | 3300005545 | Bacteria | 2685 |
| 79 | Ga0070695_100086954 | 3300005545 | Bacteria | 2078 |
| 80 | Ga0070696_100001067 | 3300005546 | Bacteria | 17730 |
| 81 | Ga0070693_100000202 | 3300005547 | Bacteria | 27944 |
| 82 | Ga0070693_100063772 | 3300005547 | Bacteria | 2149 |
| 83 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 84 | Ga0070704_100255727 | 3300005549 | Bacteria | 1441 |
| 85 | Ga0068855_100000498 | 3300005563 | Bacteria | 48519 |
| 86 | Ga0068855_100068188 | 3300005563 | Bacteria | 4142 |
| 87 | Ga0068855_100081962 | 3300005563 | Unclassified | 3739 |
| 88 | Ga0068855_100090581 | 3300005563 | Archaea | 3529 |
| 89 | Ga0068857_100010038 | 3300005577 | Bacteria | 8224 |
| 90 | Ga0068854_100014171 | 3300005578 | Bacteria | 5248 |
| 91 | Ga0068854_100039495 | 3300005578 | Bacteria | 3325 |
| 92 | Ga0068854_100058842 | 3300005578 | Bacteria | 2776 |
| 93 | Ga0068856_100328320 | 3300005614 | Bacteria | 1547 |
| 94 | Ga0068852_100044537 | 3300005616 | Bacteria | 3769 |
| 95 | Ga0068852_100511830 | 3300005616 | Bacteria | 1197 |
| 96 | Ga0068859_100044888 | 3300005617 | Bacteria | 4441 |
| 97 | Ga0068859_100301494 | 3300005617 | Bacteria | 1696 |
| 98 | Ga0068866_10047022 | 3300005718 | Unclassified | 2173 |
| 99 | Ga0068866_10066464 | 3300005718 | Bacteria | 1889 |
| 100 | Ga0068861_100104460 | 3300005719 | Bacteria | 2260 |
| 101 | Ga0068870_10011700 | 3300005840 | Bacteria | 4079 |
| 102 | Ga0068870_10390113 | 3300005840 | Bacteria | 903 |
| 103 | Ga0068863_100086693 | 3300005841 | Bacteria | 2967 |
| 104 | Ga0068863_100097064 | 3300005841 | Bacteria | 2798 |
| 105 | Ga0068860_100005538 | 3300005843 | Bacteria | 12787 |
| 106 | Ga0068862_100016424 | 3300005844 | Bacteria | 6160 |
| 107 | Ga0081455_10000614 | 3300005937 | Bacteria | 46194 |
| 108 | Ga0070717_10232017 | 3300006028 | Unclassified | 1625 |
| 109 | Ga0070717_10343043 | 3300006028 | Bacteria | 1334 |
| 110 | Ga0070715_10240573 | 3300006163 | Bacteria | 941 |
| 111 | Ga0070716_100000038 | 3300006173 | Bacteria | 52024 |
| 112 | Ga0070716_100253043 | 3300006173 | Unclassified | 1201 |
| 113 | Ga0070712_100013192 | 3300006175 | Bacteria | 5273 |
| 114 | Ga0097621_100000247 | 3300006237 | Bacteria | 36324 |
| 115 | Ga0097621_100000489 | 3300006237 | Bacteria | 27739 |
| 116 | Ga0068871_100000419 | 3300006358 | Bacteria | 29372 |
| 117 | Ga0075431_100081295 | 3300006847 | Bacteria | 3346 |
| 118 | Ga0075431_100128505 | 3300006847 | Bacteria | 2615 |
| 119 | Ga0075431_100138374 | 3300006847 | Bacteria | 2510 |
| 120 | Ga0075433_10156411 | 3300006852 | Bacteria | 2028 |
| 121 | Ga0075433_10359367 | 3300006852 | Bacteria | 1287 |
| 122 | Ga0075434_100014168 | 3300006871 | Bacteria | 7617 |
| 123 | Ga0075434_100283229 | 3300006871 | Bacteria | 1677 |
| 124 | Ga0075434_100310520 | 3300006871 | Bacteria | 1597 |
| 125 | Ga0075434_100319852 | 3300006871 | Bacteria | 1572 |
| 126 | Ga0075434_100326237 | 3300006871 | Bacteria | 1556 |
| 127 | Ga0075429_100111168 | 3300006880 | Bacteria | 2395 |
| 128 | Ga0068865_100000076 | 3300006881 | Bacteria | 51732 |
| 129 | Ga0075436_100001499 | 3300006914 | Bacteria | 15922 |
| 130 | Ga0075436_100006563 | 3300006914 | Bacteria | 7965 |
| 131 | Ga0075436_100039744 | 3300006914 | Bacteria | 3246 |
| 132 | Ga0075436_100107328 | 3300006914 | Bacteria | 1947 |
| 133 | Ga0097620_100044889 | 3300006931 | Bacteria | 4441 |
| 134 | Ga0097620_100301507 | 3300006931 | Bacteria | 1696 |
| 135 | Ga0075435_100026833 | 3300007076 | Bacteria | 4498 |
| 136 | Ga0075435_100320496 | 3300007076 | Bacteria | 1327 |
| 137 | Ga0099794_10000024 | 3300007265 | Bacteria | 62816 |
| 138 | Ga0099794_10008611 | 3300007265 | Bacteria | 4246 |
| 139 | Ga0099794_10019571 | 3300007265 | Bacteria | 3053 |
| 140 | Ga0099794_10022756 | 3300007265 | Bacteria | 2859 |
| 141 | Ga0099794_10025341 | 3300007265 | Bacteria | 2731 |
| 142 | Ga0099794_10034085 | 3300007265 | Bacteria | 2397 |
| 143 | Ga0099794_10038174 | 3300007265 | Bacteria | 2275 |
| 144 | Ga0099794_10156599 | 3300007265 | Bacteria | 1158 |
| 145 | Ga0099794_10180667 | 3300007265 | Unclassified | 1077 |
| 146 | Ga0099795_10052807 | 3300007788 | Bacteria | 1486 |
| 147 | Ga0105240_10019155 | 3300009093 | Bacteria | 9151 |
| 148 | Ga0105240_10107892 | 3300009093 | Unclassified | 3375 |
| 149 | Ga0105240_10127895 | 3300009093 | Bacteria | 3050 |
| 150 | Ga0105240_10166717 | 3300009093 | Bacteria | 2612 |
| 151 | Ga0111539_10036950 | 3300009094 | Bacteria | 5901 |
| 152 | Ga0111539_10087776 | 3300009094 | Bacteria | 3654 |
| 153 | Ga0111539_10242521 | 3300009094 | Bacteria | 2098 |
| 154 | Ga0114129_10000813 | 3300009147 | Bacteria | 40171 |
| 155 | Ga0114129_10497126 | 3300009147 | Bacteria | 1593 |
| 156 | Ga0105243_10088706 | 3300009148 | Bacteria | 2541 |
| 157 | Ga0105243_10221331 | 3300009148 | Bacteria | 1673 |
| 158 | Ga0105241_10010482 | 3300009174 | Bacteria | 6798 |
| 159 | Ga0105241_10399020 | 3300009174 | Bacteria | 1206 |
| 160 | Ga0105242_10003180 | 3300009176 | Bacteria | 12809 |
| 161 | Ga0105242_10009724 | 3300009176 | Bacteria | 7368 |
| 162 | Ga0105242_10197340 | 3300009176 | Bacteria | 1785 |
| 163 | Ga0105248_10038655 | 3300009177 | Bacteria | 5341 |
| 164 | Ga0105248_10131589 | 3300009177 | Bacteria | 2822 |
| 165 | Ga0105248_10150313 | 3300009177 | Bacteria | 2627 |
| 166 | Ga0105248_10873815 | 3300009177 | Bacteria | 1015 |
| 167 | Ga0105237_10002957 | 3300009545 | Bacteria | 20562 |
| 168 | Ga0105237_10320330 | 3300009545 | Bacteria | 1554 |
| 169 | Ga0105238_10010890 | 3300009551 | Bacteria | 9140 |
| 170 | Ga0105238_10095210 | 3300009551 | Bacteria | 2965 |
| 171 | Ga0105239_10218894 | 3300010375 | Unclassified | 2135 |
| 172 | Ga0105239_10327738 | 3300010375 | Bacteria | 1727 |
| 173 | Ga0105246_10406281 | 3300011119 | Bacteria | 1132 |
| 174 | Ga0157374_10001476 | 3300013296 | Bacteria | 19869 |
| 175 | Ga0157374_10529450 | 3300013296 | Bacteria | 1185 |
| 176 | Ga0157378_10000098 | 3300013297 | Bacteria | 81734 |
| 177 | Ga0157378_10035553 | 3300013297 | Bacteria | 4407 |
| 178 | Ga0157378_10452304 | 3300013297 | Unclassified | 1275 |
| 179 | Ga0157378_10528185 | 3300013297 | Bacteria | 1182 |
| 180 | Ga0163162_10000082 | 3300013306 | Bacteria | 86888 |
| 181 | Ga0163162_10001017 | 3300013306 | Bacteria | 26052 |
| 182 | Ga0163162_10151142 | 3300013306 | Bacteria | 2440 |
| 183 | Ga0163162_10501270 | 3300013306 | Bacteria | 1344 |
| 184 | Ga0157372_10029584 | 3300013307 | Bacteria | 5983 |
| 185 | Ga0157372_10494410 | 3300013307 | Bacteria | 1426 |
| 186 | Ga0157375_10000134 | 3300013308 | Bacteria | 73895 |
| 187 | Ga0157375_10054619 | 3300013308 | Bacteria | 3934 |
| 188 | Ga0157375_10776425 | 3300013308 | Bacteria | 1108 |
| 189 | Ga0182008_10040238 | 3300014497 | Bacteria | 2334 |
| 190 | Ga0157379_10002952 | 3300014968 | Bacteria | 14340 |
| 191 | Ga0157376_10001080 | 3300014969 | Bacteria | 17869 |
| 192 | Ga0157376_10030894 | 3300014969 | Bacteria | 4283 |
| 193 | Ga0182006_1022855 | 3300015261 | Bacteria | 2594 |
| 194 | Ga0182007_10005452 | 3300015262 | Bacteria | 5584 |
| 195 | Ga0163161_10027682 | 3300017792 | Bacteria | 4022 |
| 196 | Ga0206350_11503795 | 3300020080 | Unclassified | 2776 |
| 197 | Ga0224712_10000370 | 3300022467 | Bacteria | 8662 |
| 198 | Ga0209784_100147 | 3300025224 | Bacteria | 64246 |
| 199 | Ga0209566_100041 | 3300025225 | Bacteria | 289634 |
| 200 | Ga0209147_100111 | 3300025229 | Bacteria | 145185 |
| 201 | Ga0209025_1030910 | 3300025294 | Bacteria | 2549 |
| 202 | Ga0207653_10002163 | 3300025885 | Bacteria | 6250 |
| 203 | Ga0207653_10055322 | 3300025885 | Bacteria | 1328 |
| 204 | Ga0207692_10038373 | 3300025898 | Bacteria | 2349 |
| 205 | Ga0207642_10025009 | 3300025899 | Unclassified | 2409 |
| 206 | Ga0207699_10000010 | 3300025906 | Bacteria | 295869 |
| 207 | Ga0207699_10117707 | 3300025906 | Bacteria | 1713 |
| 208 | Ga0207699_10167782 | 3300025906 | Bacteria | 1466 |
| 209 | Ga0207645_10002749 | 3300025907 | Bacteria | 13705 |
| 210 | Ga0207643_10054102 | 3300025908 | Bacteria | 2281 |
| 211 | Ga0207684_10000032 | 3300025910 | Bacteria | 293234 |
| 212 | Ga0207684_10001475 | 3300025910 | Bacteria | 25313 |
| 213 | Ga0207684_10002192 | 3300025910 | Bacteria | 19973 |
| 214 | Ga0207684_10005406 | 3300025910 | Bacteria | 11792 |
| 215 | Ga0207684_10034256 | 3300025910 | Bacteria | 4315 |
| 216 | Ga0207684_10045717 | 3300025910 | Bacteria | 3713 |
| 217 | Ga0207654_10047663 | 3300025911 | Bacteria | 2449 |
| 218 | Ga0207654_10505363 | 3300025911 | Bacteria | 854 |
| 219 | Ga0207707_10016957 | 3300025912 | Bacteria | 6346 |
| 220 | Ga0207707_10054064 | 3300025912 | Bacteria | 3495 |
| 221 | Ga0207695_10000623 | 3300025913 | Bacteria | 71205 |
| 222 | Ga0207695_10011350 | 3300025913 | Bacteria | 10798 |
| 223 | Ga0207695_10051622 | 3300025913 | Bacteria | 4315 |
| 224 | Ga0207695_10092308 | 3300025913 | Bacteria | 3038 |
| 225 | Ga0207671_10021841 | 3300025914 | Bacteria | 4849 |
| 226 | Ga0207693_10023573 | 3300025915 | Bacteria | 4886 |
| 227 | Ga0207663_10048036 | 3300025916 | Bacteria | 2639 |
| 228 | Ga0207663_10150591 | 3300025916 | Bacteria | 1632 |
| 229 | Ga0207663_10342544 | 3300025916 | Bacteria | 1129 |
| 230 | Ga0207660_10134143 | 3300025917 | Bacteria | 1887 |
| 231 | Ga0207657_10000254 | 3300025919 | Bacteria | 56893 |
| 232 | Ga0207649_10127806 | 3300025920 | Bacteria | 1722 |
| 233 | Ga0207652_10033183 | 3300025921 | Bacteria | 4346 |
| 234 | Ga0207652_10051345 | 3300025921 | Bacteria | 3535 |
| 235 | Ga0207646_10001054 | 3300025922 | Bacteria | 35091 |
| 236 | Ga0207646_10020112 | 3300025922 | Bacteria | 6191 |
| 237 | Ga0207646_10040310 | 3300025922 | Bacteria | 4200 |
| 238 | Ga0207646_10080253 | 3300025922 | Bacteria | 2917 |
| 239 | Ga0207646_10118161 | 3300025922 | Bacteria | 2382 |
| 240 | Ga0207646_10146696 | 3300025922 | Bacteria | 2126 |
| 241 | Ga0207646_10561518 | 3300025922 | Bacteria | 1026 |
| 242 | Ga0207681_10145239 | 3300025923 | Bacteria | 1772 |
| 243 | Ga0207694_10015358 | 3300025924 | Bacteria | 5776 |
| 244 | Ga0207650_10143063 | 3300025925 | Bacteria | 1882 |
| 245 | Ga0207687_10011430 | 3300025927 | Bacteria | 5802 |
| 246 | Ga0207700_10387784 | 3300025928 | Bacteria | 1222 |
| 247 | Ga0207664_10136954 | 3300025929 | Bacteria | 2067 |
| 248 | Ga0207644_10004058 | 3300025931 | Bacteria | 9499 |
| 249 | Ga0207644_10125271 | 3300025931 | Unclassified | 1960 |
| 250 | Ga0207706_10038032 | 3300025933 | Bacteria | 4270 |
| 251 | Ga0207686_10024021 | 3300025934 | Bacteria | 3526 |
| 252 | Ga0207686_10041185 | 3300025934 | Bacteria | 2815 |
| 253 | Ga0207686_10323645 | 3300025934 | Bacteria | 1153 |
| 254 | Ga0207709_10003833 | 3300025935 | Bacteria | 8817 |
| 255 | Ga0207709_10444109 | 3300025935 | Bacteria | 1001 |
| 256 | Ga0207704_10000189 | 3300025938 | Bacteria | 32372 |
| 257 | Ga0207665_10000115 | 3300025939 | Bacteria | 52837 |
| 258 | Ga0207711_10003267 | 3300025941 | Bacteria | 14112 |
| 259 | Ga0207711_10371127 | 3300025941 | Unclassified | 1327 |
| 260 | Ga0207689_10043734 | 3300025942 | Bacteria | 3702 |
| 261 | Ga0207661_10155218 | 3300025944 | Bacteria | 1982 |
| 262 | Ga0207679_10178861 | 3300025945 | Bacteria | 1753 |
| 263 | Ga0207667_10001774 | 3300025949 | Bacteria | 27165 |
| 264 | Ga0207667_10005697 | 3300025949 | Bacteria | 15190 |
| 265 | Ga0207651_10004706 | 3300025960 | Bacteria | 6929 |
| 266 | Ga0207640_10392251 | 3300025981 | Bacteria | 1128 |
| 267 | Ga0207658_10027376 | 3300025986 | Bacteria | 4004 |
| 268 | Ga0207658_10247374 | 3300025986 | Bacteria | 1514 |
| 269 | Ga0207658_10847230 | 3300025986 | Unclassified | 831 |
| 270 | Ga0207677_10129246 | 3300026023 | Bacteria | 1915 |
| 271 | Ga0207703_10154664 | 3300026035 | Bacteria | 2003 |
| 272 | Ga0207639_10028671 | 3300026041 | Bacteria | 4067 |
| 273 | Ga0207702_10000314 | 3300026078 | Bacteria | 55437 |
| 274 | Ga0207702_10200988 | 3300026078 | Bacteria | 1847 |
| 275 | Ga0207641_10108675 | 3300026088 | Bacteria | 2455 |
| 276 | Ga0207641_10999348 | 3300026088 | Unclassified | 833 |
| 277 | Ga0207648_10034463 | 3300026089 | Unclassified | 4463 |
| 278 | Ga0207648_10434081 | 3300026089 | Bacteria | 1194 |
| 279 | Ga0207674_10010550 | 3300026116 | Bacteria | 10456 |
| 280 | Ga0207674_10080000 | 3300026116 | Bacteria | 3272 |
| 281 | Ga0207675_100281020 | 3300026118 | Bacteria | 1617 |
| 282 | Ga0207683_10027106 | 3300026121 | Bacteria | 4952 |
| 283 | Ga0207698_10075279 | 3300026142 | Bacteria | 2697 |
| 284 | Ga0209588_1000007 | 3300027671 | Bacteria | 183924 |
| 285 | Ga0209588_1000379 | 3300027671 | Bacteria | 11568 |
| 286 | Ga0209588_1005540 | 3300027671 | Bacteria | 3624 |
| 287 | Ga0209588_1020841 | 3300027671 | Bacteria | 2054 |
| 288 | Ga0209588_1035334 | 3300027671 | Bacteria | 1606 |
| 289 | Ga0209588_1038952 | 3300027671 | Bacteria | 1532 |
| 290 | Ga0207428_10038761 | 3300027907 | Bacteria | 3872 |
| 291 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 292 | Ga0268265_10015715 | 3300028380 | Bacteria | 5185 |
| 293 | Ga0268264_10045924 | 3300028381 | Bacteria | 3628 |
| 294 | Ga0265760_10003454 | 3300031090 | Unclassified | 4586 |
| 295 | Ga0265760_10004198 | 3300031090 | Bacteria | 4147 |
| 296 | Ga0307416_100262744 | 3300032002 | Bacteria | 1688 |
| 297 | Ga0307416_100355262 | 3300032002 | Bacteria | 1485 |
| 298 | Ga0307510_10001152 | 3300033180 | Bacteria | 28416 |
| 299 | Ga0316212_1000411 | 3300033547 | Bacteria | 5167 |
| 300 | Ga0373948_0031350 | 3300034817 | Bacteria | 1073 |
| 301 | Ga0373926_0009409 | 3300035083 | Bacteria | 3267 |
| 302 | Ga0373946_0000969 | 3300035171 | Bacteria | 9838 |
| 303 | Ga0373927_0000952 | 3300035695 | Bacteria | 22046 |
| 304 | Ga0373947_0002119 | 3300035725 | Bacteria | 12098 |
| 305 | Ga0373937_0019459 | 3300036401 | Bacteria | 6078 |
| 306 | Ga0373925_0001097 | 3300037068 | Bacteria | 24247 |
| 307 | Ga0373925_0017715 | 3300037068 | Bacteria | 5168 |
| 308 | Ga0373925_0385091 | 3300037068 | Bacteria | 1142 |
| 309 | Ga0395899_0026199 | 3300037312 | Bacteria | 4400 |
| 310 | Ga0395899_0166768 | 3300037312 | Bacteria | 1553 |
| 311 | Ga0395900_0008131 | 3300037418 | Bacteria | 10800 |
| 312 | Ga0395898_0259348 | 3300037466 | Bacteria | 1658 |
| 313 | Ga0395905_0000716 | 3300037471 | Bacteria | 43859 |
| 314 | Ga0395905_0017061 | 3300037471 | Bacteria | 6894 |
| 315 | Ga0395901_0001250 | 3300038443 | Bacteria | 27039 |
| 316 | Ga0436361_0893758 | 3300039447 | Bacteria | 1114 |
| 317 | Ga0436361_1036667 | 3300039447 | Bacteria | 4040 |
| 318 | Ga0439441_007564 | 3300042001 | Bacteria | 1754 |
| 319 | Ga0439448_0010775 | 3300042005 | Bacteria | 2716 |
| 320 | Ga0439449_0117525 | 3300042007 | Bacteria | 986 |
| 321 | Ga0451577_0224176 | 3300042876 | Bacteria | 1699 |
| 322 | Ga0466963_0000098 | 3300044694 | Bacteria | 30946 |
| 323 | Ga0453684_0173165 | 3300044712 | Bacteria | 2541 |
| 324 | Ga0466971_0029283 | 3300044719 | Bacteria | 2463 |
| 325 | Ga0466957_0040445 | 3300044842 | Bacteria | 2816 |
| 326 | Ga0466957_0091134 | 3300044842 | Bacteria | 1910 |
| 327 | Ga0466957_0093853 | 3300044842 | Bacteria | 1884 |
| 328 | Ga0466960_0054063 | 3300044901 | Bacteria | 1948 |
| 329 | Ga0466960_0096700 | 3300044901 | Bacteria | 1514 |
| 330 | Ga0451576_0007766 | 3300045051 | Bacteria | 12726 |
| 331 | Ga0451576_0356065 | 3300045051 | Bacteria | 1532 |
| 332 | Ga0451576_0931500 | 3300045051 | Bacteria | 911 |
| 333 | Ga0466958_0026281 | 3300045836 | Bacteria | 3440 |
| 334 | Ga0466967_0003257 | 3300045976 | Bacteria | 10514 |
| 335 | Ga0466967_0016631 | 3300045976 | Bacteria | 5809 |
| 336 | Ga0466967_0094129 | 3300045976 | Bacteria | 2727 |
| 337 | Ga0466967_0825801 | 3300045976 | Unclassified | 921 |
| 338 | Ga0495653_0221049 | 3300046463 | Unclassified | 1273 |
| 339 | Ga0495580_0005966 | 3300046472 | Bacteria | 9984 |
| 340 | Ga0495582_0073861 | 3300046473 | Bacteria | 1888 |
| 341 | Ga0495630_0026255 | 3300046517 | Bacteria | 4311 |
| 342 | Ga0495666_0028262 | 3300046526 | Bacteria | 2759 |
| 343 | Ga0495652_0186086 | 3300046529 | Unclassified | 1589 |
| 344 | Ga0495640_0108624 | 3300046533 | Bacteria | 1815 |
| 345 | Ga0495586_0091509 | 3300046535 | Bacteria | 1681 |
| 346 | Ga0495658_0032112 | 3300046683 | Bacteria | 2865 |
| 347 | Ga0495674_0429152 | 3300047319 | Unclassified | 1064 |
| 348 | Ga0495683_0056035 | 3300047323 | Bacteria | 1961 |
| 349 | Ga0495684_0175764 | 3300047471 | Bacteria | 1589 |
| 350 | Ga0495602_0016602 | 3300048088 | Bacteria | 7402 |
| 351 | Ga0496101_0006315 | 3300048904 | Bacteria | 7628 |
| 352 | Ga0496101_0166899 | 3300048904 | Bacteria | 1690 |
| 353 | Ga0496102_0078794 | 3300048905 | Bacteria | 3033 |
| 354 | Ga0496102_0510651 | 3300048905 | Bacteria | 1124 |
| 355 | Ga0496104_0056673 | 3300048907 | Bacteria | 3707 |
| 356 | Ga0496104_0059308 | 3300048907 | Unclassified | 3623 |
| 357 | Ga0496105_0490087 | 3300048908 | Bacteria | 966 |
| 358 | Ga0496106_0023601 | 3300048909 | Bacteria | 4569 |
| 359 | Ga0496106_0794828 | 3300048909 | Bacteria | 751 |
| 360 | Ga0496108_0010299 | 3300048911 | Bacteria | 7590 |
| 361 | Ga0496108_0026129 | 3300048911 | Bacteria | 4816 |
| 362 | Ga0496109_0032853 | 3300048912 | Bacteria | 4667 |
| 363 | Ga0496112_0037382 | 3300048915 | Bacteria | 4739 |
| 364 | Ga0496112_0229035 | 3300048915 | Unclassified | 1813 |
| 365 | Ga0496113_0133095 | 3300048916 | Unclassified | 1952 |
| 366 | Ga0496114_0066427 | 3300048917 | Bacteria | 3023 |
| 367 | Ga0496114_0382918 | 3300048917 | Bacteria | 1245 |
| 368 | Ga0496115_0447980 | 3300048918 | Bacteria | 1043 |
| 369 | Ga0496116_0000189 | 3300048919 | Bacteria | 122859 |
| 370 | Ga0496116_0004879 | 3300048919 | Bacteria | 12652 |
| 371 | Ga0496117_0013809 | 3300048920 | Bacteria | 7012 |
| 372 | Ga0496118_0007074 | 3300048921 | Bacteria | 12054 |
| 373 | Ga0496121_0001568 | 3300048924 | Bacteria | 38102 |
| 374 | Ga0496123_0017067 | 3300048926 | Bacteria | 5862 |
| 375 | Ga0496124_0012244 | 3300048927 | Bacteria | 8481 |
| 376 | Ga0496125_0012885 | 3300048928 | Bacteria | 8259 |
| 377 | Ga0496125_0064971 | 3300048928 | Bacteria | 2895 |
| 378 | Ga0496126_0002481 | 3300048929 | Bacteria | 24825 |
| 379 | Ga0501039_0416726 | 3300049575 | Bacteria | 1055 |
| 380 | Ga0501040_0006797 | 3300049576 | Bacteria | 7417 |
| 381 | Ga0501040_0506307 | 3300049576 | Bacteria | 870 |
| 382 | Ga0501041_0119850 | 3300049577 | Bacteria | 1635 |
| 383 | Ga0501046_0033553 | 3300049580 | Bacteria | 4146 |
| 384 | Ga0501046_0118632 | 3300049580 | Bacteria | 2015 |
| 385 | Ga0501048_0382845 | 3300049582 | Bacteria | 1005 |
| 386 | Ga0501067_0001930 | 3300049583 | Bacteria | 11400 |
| 387 | Ga0501067_0056834 | 3300049583 | Bacteria | 2167 |
| 388 | Ga0501069_0163201 | 3300049585 | Bacteria | 1283 |
| 389 | Ga0501070_0323160 | 3300049586 | Bacteria | 1255 |
| 390 | Ga0501072_0239637 | 3300049588 | Bacteria | 1444 |
| 391 | Ga0501072_0580872 | 3300049588 | Bacteria | 884 |
| 392 | Ga0501074_0282089 | 3300049590 | Bacteria | 1181 |
| 393 | Ga0501075_0063704 | 3300049591 | Bacteria | 2780 |
| 394 | Ga0501075_0069212 | 3300049591 | Bacteria | 2667 |
| 395 | Ga0501075_0189997 | 3300049591 | Bacteria | 1566 |
| 396 | Ga0501075_0214213 | 3300049591 | Bacteria | 1469 |
| 397 | Ga0501075_0544867 | 3300049591 | Bacteria | 885 |
| 398 | Ga0501076_0096358 | 3300049592 | Bacteria | 2383 |
| 399 | Ga0501076_0228463 | 3300049592 | Bacteria | 1521 |
| 400 | Ga0501077_0029636 | 3300049593 | Bacteria | 3480 |
| 401 | Ga0501077_0116015 | 3300049593 | Bacteria | 1697 |
| 402 | Ga0501077_0116531 | 3300049593 | Bacteria | 1693 |
| 403 | Ga0501079_0044554 | 3300049741 | Bacteria | 3423 |
| 404 | Ga0501079_0051199 | 3300049741 | Bacteria | 3188 |
| 405 | Ga0501079_0323499 | 3300049741 | Bacteria | 1207 |
| 406 | Ga0501083_0062269 | 3300049744 | Bacteria | 2490 |
| 407 | Ga0501035_0217433 | 3300049822 | Bacteria | 1633 |
| 408 | Ga0501045_0049980 | 3300049824 | Bacteria | 3050 |
| 409 | Ga0501045_0112138 | 3300049824 | Bacteria | 2022 |
| 410 | nmdc:mga05p37_56200_c1 | 3300050507 | Bacteria | 4845 |
| 411 | nmdc:mga05p37_74300_c1 | 3300050507 | Bacteria | 4184 |
| 412 | nmdc:mga09592_130421_c1 | 3300050508 | Bacteria | 2162 |
| 413 | nmdc:mga0qj67_143248_c1 | 3300050509 | Unclassified | 1938 |
| 414 | nmdc:mga0qj67_450762_c1 | 3300050509 | Bacteria | 1036 |
| 415 | nmdc:mga06r32_106674_c1 | 3300050510 | Bacteria | 2752 |
| 416 | nmdc:mga06r32_19964_c1 | 3300050510 | Bacteria | 6160 |
| 417 | nmdc:mga06r32_279547_c1 | 3300050510 | Bacteria | 1656 |
| 418 | nmdc:mga06r32_346261_c1 | 3300050510 | Bacteria | 1471 |
| 419 | nmdc:mga08y16_160048_c1 | 3300050511 | Bacteria | 2339 |
| 420 | nmdc:mga08y16_26800_c1 | 3300050511 | Bacteria | 6073 |
| 421 | nmdc:mga08y16_7197_c1 | 3300050511 | Bacteria | 11674 |
| 422 | nmdc:mga0n895_235826_c1 | 3300050512 | Bacteria | 1857 |
| 423 | nmdc:mga0n895_424896_c1 | 3300050512 | Bacteria | 1343 |
| 424 | nmdc:mga0n895_445845_c1 | 3300050512 | Bacteria | 1307 |
| 425 | nmdc:mga0n895_59916_c1 | 3300050512 | Bacteria | 3756 |
| 426 | nmdc:mga0rr50_288605_c1 | 3300050513 | Bacteria | 1370 |
| 427 | nmdc:mga0rr50_381804_c1 | 3300050513 | Unclassified | 1188 |
| 428 | nmdc:mga0rr50_683070_c1 | 3300050513 | Unclassified | 876 |
| 429 | nmdc:mga0rr50_8492_c1 | 3300050513 | Bacteria | 6398 |
| 430 | nmdc:mga08x19_12512_c1 | 3300050514 | Bacteria | 5114 |
| 431 | nmdc:mga08x19_252780_c1 | 3300050514 | Bacteria | 1217 |
| 432 | nmdc:mga08x19_29323_c1 | 3300050514 | Bacteria | 3451 |
| 433 | nmdc:mga08x19_43187_c1 | 3300050514 | Bacteria | 2876 |
| 434 | nmdc:mga08x19_4919_c1 | 3300050514 | Bacteria | 7889 |
| 435 | nmdc:mga08x19_645_c1 | 3300050514 | Bacteria | 22518 |
| 436 | nmdc:mga0a205_191526_c1 | 3300050515 | Bacteria | 1937 |
| 437 | Ga0501084_0042565 | 3300054114 | Bacteria | 3799 |
| 438 | Ga0501084_0161334 | 3300054114 | Bacteria | 1891 |
| 439 | Ga0501084_0530678 | 3300054114 | Bacteria | 995 |
| 440 | Ga0501082_0064634 | 3300060353 | Bacteria | 3151 |
| 441 | Ga0501082_0230342 | 3300060353 | Bacteria | 1612 |
| 442 | Ga0501082_0326032 | 3300060353 | Bacteria | 1338 |
| 443 | Ga0501082_0526301 | 3300060353 | Bacteria | 1034 |
| 444 | Ga0501082_0605327 | 3300060353 | Bacteria | 959 |
| 445 | Ga0466962_0076911 | 3300061719 | Bacteria | 1595 |
| 446 | Ga0530510_0072122 | 3300061734 | Bacteria | 2507 |
| 447 | Ga0530510_0088688 | 3300061734 | Bacteria | 2255 |
| 448 | Ga0530510_0428567 | 3300061734 | Bacteria | 999 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047319 | Ga0495674_0429152 | Ga0495674_0429152_412_1044 | 209 |
| 2 | 3300037471 | Ga0395905_0017061 | Ga0395905_0017061_790_1422 | 210 |
| 3 | 3300045976 | Ga0466967_0016631 | Ga0466967_0016631_1611_2318 | 215 |
| 4 | 3300044719 | Ga0466971_0029283 | Ga0466971_0029283_1128_1835 | 218 |
| 5 | 3300044842 | Ga0466957_0091134 | Ga0466957_0091134_291_998 | 218 |
| 6 | 3300045976 | Ga0466967_0003257 | Ga0466967_0003257_324_1031 | 218 |
| 7 | 3300006871 | Ga0075434_100014168 | Ga0075434_1000141686 | 220 |
| 8 | 3300007076 | Ga0075435_100026833 | Ga0075435_1000268334 | 220 |
| 9 | 3300025920 | Ga0207649_10127806 | Ga0207649_101278062 | 220 |
| 10 | 3300025945 | Ga0207679_10178861 | Ga0207679_101788612 | 220 |
| 11 | 3300049583 | Ga0501067_0001930 | Ga0501067_0001930_7459_8166 | 220 |
| 12 | 3300049585 | Ga0501069_0163201 | Ga0501069_0163201_509_1216 | 220 |
| 13 | 3300050512 | nmdc:mga0n895_59916_c1 | nmdc:mga0n895_59916_c1_819_1526 | 220 |
| 14 | 3300050513 | nmdc:mga0rr50_8492_c1 | nmdc:mga0rr50_8492_c1_100_807 | 220 |
| 15 | 3300050514 | nmdc:mga08x19_43187_c1 | nmdc:mga08x19_43187_c1_1402_2109 | 220 |
| 16 | 3300061734 | Ga0530510_0072122 | Ga0530510_0072122_907_1614 | 220 |
| 17 | 3300009147 | Ga0114129_10497126 | Ga0114129_104971262 | 223 |
| 18 | 3300048919 | Ga0496116_0004879 | Ga0496116_0004879_2036_2764 | 223 |
| 19 | 3300048928 | Ga0496125_0064971 | Ga0496125_0064971_2114_2842 | 223 |
| 20 | 3300050507 | nmdc:mga05p37_56200_c1 | nmdc:mga05p37_56200_c1_1507_2184 | 223 |
| 21 | 3300005335 | Ga0070666_10175325 | Ga0070666_101753252 | 229 |
| 22 | 3300005355 | Ga0070671_100006354 | Ga0070671_1000063548 | 229 |
| 23 | 3300005367 | Ga0070667_100008627 | Ga0070667_1000086274 | 229 |
| 24 | 3300005841 | Ga0068863_100097064 | Ga0068863_1000970642 | 229 |
| 25 | 3300006237 | Ga0097621_100000489 | Ga0097621_1000004898 | 229 |
| 26 | 3300006358 | Ga0068871_100000419 | Ga0068871_10000041914 | 229 |
| 27 | 3300009176 | Ga0105242_10197340 | Ga0105242_101973402 | 229 |
| 28 | 3300009177 | Ga0105248_10131589 | Ga0105248_101315892 | 229 |
| 29 | 3300013297 | Ga0157378_10452304 | Ga0157378_104523042 | 229 |
| 30 | 3300013306 | Ga0163162_10001017 | Ga0163162_1000101710 | 229 |
| 31 | 3300013308 | Ga0157375_10000134 | Ga0157375_1000013448 | 229 |
| 32 | 3300014968 | Ga0157379_10002952 | Ga0157379_100029525 | 229 |
| 33 | 3300014969 | Ga0157376_10001080 | Ga0157376_100010806 | 229 |
| 34 | 3300017792 | Ga0163161_10027682 | Ga0163161_100276822 | 229 |
| 35 | 3300025899 | Ga0207642_10025009 | Ga0207642_100250091 | 229 |
| 36 | 3300025931 | Ga0207644_10004058 | Ga0207644_100040589 | 229 |
| 37 | 3300025934 | Ga0207686_10323645 | Ga0207686_103236452 | 229 |
| 38 | 3300025941 | Ga0207711_10371127 | Ga0207711_103711272 | 229 |
| 39 | 3300025986 | Ga0207658_10027376 | Ga0207658_100273764 | 229 |
| 40 | 3300026088 | Ga0207641_10108675 | Ga0207641_101086752 | 229 |
| 41 | 3300048904 | Ga0496101_0006315 | Ga0496101_0006315_6147_6839 | 229 |
| 42 | 3300048909 | Ga0496106_0794828 | Ga0496106_0794828_16_708 | 229 |
| 43 | 3300048917 | Ga0496114_0382918 | Ga0496114_0382918_322_1014 | 229 |
| 44 | 3300037418 | Ga0395900_0008131 | Ga0395900_0008131_8650_9348 | 232 |
| 45 | 3300037466 | Ga0395898_0259348 | Ga0395898_0259348_365_1063 | 232 |
| 46 | 3300037471 | Ga0395905_0000716 | Ga0395905_0000716_40158_40856 | 232 |
| 47 | 3300038443 | Ga0395901_0001250 | Ga0395901_0001250_22528_23226 | 232 |
| 48 | 3300002077 | JGI24744J21845_10003244 | JGI24744J21845_100032446 | 233 |
| 49 | 3300005328 | Ga0070676_10000619 | Ga0070676_1000061914 | 233 |
| 50 | 3300005338 | Ga0068868_100019537 | Ga0068868_1000195371 | 233 |
| 51 | 3300005354 | Ga0070675_100309106 | Ga0070675_1003091063 | 233 |
| 52 | 3300005364 | Ga0070673_100007135 | Ga0070673_1000071356 | 233 |
| 53 | 3300005459 | Ga0068867_100007963 | Ga0068867_1000079637 | 233 |
| 54 | 3300005539 | Ga0068853_100021383 | Ga0068853_1000213835 | 233 |
| 55 | 3300005544 | Ga0070686_100032952 | Ga0070686_1000329523 | 233 |
| 56 | 3300005548 | Ga0070665_100000010 | Ga0070665_100000010282 | 233 |
| 57 | 3300005563 | Ga0068855_100068188 | Ga0068855_1000681885 | 233 |
| 58 | 3300005616 | Ga0068852_100044537 | Ga0068852_1000445373 | 233 |
| 59 | 3300005718 | Ga0068866_10066464 | Ga0068866_100664641 | 233 |
| 60 | 3300005840 | Ga0068870_10390113 | Ga0068870_103901131 | 233 |
| 61 | 3300006237 | Ga0097621_100000247 | Ga0097621_10000024737 | 233 |
| 62 | 3300006881 | Ga0068865_100000076 | Ga0068865_10000007639 | 233 |
| 63 | 3300007265 | Ga0099794_10019571 | Ga0099794_100195712 | 233 |
| 64 | 3300007265 | Ga0099794_10022756 | Ga0099794_100227564 | 233 |
| 65 | 3300007788 | Ga0099795_10052807 | Ga0099795_100528072 | 233 |
| 66 | 3300009093 | Ga0105240_10107892 | Ga0105240_101078922 | 233 |
| 67 | 3300009093 | Ga0105240_10127895 | Ga0105240_101278952 | 233 |
| 68 | 3300009094 | Ga0111539_10036950 | Ga0111539_100369505 | 233 |
| 69 | 3300009148 | Ga0105243_10088706 | Ga0105243_100887062 | 233 |
| 70 | 3300009174 | Ga0105241_10010482 | Ga0105241_100104826 | 233 |
| 71 | 3300009174 | Ga0105241_10399020 | Ga0105241_103990202 | 233 |
| 72 | 3300009176 | Ga0105242_10003180 | Ga0105242_1000318014 | 233 |
| 73 | 3300009177 | Ga0105248_10150313 | Ga0105248_101503132 | 233 |
| 74 | 3300009545 | Ga0105237_10002957 | Ga0105237_1000295720 | 233 |
| 75 | 3300009551 | Ga0105238_10010890 | Ga0105238_1001089010 | 233 |
| 76 | 3300009551 | Ga0105238_10095210 | Ga0105238_100952103 | 233 |
| 77 | 3300010375 | Ga0105239_10218894 | Ga0105239_102188942 | 233 |
| 78 | 3300011119 | Ga0105246_10406281 | Ga0105246_104062811 | 233 |
| 79 | 3300013296 | Ga0157374_10001476 | Ga0157374_1000147619 | 233 |
| 80 | 3300013297 | Ga0157378_10000098 | Ga0157378_100000986 | 233 |
| 81 | 3300013297 | Ga0157378_10035553 | Ga0157378_100355533 | 233 |
| 82 | 3300013297 | Ga0157378_10528185 | Ga0157378_105281852 | 233 |
| 83 | 3300013306 | Ga0163162_10000082 | Ga0163162_1000008212 | 233 |
| 84 | 3300013306 | Ga0163162_10151142 | Ga0163162_101511422 | 233 |
| 85 | 3300013306 | Ga0163162_10501270 | Ga0163162_105012701 | 233 |
| 86 | 3300013307 | Ga0157372_10029584 | Ga0157372_100295844 | 233 |
| 87 | 3300013308 | Ga0157375_10054619 | Ga0157375_100546193 | 233 |
| 88 | 3300014497 | Ga0182008_10040238 | Ga0182008_100402382 | 233 |
| 89 | 3300014969 | Ga0157376_10030894 | Ga0157376_100308943 | 233 |
| 90 | 3300015261 | Ga0182006_1022855 | Ga0182006_10228552 | 233 |
| 91 | 3300015262 | Ga0182007_10005452 | Ga0182007_100054522 | 233 |
| 92 | 3300025907 | Ga0207645_10002749 | Ga0207645_100027493 | 233 |
| 93 | 3300025911 | Ga0207654_10047663 | Ga0207654_100476633 | 233 |
| 94 | 3300025913 | Ga0207695_10092308 | Ga0207695_100923083 | 233 |
| 95 | 3300025914 | Ga0207671_10021841 | Ga0207671_100218414 | 233 |
| 96 | 3300025924 | Ga0207694_10015358 | Ga0207694_100153584 | 233 |
| 97 | 3300025931 | Ga0207644_10125271 | Ga0207644_101252713 | 233 |
| 98 | 3300025934 | Ga0207686_10041185 | Ga0207686_100411852 | 233 |
| 99 | 3300025938 | Ga0207704_10000189 | Ga0207704_100001894 | 233 |
| 100 | 3300025949 | Ga0207667_10005697 | Ga0207667_1000569712 | 233 |
| 101 | 3300025960 | Ga0207651_10004706 | Ga0207651_100047066 | 233 |
| 102 | 3300025986 | Ga0207658_10847230 | Ga0207658_108472301 | 233 |
| 103 | 3300026041 | Ga0207639_10028671 | Ga0207639_100286715 | 233 |
| 104 | 3300026088 | Ga0207641_10999348 | Ga0207641_109993481 | 233 |
| 105 | 3300026089 | Ga0207648_10034463 | Ga0207648_100344633 | 233 |
| 106 | 3300026121 | Ga0207683_10027106 | Ga0207683_100271066 | 233 |
| 107 | 3300028379 | Ga0268266_10000032 | Ga0268266_10000032294 | 233 |
| 108 | 3300033180 | Ga0307510_10001152 | Ga0307510_1000115214 | 233 |
| 109 | 3300042005 | Ga0439448_0010775 | Ga0439448_0010775_1202_1903 | 233 |
| 110 | 3300047323 | Ga0495683_0056035 | Ga0495683_0056035_486_1187 | 233 |
| 111 | 3300048905 | Ga0496102_0078794 | Ga0496102_0078794_1418_2131 | 233 |
| 112 | 3300048907 | Ga0496104_0059308 | Ga0496104_0059308_2100_2831 | 233 |
| 113 | 3300048908 | Ga0496105_0490087 | Ga0496105_0490087_102_833 | 233 |
| 114 | 3300048909 | Ga0496106_0023601 | Ga0496106_0023601_3001_3714 | 233 |
| 115 | 3300048911 | Ga0496108_0026129 | Ga0496108_0026129_2392_3123 | 233 |
| 116 | 3300048915 | Ga0496112_0229035 | Ga0496112_0229035_900_1613 | 233 |
| 117 | 3300048916 | Ga0496113_0133095 | Ga0496113_0133095_653_1384 | 233 |
| 118 | 3300049576 | Ga0501040_0006797 | Ga0501040_0006797_4919_5635 | 233 |
| 119 | 3300050509 | nmdc:mga0qj67_143248_c1 | nmdc:mga0qj67_143248_c1_1144_1863 | 233 |
| 120 | 3300050510 | nmdc:mga06r32_19964_c1 | nmdc:mga06r32_19964_c1_2007_2726 | 233 |
| 121 | 3300050511 | nmdc:mga08y16_160048_c1 | nmdc:mga08y16_160048_c1_291_1010 | 233 |
| 122 | 3300054114 | Ga0501084_0530678 | Ga0501084_0530678_158_874 | 233 |
| 123 | 3300005329 | Ga0070683_100101853 | Ga0070683_1001018531 | 234 |
| 124 | 3300005338 | Ga0068868_100116604 | Ga0068868_1001166042 | 234 |
| 125 | 3300005435 | Ga0070714_100076396 | Ga0070714_1000763961 | 234 |
| 126 | 3300005439 | Ga0070711_100130101 | Ga0070711_1001301012 | 234 |
| 127 | 3300005458 | Ga0070681_10087352 | Ga0070681_100873523 | 234 |
| 128 | 3300005530 | Ga0070679_100041420 | Ga0070679_1000414203 | 234 |
| 129 | 3300005539 | Ga0068853_100187186 | Ga0068853_1001871862 | 234 |
| 130 | 3300005563 | Ga0068855_100081962 | Ga0068855_1000819627 | 234 |
| 131 | 3300005578 | Ga0068854_100039495 | Ga0068854_1000394953 | 234 |
| 132 | 3300005578 | Ga0068854_100058842 | Ga0068854_1000588422 | 234 |
| 133 | 3300006163 | Ga0070715_10240573 | Ga0070715_102405732 | 234 |
| 134 | 3300006175 | Ga0070712_100013192 | Ga0070712_1000131922 | 234 |
| 135 | 3300009093 | Ga0105240_10019155 | Ga0105240_1001915512 | 234 |
| 136 | 3300009093 | Ga0105240_10166717 | Ga0105240_101667172 | 234 |
| 137 | 3300009177 | Ga0105248_10873815 | Ga0105248_108738152 | 234 |
| 138 | 3300009545 | Ga0105237_10320330 | Ga0105237_103203303 | 234 |
| 139 | 3300010375 | Ga0105239_10327738 | Ga0105239_103277382 | 234 |
| 140 | 3300013296 | Ga0157374_10529450 | Ga0157374_105294501 | 234 |
| 141 | 3300013307 | Ga0157372_10494410 | Ga0157372_104944102 | 234 |
| 142 | 3300025898 | Ga0207692_10038373 | Ga0207692_100383732 | 234 |
| 143 | 3300025911 | Ga0207654_10505363 | Ga0207654_105053631 | 234 |
| 144 | 3300025912 | Ga0207707_10016957 | Ga0207707_100169577 | 234 |
| 145 | 3300025913 | Ga0207695_10011350 | Ga0207695_1001135012 | 234 |
| 146 | 3300025913 | Ga0207695_10051622 | Ga0207695_100516221 | 234 |
| 147 | 3300025915 | Ga0207693_10023573 | Ga0207693_100235734 | 234 |
| 148 | 3300025916 | Ga0207663_10048036 | Ga0207663_100480363 | 234 |
| 149 | 3300025921 | Ga0207652_10051345 | Ga0207652_100513451 | 234 |
| 150 | 3300025927 | Ga0207687_10011430 | Ga0207687_100114305 | 234 |
| 151 | 3300025929 | Ga0207664_10136954 | Ga0207664_101369542 | 234 |
| 152 | 3300025981 | Ga0207640_10392251 | Ga0207640_103922512 | 234 |
| 153 | 3300026023 | Ga0207677_10129246 | Ga0207677_101292462 | 234 |
| 154 | 3300026078 | Ga0207702_10200988 | Ga0207702_102009883 | 234 |
| 155 | 3300026142 | Ga0207698_10075279 | Ga0207698_100752792 | 234 |
| 156 | 3300044694 | Ga0466963_0000098 | Ga0466963_0000098_700_1407 | 234 |
| 157 | 3300044842 | Ga0466957_0040445 | Ga0466957_0040445_517_1224 | 234 |
| 158 | 3300044842 | Ga0466957_0093853 | Ga0466957_0093853_725_1432 | 234 |
| 159 | 3300044901 | Ga0466960_0054063 | Ga0466960_0054063_357_1064 | 234 |
| 160 | 3300044901 | Ga0466960_0096700 | Ga0466960_0096700_195_902 | 234 |
| 161 | 3300045836 | Ga0466958_0026281 | Ga0466958_0026281_545_1252 | 234 |
| 162 | 3300045976 | Ga0466967_0094129 | Ga0466967_0094129_1040_1747 | 234 |
| 163 | 3300046529 | Ga0495652_0186086 | Ga0495652_0186086_128_835 | 234 |
| 164 | 3300046533 | Ga0495640_0108624 | Ga0495640_0108624_607_1314 | 234 |
| 165 | 3300048904 | Ga0496101_0166899 | Ga0496101_0166899_425_1132 | 234 |
| 166 | 3300048905 | Ga0496102_0510651 | Ga0496102_0510651_223_930 | 234 |
| 167 | 3300048907 | Ga0496104_0056673 | Ga0496104_0056673_1406_2113 | 234 |
| 168 | 3300048911 | Ga0496108_0010299 | Ga0496108_0010299_3247_3954 | 234 |
| 169 | 3300048912 | Ga0496109_0032853 | Ga0496109_0032853_583_1290 | 234 |
| 170 | 3300048915 | Ga0496112_0037382 | Ga0496112_0037382_843_1550 | 234 |
| 171 | 3300048917 | Ga0496114_0066427 | Ga0496114_0066427_1369_2076 | 234 |
| 172 | 3300048918 | Ga0496115_0447980 | Ga0496115_0447980_300_1007 | 234 |
| 173 | 3300049586 | Ga0501070_0323160 | Ga0501070_0323160_21_728 | 234 |
| 174 | 3300061719 | Ga0466962_0076911 | Ga0466962_0076911_541_1248 | 234 |
| 175 | 3300005458 | Ga0070681_10181981 | Ga0070681_101819811 | 235 |
| 176 | 3300005563 | Ga0068855_100000498 | Ga0068855_10000049846 | 235 |
| 177 | 3300025949 | Ga0207667_10001774 | Ga0207667_100017744 | 235 |
| 178 | 3300026078 | Ga0207702_10000314 | Ga0207702_1000031428 | 235 |
| 179 | 3300049588 | Ga0501072_0580872 | Ga0501072_0580872_104_820 | 235 |
| 180 | 3300049591 | Ga0501075_0544867 | Ga0501075_0544867_42_758 | 235 |
| 181 | 3300049824 | Ga0501045_0049980 | Ga0501045_0049980_2026_2751 | 235 |
| 182 | 3300060353 | Ga0501082_0326032 | Ga0501082_0326032_60_776 | 235 |
| 183 | 2162886012 | MBSR1b_contig_5305914 | MBSR1b_0655.00003590 | 236 |
| 184 | 3300005293 | Ga0065715_10134717 | Ga0065715_101347173 | 236 |
| 185 | 3300005327 | Ga0070658_10051737 | Ga0070658_100517373 | 236 |
| 186 | 3300005329 | Ga0070683_100196908 | Ga0070683_1001969083 | 236 |
| 187 | 3300005334 | Ga0068869_100019015 | Ga0068869_1000190154 | 236 |
| 188 | 3300005336 | Ga0070680_100132565 | Ga0070680_1001325652 | 236 |
| 189 | 3300005339 | Ga0070660_100116205 | Ga0070660_1001162051 | 236 |
| 190 | 3300005344 | Ga0070661_100083642 | Ga0070661_1000836423 | 236 |
| 191 | 3300005345 | Ga0070692_10052401 | Ga0070692_100524011 | 236 |
| 192 | 3300005353 | Ga0070669_100132987 | Ga0070669_1001329873 | 236 |
| 193 | 3300005366 | Ga0070659_100041895 | Ga0070659_1000418953 | 236 |
| 194 | 3300005406 | Ga0070703_10088170 | Ga0070703_100881702 | 236 |
| 195 | 3300005434 | Ga0070709_10000103 | Ga0070709_1000010325 | 236 |
| 196 | 3300005434 | Ga0070709_10034804 | Ga0070709_100348043 | 236 |
| 197 | 3300005436 | Ga0070713_100014552 | Ga0070713_1000145527 | 236 |
| 198 | 3300005436 | Ga0070713_100102199 | Ga0070713_1001021992 | 236 |
| 199 | 3300005436 | Ga0070713_100124330 | Ga0070713_1001243302 | 236 |
| 200 | 3300005444 | Ga0070694_100157141 | Ga0070694_1001571412 | 236 |
| 201 | 3300005445 | Ga0070708_100001533 | Ga0070708_1000015333 | 236 |
| 202 | 3300005445 | Ga0070708_100001851 | Ga0070708_10000185118 | 236 |
| 203 | 3300005445 | Ga0070708_100030962 | Ga0070708_1000309623 | 236 |
| 204 | 3300005445 | Ga0070708_100650092 | Ga0070708_1006500922 | 236 |
| 205 | 3300005445 | Ga0070708_100741111 | Ga0070708_1007411111 | 236 |
| 206 | 3300005457 | Ga0070662_100005626 | Ga0070662_1000056262 | 236 |
| 207 | 3300005458 | Ga0070681_10126006 | Ga0070681_101260062 | 236 |
| 208 | 3300005459 | Ga0068867_100100516 | Ga0068867_1001005163 | 236 |
| 209 | 3300005467 | Ga0070706_100000003 | Ga0070706_100000003186 | 236 |
| 210 | 3300005467 | Ga0070706_100001737 | Ga0070706_10000173719 | 236 |
| 211 | 3300005467 | Ga0070706_100117989 | Ga0070706_1001179891 | 236 |
| 212 | 3300005467 | Ga0070706_100149388 | Ga0070706_1001493883 | 236 |
| 213 | 3300005467 | Ga0070706_100310707 | Ga0070706_1003107072 | 236 |
| 214 | 3300005468 | Ga0070707_100006616 | Ga0070707_1000066163 | 236 |
| 215 | 3300005468 | Ga0070707_100007093 | Ga0070707_1000070939 | 236 |
| 216 | 3300005468 | Ga0070707_100008529 | Ga0070707_1000085294 | 236 |
| 217 | 3300005468 | Ga0070707_100089024 | Ga0070707_1000890243 | 236 |
| 218 | 3300005468 | Ga0070707_100189515 | Ga0070707_1001895153 | 236 |
| 219 | 3300005468 | Ga0070707_100338456 | Ga0070707_1003384561 | 236 |
| 220 | 3300005471 | Ga0070698_100008343 | Ga0070698_10000834311 | 236 |
| 221 | 3300005471 | Ga0070698_100025761 | Ga0070698_1000257616 | 236 |
| 222 | 3300005471 | Ga0070698_100048778 | Ga0070698_1000487783 | 236 |
| 223 | 3300005471 | Ga0070698_100171452 | Ga0070698_1001714522 | 236 |
| 224 | 3300005471 | Ga0070698_100301285 | Ga0070698_1003012853 | 236 |
| 225 | 3300005518 | Ga0070699_100006289 | Ga0070699_1000062897 | 236 |
| 226 | 3300005518 | Ga0070699_100017797 | Ga0070699_1000177977 | 236 |
| 227 | 3300005518 | Ga0070699_100056848 | Ga0070699_1000568482 | 236 |
| 228 | 3300005518 | Ga0070699_100073066 | Ga0070699_1000730662 | 236 |
| 229 | 3300005518 | Ga0070699_100290657 | Ga0070699_1002906572 | 236 |
| 230 | 3300005530 | Ga0070679_100013169 | Ga0070679_1000131693 | 236 |
| 231 | 3300005535 | Ga0070684_100199728 | Ga0070684_1001997282 | 236 |
| 232 | 3300005536 | Ga0070697_100002968 | Ga0070697_1000029688 | 236 |
| 233 | 3300005536 | Ga0070697_100005220 | Ga0070697_1000052209 | 236 |
| 234 | 3300005536 | Ga0070697_100005819 | Ga0070697_1000058198 | 236 |
| 235 | 3300005536 | Ga0070697_100033336 | Ga0070697_1000333363 | 236 |
| 236 | 3300005536 | Ga0070697_100180195 | Ga0070697_1001801953 | 236 |
| 237 | 3300005536 | Ga0070697_100325232 | Ga0070697_1003252322 | 236 |
| 238 | 3300005539 | Ga0068853_100208085 | Ga0068853_1002080852 | 236 |
| 239 | 3300005545 | Ga0070695_100001936 | Ga0070695_1000019369 | 236 |
| 240 | 3300005545 | Ga0070695_100020213 | Ga0070695_1000202135 | 236 |
| 241 | 3300005545 | Ga0070695_100049712 | Ga0070695_1000497121 | 236 |
| 242 | 3300005545 | Ga0070695_100086954 | Ga0070695_1000869541 | 236 |
| 243 | 3300005546 | Ga0070696_100001067 | Ga0070696_1000010677 | 236 |
| 244 | 3300005547 | Ga0070693_100000202 | Ga0070693_10000020218 | 236 |
| 245 | 3300005547 | Ga0070693_100063772 | Ga0070693_1000637721 | 236 |
| 246 | 3300005549 | Ga0070704_100255727 | Ga0070704_1002557272 | 236 |
| 247 | 3300005563 | Ga0068855_100090581 | Ga0068855_1000905813 | 236 |
| 248 | 3300005577 | Ga0068857_100010038 | Ga0068857_1000100389 | 236 |
| 249 | 3300005578 | Ga0068854_100014171 | Ga0068854_1000141714 | 236 |
| 250 | 3300005614 | Ga0068856_100328320 | Ga0068856_1003283202 | 236 |
| 251 | 3300005616 | Ga0068852_100511830 | Ga0068852_1005118302 | 236 |
| 252 | 3300005617 | Ga0068859_100044888 | Ga0068859_1000448884 | 236 |
| 253 | 3300005617 | Ga0068859_100301494 | Ga0068859_1003014942 | 236 |
| 254 | 3300005718 | Ga0068866_10047022 | Ga0068866_100470222 | 236 |
| 255 | 3300005719 | Ga0068861_100104460 | Ga0068861_1001044602 | 236 |
| 256 | 3300005840 | Ga0068870_10011700 | Ga0068870_100117002 | 236 |
| 257 | 3300005841 | Ga0068863_100086693 | Ga0068863_1000866931 | 236 |
| 258 | 3300005843 | Ga0068860_100005538 | Ga0068860_1000055385 | 236 |
| 259 | 3300005844 | Ga0068862_100016424 | Ga0068862_1000164249 | 236 |
| 260 | 3300005937 | Ga0081455_10000614 | Ga0081455_100006143 | 236 |
| 261 | 3300006028 | Ga0070717_10232017 | Ga0070717_102320171 | 236 |
| 262 | 3300006028 | Ga0070717_10343043 | Ga0070717_103430432 | 236 |
| 263 | 3300006173 | Ga0070716_100000038 | Ga0070716_10000003842 | 236 |
| 264 | 3300006173 | Ga0070716_100253043 | Ga0070716_1002530431 | 236 |
| 265 | 3300006847 | Ga0075431_100081295 | Ga0075431_1000812954 | 236 |
| 266 | 3300006847 | Ga0075431_100128505 | Ga0075431_1001285052 | 236 |
| 267 | 3300006847 | Ga0075431_100138374 | Ga0075431_1001383742 | 236 |
| 268 | 3300006852 | Ga0075433_10156411 | Ga0075433_101564113 | 236 |
| 269 | 3300006852 | Ga0075433_10359367 | Ga0075433_103593672 | 236 |
| 270 | 3300006871 | Ga0075434_100283229 | Ga0075434_1002832292 | 236 |
| 271 | 3300006871 | Ga0075434_100310520 | Ga0075434_1003105202 | 236 |
| 272 | 3300006871 | Ga0075434_100319852 | Ga0075434_1003198522 | 236 |
| 273 | 3300006871 | Ga0075434_100326237 | Ga0075434_1003262372 | 236 |
| 274 | 3300006880 | Ga0075429_100111168 | Ga0075429_1001111682 | 236 |
| 275 | 3300006914 | Ga0075436_100001499 | Ga0075436_1000014994 | 236 |
| 276 | 3300006914 | Ga0075436_100006563 | Ga0075436_1000065633 | 236 |
| 277 | 3300006914 | Ga0075436_100039744 | Ga0075436_1000397443 | 236 |
| 278 | 3300006914 | Ga0075436_100107328 | Ga0075436_1001073282 | 236 |
| 279 | 3300006931 | Ga0097620_100044889 | Ga0097620_1000448893 | 236 |
| 280 | 3300006931 | Ga0097620_100301507 | Ga0097620_1003015072 | 236 |
| 281 | 3300007076 | Ga0075435_100320496 | Ga0075435_1003204963 | 236 |
| 282 | 3300007265 | Ga0099794_10000024 | Ga0099794_1000002455 | 236 |
| 283 | 3300007265 | Ga0099794_10008611 | Ga0099794_100086112 | 236 |
| 284 | 3300007265 | Ga0099794_10025341 | Ga0099794_100253412 | 236 |
| 285 | 3300007265 | Ga0099794_10034085 | Ga0099794_100340854 | 236 |
| 286 | 3300007265 | Ga0099794_10038174 | Ga0099794_100381742 | 236 |
| 287 | 3300007265 | Ga0099794_10156599 | Ga0099794_101565992 | 236 |
| 288 | 3300007265 | Ga0099794_10180667 | Ga0099794_101806671 | 236 |
| 289 | 3300009094 | Ga0111539_10087776 | Ga0111539_100877763 | 236 |
| 290 | 3300009094 | Ga0111539_10242521 | Ga0111539_102425212 | 236 |
| 291 | 3300009147 | Ga0114129_10000813 | Ga0114129_1000081335 | 236 |
| 292 | 3300009148 | Ga0105243_10221331 | Ga0105243_102213312 | 236 |
| 293 | 3300009176 | Ga0105242_10009724 | Ga0105242_100097247 | 236 |
| 294 | 3300009177 | Ga0105248_10038655 | Ga0105248_100386552 | 236 |
| 295 | 3300013308 | Ga0157375_10776425 | Ga0157375_107764252 | 236 |
| 296 | 3300020080 | Ga0206350_11503795 | Ga0206350_115037952 | 236 |
| 297 | 3300022467 | Ga0224712_10000370 | Ga0224712_100003709 | 236 |
| 298 | 3300025224 | Ga0209784_100147 | Ga0209784_10014710 | 236 |
| 299 | 3300025225 | Ga0209566_100041 | Ga0209566_100041157 | 236 |
| 300 | 3300025229 | Ga0209147_100111 | Ga0209147_10011137 | 236 |
| 301 | 3300025294 | Ga0209025_1030910 | Ga0209025_10309102 | 236 |
| 302 | 3300025885 | Ga0207653_10002163 | Ga0207653_100021633 | 236 |
| 303 | 3300025885 | Ga0207653_10055322 | Ga0207653_100553222 | 236 |
| 304 | 3300025906 | Ga0207699_10000010 | Ga0207699_1000001043 | 236 |
| 305 | 3300025906 | Ga0207699_10117707 | Ga0207699_101177071 | 236 |
| 306 | 3300025906 | Ga0207699_10167782 | Ga0207699_101677821 | 236 |
| 307 | 3300025908 | Ga0207643_10054102 | Ga0207643_100541024 | 236 |
| 308 | 3300025910 | Ga0207684_10000032 | Ga0207684_10000032193 | 236 |
| 309 | 3300025910 | Ga0207684_10001475 | Ga0207684_1000147510 | 236 |
| 310 | 3300025910 | Ga0207684_10002192 | Ga0207684_1000219211 | 236 |
| 311 | 3300025910 | Ga0207684_10005406 | Ga0207684_100054069 | 236 |
| 312 | 3300025910 | Ga0207684_10034256 | Ga0207684_100342562 | 236 |
| 313 | 3300025910 | Ga0207684_10045717 | Ga0207684_100457172 | 236 |
| 314 | 3300025912 | Ga0207707_10054064 | Ga0207707_100540642 | 236 |
| 315 | 3300025913 | Ga0207695_10000623 | Ga0207695_1000062320 | 236 |
| 316 | 3300025916 | Ga0207663_10150591 | Ga0207663_101505912 | 236 |
| 317 | 3300025916 | Ga0207663_10342544 | Ga0207663_103425442 | 236 |
| 318 | 3300025917 | Ga0207660_10134143 | Ga0207660_101341431 | 236 |
| 319 | 3300025919 | Ga0207657_10000254 | Ga0207657_100002549 | 236 |
| 320 | 3300025921 | Ga0207652_10033183 | Ga0207652_100331833 | 236 |
| 321 | 3300025922 | Ga0207646_10001054 | Ga0207646_100010541 | 236 |
| 322 | 3300025922 | Ga0207646_10020112 | Ga0207646_100201121 | 236 |
| 323 | 3300025922 | Ga0207646_10040310 | Ga0207646_100403102 | 236 |
| 324 | 3300025922 | Ga0207646_10080253 | Ga0207646_100802532 | 236 |
| 325 | 3300025922 | Ga0207646_10118161 | Ga0207646_101181612 | 236 |
| 326 | 3300025922 | Ga0207646_10146696 | Ga0207646_101466962 | 236 |
| 327 | 3300025922 | Ga0207646_10561518 | Ga0207646_105615182 | 236 |
| 328 | 3300025923 | Ga0207681_10145239 | Ga0207681_101452392 | 236 |
| 329 | 3300025925 | Ga0207650_10143063 | Ga0207650_101430632 | 236 |
| 330 | 3300025928 | Ga0207700_10387784 | Ga0207700_103877842 | 236 |
| 331 | 3300025933 | Ga0207706_10038032 | Ga0207706_100380322 | 236 |
| 332 | 3300025934 | Ga0207686_10024021 | Ga0207686_100240214 | 236 |
| 333 | 3300025935 | Ga0207709_10003833 | Ga0207709_100038338 | 236 |
| 334 | 3300025935 | Ga0207709_10444109 | Ga0207709_104441092 | 236 |
| 335 | 3300025939 | Ga0207665_10000115 | Ga0207665_1000011520 | 236 |
| 336 | 3300025941 | Ga0207711_10003267 | Ga0207711_100032677 | 236 |
| 337 | 3300025942 | Ga0207689_10043734 | Ga0207689_100437344 | 236 |
| 338 | 3300025944 | Ga0207661_10155218 | Ga0207661_101552182 | 236 |
| 339 | 3300025986 | Ga0207658_10247374 | Ga0207658_102473742 | 236 |
| 340 | 3300026035 | Ga0207703_10154664 | Ga0207703_101546642 | 236 |
| 341 | 3300026089 | Ga0207648_10434081 | Ga0207648_104340812 | 236 |
| 342 | 3300026116 | Ga0207674_10010550 | Ga0207674_100105503 | 236 |
| 343 | 3300026116 | Ga0207674_10080000 | Ga0207674_100800002 | 236 |
| 344 | 3300026118 | Ga0207675_100281020 | Ga0207675_1002810202 | 236 |
| 345 | 3300027671 | Ga0209588_1000007 | Ga0209588_1000007143 | 236 |
| 346 | 3300027671 | Ga0209588_1000379 | Ga0209588_10003795 | 236 |
| 347 | 3300027671 | Ga0209588_1005540 | Ga0209588_10055402 | 236 |
| 348 | 3300027671 | Ga0209588_1020841 | Ga0209588_10208412 | 236 |
| 349 | 3300027671 | Ga0209588_1035334 | Ga0209588_10353342 | 236 |
| 350 | 3300027671 | Ga0209588_1038952 | Ga0209588_10389522 | 236 |
| 351 | 3300027907 | Ga0207428_10038761 | Ga0207428_100387612 | 236 |
| 352 | 3300028380 | Ga0268265_10015715 | Ga0268265_100157152 | 236 |
| 353 | 3300028381 | Ga0268264_10045924 | Ga0268264_100459242 | 236 |
| 354 | 3300031090 | Ga0265760_10003454 | Ga0265760_100034543 | 236 |
| 355 | 3300031090 | Ga0265760_10004198 | Ga0265760_100041982 | 236 |
| 356 | 3300032002 | Ga0307416_100262744 | Ga0307416_1002627442 | 236 |
| 357 | 3300032002 | Ga0307416_100355262 | Ga0307416_1003552621 | 236 |
| 358 | 3300033547 | Ga0316212_1000411 | Ga0316212_10004115 | 236 |
| 359 | 3300034817 | Ga0373948_0031350 | Ga0373948_0031350_90_824 | 236 |
| 360 | 3300035083 | Ga0373926_0009409 | Ga0373926_0009409_636_1379 | 236 |
| 361 | 3300035171 | Ga0373946_0000969 | Ga0373946_0000969_8199_8942 | 236 |
| 362 | 3300035695 | Ga0373927_0000952 | Ga0373927_0000952_12949_13692 | 236 |
| 363 | 3300035725 | Ga0373947_0002119 | Ga0373947_0002119_8199_8942 | 236 |
| 364 | 3300036401 | Ga0373937_0019459 | Ga0373937_0019459_1550_2293 | 236 |
| 365 | 3300037068 | Ga0373925_0001097 | Ga0373925_0001097_8274_9017 | 236 |
| 366 | 3300037068 | Ga0373925_0017715 | Ga0373925_0017715_1707_2420 | 236 |
| 367 | 3300037068 | Ga0373925_0385091 | Ga0373925_0385091_11_724 | 236 |
| 368 | 3300037312 | Ga0395899_0026199 | Ga0395899_0026199_1735_2448 | 236 |
| 369 | 3300037312 | Ga0395899_0166768 | Ga0395899_0166768_321_1034 | 236 |
| 370 | 3300039447 | Ga0436361_0893758 | Ga0436361_0893758_153_1040 | 236 |
| 371 | 3300039447 | Ga0436361_1036667 | Ga0436361_1036667_2196_2924 | 236 |
| 372 | 3300042001 | Ga0439441_007564 | Ga0439441_007564_952_1662 | 236 |
| 373 | 3300042007 | Ga0439449_0117525 | Ga0439449_0117525_138_851 | 236 |
| 374 | 3300042876 | Ga0451577_0224176 | Ga0451577_0224176_484_1218 | 236 |
| 375 | 3300044712 | Ga0453684_0173165 | Ga0453684_0173165_1773_2507 | 236 |
| 376 | 3300045051 | Ga0451576_0007766 | Ga0451576_0007766_4204_4938 | 236 |
| 377 | 3300045051 | Ga0451576_0356065 | Ga0451576_0356065_616_1350 | 236 |
| 378 | 3300045051 | Ga0451576_0931500 | Ga0451576_0931500_130_864 | 236 |
| 379 | 3300045976 | Ga0466967_0825801 | Ga0466967_0825801_23_775 | 236 |
| 380 | 3300046463 | Ga0495653_0221049 | Ga0495653_0221049_223_999 | 236 |
| 381 | 3300046472 | Ga0495580_0005966 | Ga0495580_0005966_7248_7961 | 236 |
| 382 | 3300046473 | Ga0495582_0073861 | Ga0495582_0073861_839_1552 | 236 |
| 383 | 3300046517 | Ga0495630_0026255 | Ga0495630_0026255_1816_2559 | 236 |
| 384 | 3300046526 | Ga0495666_0028262 | Ga0495666_0028262_766_1509 | 236 |
| 385 | 3300046535 | Ga0495586_0091509 | Ga0495586_0091509_755_1468 | 236 |
| 386 | 3300046683 | Ga0495658_0032112 | Ga0495658_0032112_297_1010 | 236 |
| 387 | 3300047471 | Ga0495684_0175764 | Ga0495684_0175764_519_1232 | 236 |
| 388 | 3300048088 | Ga0495602_0016602 | Ga0495602_0016602_764_1540 | 236 |
| 389 | 3300048919 | Ga0496116_0000189 | Ga0496116_0000189_36277_36990 | 236 |
| 390 | 3300048920 | Ga0496117_0013809 | Ga0496117_0013809_3559_4272 | 236 |
| 391 | 3300048921 | Ga0496118_0007074 | Ga0496118_0007074_7013_7726 | 236 |
| 392 | 3300048924 | Ga0496121_0001568 | Ga0496121_0001568_1215_1928 | 236 |
| 393 | 3300048926 | Ga0496123_0017067 | Ga0496123_0017067_3566_4294 | 236 |
| 394 | 3300048927 | Ga0496124_0012244 | Ga0496124_0012244_1637_2350 | 236 |
| 395 | 3300048928 | Ga0496125_0012885 | Ga0496125_0012885_3612_4325 | 236 |
| 396 | 3300048929 | Ga0496126_0002481 | Ga0496126_0002481_9063_9776 | 236 |
| 397 | 3300049575 | Ga0501039_0416726 | Ga0501039_0416726_106_840 | 236 |
| 398 | 3300049576 | Ga0501040_0506307 | Ga0501040_0506307_98_817 | 236 |
| 399 | 3300049577 | Ga0501041_0119850 | Ga0501041_0119850_400_1110 | 236 |
| 400 | 3300049580 | Ga0501046_0033553 | Ga0501046_0033553_484_1263 | 236 |
| 401 | 3300049580 | Ga0501046_0118632 | Ga0501046_0118632_1104_1838 | 236 |
| 402 | 3300049582 | Ga0501048_0382845 | Ga0501048_0382845_31_741 | 236 |
| 403 | 3300049583 | Ga0501067_0056834 | Ga0501067_0056834_716_1426 | 236 |
| 404 | 3300049588 | Ga0501072_0239637 | Ga0501072_0239637_172_882 | 236 |
| 405 | 3300049590 | Ga0501074_0282089 | Ga0501074_0282089_21_755 | 236 |
| 406 | 3300049591 | Ga0501075_0063704 | Ga0501075_0063704_1768_2502 | 236 |
| 407 | 3300049591 | Ga0501075_0069212 | Ga0501075_0069212_1801_2535 | 236 |
| 408 | 3300049591 | Ga0501075_0189997 | Ga0501075_0189997_331_1041 | 236 |
| 409 | 3300049591 | Ga0501075_0214213 | Ga0501075_0214213_692_1426 | 236 |
| 410 | 3300049592 | Ga0501076_0096358 | Ga0501076_0096358_21_755 | 236 |
| 411 | 3300049592 | Ga0501076_0228463 | Ga0501076_0228463_745_1479 | 236 |
| 412 | 3300049593 | Ga0501077_0029636 | Ga0501077_0029636_1665_2375 | 236 |
| 413 | 3300049593 | Ga0501077_0116015 | Ga0501077_0116015_802_1536 | 236 |
| 414 | 3300049593 | Ga0501077_0116531 | Ga0501077_0116531_259_993 | 236 |
| 415 | 3300049741 | Ga0501079_0044554 | Ga0501079_0044554_681_1415 | 236 |
| 416 | 3300049741 | Ga0501079_0051199 | Ga0501079_0051199_672_1382 | 236 |
| 417 | 3300049741 | Ga0501079_0323499 | Ga0501079_0323499_186_920 | 236 |
| 418 | 3300049744 | Ga0501083_0062269 | Ga0501083_0062269_1055_1789 | 236 |
| 419 | 3300049822 | Ga0501035_0217433 | Ga0501035_0217433_33_767 | 236 |
| 420 | 3300049824 | Ga0501045_0112138 | Ga0501045_0112138_1092_1802 | 236 |
| 421 | 3300050507 | nmdc:mga05p37_74300_c1 | nmdc:mga05p37_74300_c1_461_1207 | 236 |
| 422 | 3300050508 | nmdc:mga09592_130421_c1 | nmdc:mga09592_130421_c1_652_1374 | 236 |
| 423 | 3300050509 | nmdc:mga0qj67_450762_c1 | nmdc:mga0qj67_450762_c1_32_778 | 236 |
| 424 | 3300050510 | nmdc:mga06r32_106674_c1 | nmdc:mga06r32_106674_c1_1879_2613 | 236 |
| 425 | 3300050510 | nmdc:mga06r32_279547_c1 | nmdc:mga06r32_279547_c1_212_922 | 236 |
| 426 | 3300050510 | nmdc:mga06r32_346261_c1 | nmdc:mga06r32_346261_c1_148_870 | 236 |
| 427 | 3300050511 | nmdc:mga08y16_26800_c1 | nmdc:mga08y16_26800_c1_1686_2417 | 236 |
| 428 | 3300050511 | nmdc:mga08y16_7197_c1 | nmdc:mga08y16_7197_c1_624_1349 | 236 |
| 429 | 3300050512 | nmdc:mga0n895_235826_c1 | nmdc:mga0n895_235826_c1_781_1515 | 236 |
| 430 | 3300050512 | nmdc:mga0n895_424896_c1 | nmdc:mga0n895_424896_c1_240_986 | 236 |
| 431 | 3300050512 | nmdc:mga0n895_445845_c1 | nmdc:mga0n895_445845_c1_307_1017 | 236 |
| 432 | 3300050513 | nmdc:mga0rr50_288605_c1 | nmdc:mga0rr50_288605_c1_550_1323 | 236 |
| 433 | 3300050513 | nmdc:mga0rr50_381804_c1 | nmdc:mga0rr50_381804_c1_178_921 | 236 |
| 434 | 3300050513 | nmdc:mga0rr50_683070_c1 | nmdc:mga0rr50_683070_c1_31_780 | 236 |
| 435 | 3300050514 | nmdc:mga08x19_12512_c1 | nmdc:mga08x19_12512_c1_2518_3261 | 236 |
| 436 | 3300050514 | nmdc:mga08x19_252780_c1 | nmdc:mga08x19_252780_c1_218_994 | 236 |
| 437 | 3300050514 | nmdc:mga08x19_29323_c1 | nmdc:mga08x19_29323_c1_1021_1755 | 236 |
| 438 | 3300050514 | nmdc:mga08x19_4919_c1 | nmdc:mga08x19_4919_c1_1904_2632 | 236 |
| 439 | 3300050514 | nmdc:mga08x19_645_c1 | nmdc:mga08x19_645_c1_20408_21151 | 236 |
| 440 | 3300050515 | nmdc:mga0a205_191526_c1 | nmdc:mga0a205_191526_c1_315_1025 | 236 |
| 441 | 3300054114 | Ga0501084_0042565 | Ga0501084_0042565_1505_2239 | 236 |
| 442 | 3300054114 | Ga0501084_0161334 | Ga0501084_0161334_184_894 | 236 |
| 443 | 3300060353 | Ga0501082_0064634 | Ga0501082_0064634_185_919 | 236 |
| 444 | 3300060353 | Ga0501082_0230342 | Ga0501082_0230342_447_1157 | 236 |
| 445 | 3300060353 | Ga0501082_0526301 | Ga0501082_0526301_145_879 | 236 |
| 446 | 3300060353 | Ga0501082_0605327 | Ga0501082_0605327_155_889 | 236 |
| 447 | 3300061734 | Ga0530510_0088688 | Ga0530510_0088688_222_932 | 236 |
| 448 | 3300061734 | Ga0530510_0428567 | Ga0530510_0428567_93_815 | 236 |
| 449 | iso_pu_bacteria | 2721755487 | 2722726856 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6st3-assembly1.cif.gz_A | hif prolyl hydroxylase 2 (phd2/ egln1) in complex with 4-hydroxy-n-(4-phenoxybenzyl)-2-(1h-pyrazol-1-yl)pyrimidine-5-carboxamide | 0.7125 | 7 | 229 |
| 5l9b-assembly1.cif.gz_A | hif prolyl hydroxylase 2 (phd2/ egln1) in complex with 2-oxoglutarate (2og) and hif-1alpha codd (556-574) | 0.6924 | 7 | 229 |
| 3oui-assembly1.cif.gz_A | phd2-r717 with 40787422 | 0.6869 | 7 | 229 |
| 5v18-assembly1.cif.gz_A | structure of phd2 in complex with 1,2,4-triazolo-[1,5-a]pyridine | 0.6822 | 3 | 234 |
| 4j25-assembly7.cif.gz_G | crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) | 0.6781 | 13 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLH7_61_232_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9476 | 52 | 235 | 2.60.120.590 |
| af_P9WLH7_61_232_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9423 | 52 | 235 | 2.60.120.590 |
| af_Z4YHZ5_296_475_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.6964 | 25 | 229 | 2.60.120.620 |
| af_A0A0R0I0F2_21_185_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.6899 | 126 | 231 | 2.60.120.10 |
| af_Q9VVQ4_306_472_2.60.120.620 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.6888 | 25 | 231 | 2.60.120.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A7PC52-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9941 | 29 | 236 |
GO:0016491
GO:0046872 |
| AF-A0A017TEZ0-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9935 | 4 | 236 |
|
| AF-A0A4V2VQR4-F1-model_v4 | deleted | 0.9935 | 4 | 236 |
|
| AF-A0A2V6QXL5-F1-model_v4 | Prolyl 4-hydroxylase subunit alpha | 0.9934 | 22 | 236 |
|
| AF-A0A1I2YLY0-F1-model_v4 | O-6-methylguanine DNA methyltransferase | 0.9933 | 3 | 236 |
GO:0003700
GO:0003908 GO:0006281 GO:0032259 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar