F446326

General Info

Members Datasets Scaffolds Average Seq Length
449 245 448 239

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100338456|Ga0070707_1003384561
Length 253
Sequence MGIEAGMAEAIRKTSEAQSIPERIEALDWKSVGESLSQRGYAVTAQVLSSAECARLVALYKDASRFRSEIIMERYRFGIGDYKYFGHPLPEIVTSLRTYAYPHLADVANQWAETLGETSPRFPRDHAAFLKICHKAGQTKPTPLLLHYEAGGYNCLHQDIYGDVSFPLQMVFLLGQQGRDWEGGEFLLVEQQPRAQSKGEVIRPDQGQAIVFTTRYRPVRGTRGYYRVNMRHGVSRVHRGTRYTLGIIFHDAK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 0.89
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 4.01
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5305914 2162886012 Bacteria 1471
2 JGI24744J21845_10003244 3300002077 Bacteria 3339
3 Ga0065715_10134717 3300005293 Bacteria 1918
4 Ga0070658_10051737 3300005327 Bacteria 3329
5 Ga0070676_10000619 3300005328 Bacteria 17345
6 Ga0070683_100101853 3300005329 Bacteria 2704
7 Ga0070683_100196908 3300005329 Bacteria 1913
8 Ga0068869_100019015 3300005334 Bacteria 4686
9 Ga0070666_10175325 3300005335 Bacteria 1503
10 Ga0070680_100132565 3300005336 Bacteria 2085
11 Ga0068868_100019537 3300005338 Bacteria 5077
12 Ga0068868_100116604 3300005338 Bacteria 2175
13 Ga0070660_100116205 3300005339 Bacteria 2133
14 Ga0070661_100083642 3300005344 Bacteria 2357
15 Ga0070692_10052401 3300005345 Bacteria 2125
16 Ga0070669_100132987 3300005353 Bacteria 1911
17 Ga0070675_100309106 3300005354 Bacteria 1394
18 Ga0070671_100006354 3300005355 Bacteria 9431
19 Ga0070673_100007135 3300005364 Bacteria 7339
20 Ga0070659_100041895 3300005366 Bacteria 3580
21 Ga0070667_100008627 3300005367 Bacteria 8448
22 Ga0070703_10088170 3300005406 Bacteria 1071
23 Ga0070709_10000103 3300005434 Bacteria 60237
24 Ga0070709_10034804 3300005434 Bacteria 3057
25 Ga0070714_100076396 3300005435 Bacteria 2908
26 Ga0070713_100014552 3300005436 Bacteria 5850
27 Ga0070713_100102199 3300005436 Bacteria 2485
28 Ga0070713_100124330 3300005436 Bacteria 2267
29 Ga0070711_100130101 3300005439 Bacteria 1873
30 Ga0070694_100157141 3300005444 Bacteria 1665
31 Ga0070708_100001533 3300005445 Bacteria 17655
32 Ga0070708_100001851 3300005445 Bacteria 16232
33 Ga0070708_100030962 3300005445 Bacteria 4628
34 Ga0070708_100650092 3300005445 Bacteria 994
35 Ga0070708_100741111 3300005445 Bacteria 924
36 Ga0070662_100005626 3300005457 Bacteria 8016
37 Ga0070681_10087352 3300005458 Bacteria 3071
38 Ga0070681_10126006 3300005458 Bacteria 2494
39 Ga0070681_10181981 3300005458 Unclassified 2023
40 Ga0068867_100007963 3300005459 Bacteria 7486
41 Ga0068867_100100516 3300005459 Bacteria 2208
42 Ga0070706_100000003 3300005467 Bacteria 284182
43 Ga0070706_100001737 3300005467 Bacteria 22580
44 Ga0070706_100117989 3300005467 Bacteria 2472
45 Ga0070706_100149388 3300005467 Bacteria 2181
46 Ga0070706_100310707 3300005467 Bacteria 1470
47 Ga0070707_100006616 3300005468 Bacteria 10747
48 Ga0070707_100007093 3300005468 Bacteria 10389
49 Ga0070707_100008529 3300005468 Bacteria 9523
50 Ga0070707_100089024 3300005468 Bacteria 2986
51 Ga0070707_100189515 3300005468 Bacteria 2005
52 Ga0070707_100338456 3300005468 Bacteria 1462
53 Ga0070698_100008343 3300005471 Bacteria 11196
54 Ga0070698_100025761 3300005471 Bacteria 6128
55 Ga0070698_100048778 3300005471 Bacteria 4326
56 Ga0070698_100171452 3300005471 Bacteria 2111
57 Ga0070698_100301285 3300005471 Unclassified 1533
58 Ga0070699_100006289 3300005518 Bacteria 10360
59 Ga0070699_100017797 3300005518 Bacteria 6102
60 Ga0070699_100056848 3300005518 Bacteria 3388
61 Ga0070699_100073066 3300005518 Bacteria 2984
62 Ga0070699_100290657 3300005518 Bacteria 1465
63 Ga0070679_100013169 3300005530 Bacteria 7920
64 Ga0070679_100041420 3300005530 Bacteria 4584
65 Ga0070684_100199728 3300005535 Unclassified 1821
66 Ga0070697_100002968 3300005536 Bacteria 13045
67 Ga0070697_100005220 3300005536 Bacteria 9978
68 Ga0070697_100005819 3300005536 Bacteria 9514
69 Ga0070697_100033336 3300005536 Bacteria 4147
70 Ga0070697_100180195 3300005536 Bacteria 1791
71 Ga0070697_100325232 3300005536 Bacteria 1325
72 Ga0068853_100021383 3300005539 Bacteria 5394
73 Ga0068853_100187186 3300005539 Bacteria 1880
74 Ga0068853_100208085 3300005539 Unclassified 1782
75 Ga0070686_100032952 3300005544 Bacteria 3180
76 Ga0070695_100001936 3300005545 Bacteria 11732
77 Ga0070695_100020213 3300005545 Unclassified 4064
78 Ga0070695_100049712 3300005545 Bacteria 2685
79 Ga0070695_100086954 3300005545 Bacteria 2078
80 Ga0070696_100001067 3300005546 Bacteria 17730
81 Ga0070693_100000202 3300005547 Bacteria 27944
82 Ga0070693_100063772 3300005547 Bacteria 2149
83 Ga0070665_100000010 3300005548 Bacteria 529545
84 Ga0070704_100255727 3300005549 Bacteria 1441
85 Ga0068855_100000498 3300005563 Bacteria 48519
86 Ga0068855_100068188 3300005563 Bacteria 4142
87 Ga0068855_100081962 3300005563 Unclassified 3739
88 Ga0068855_100090581 3300005563 Archaea 3529
89 Ga0068857_100010038 3300005577 Bacteria 8224
90 Ga0068854_100014171 3300005578 Bacteria 5248
91 Ga0068854_100039495 3300005578 Bacteria 3325
92 Ga0068854_100058842 3300005578 Bacteria 2776
93 Ga0068856_100328320 3300005614 Bacteria 1547
94 Ga0068852_100044537 3300005616 Bacteria 3769
95 Ga0068852_100511830 3300005616 Bacteria 1197
96 Ga0068859_100044888 3300005617 Bacteria 4441
97 Ga0068859_100301494 3300005617 Bacteria 1696
98 Ga0068866_10047022 3300005718 Unclassified 2173
99 Ga0068866_10066464 3300005718 Bacteria 1889
100 Ga0068861_100104460 3300005719 Bacteria 2260
101 Ga0068870_10011700 3300005840 Bacteria 4079
102 Ga0068870_10390113 3300005840 Bacteria 903
103 Ga0068863_100086693 3300005841 Bacteria 2967
104 Ga0068863_100097064 3300005841 Bacteria 2798
105 Ga0068860_100005538 3300005843 Bacteria 12787
106 Ga0068862_100016424 3300005844 Bacteria 6160
107 Ga0081455_10000614 3300005937 Bacteria 46194
108 Ga0070717_10232017 3300006028 Unclassified 1625
109 Ga0070717_10343043 3300006028 Bacteria 1334
110 Ga0070715_10240573 3300006163 Bacteria 941
111 Ga0070716_100000038 3300006173 Bacteria 52024
112 Ga0070716_100253043 3300006173 Unclassified 1201
113 Ga0070712_100013192 3300006175 Bacteria 5273
114 Ga0097621_100000247 3300006237 Bacteria 36324
115 Ga0097621_100000489 3300006237 Bacteria 27739
116 Ga0068871_100000419 3300006358 Bacteria 29372
117 Ga0075431_100081295 3300006847 Bacteria 3346
118 Ga0075431_100128505 3300006847 Bacteria 2615
119 Ga0075431_100138374 3300006847 Bacteria 2510
120 Ga0075433_10156411 3300006852 Bacteria 2028
121 Ga0075433_10359367 3300006852 Bacteria 1287
122 Ga0075434_100014168 3300006871 Bacteria 7617
123 Ga0075434_100283229 3300006871 Bacteria 1677
124 Ga0075434_100310520 3300006871 Bacteria 1597
125 Ga0075434_100319852 3300006871 Bacteria 1572
126 Ga0075434_100326237 3300006871 Bacteria 1556
127 Ga0075429_100111168 3300006880 Bacteria 2395
128 Ga0068865_100000076 3300006881 Bacteria 51732
129 Ga0075436_100001499 3300006914 Bacteria 15922
130 Ga0075436_100006563 3300006914 Bacteria 7965
131 Ga0075436_100039744 3300006914 Bacteria 3246
132 Ga0075436_100107328 3300006914 Bacteria 1947
133 Ga0097620_100044889 3300006931 Bacteria 4441
134 Ga0097620_100301507 3300006931 Bacteria 1696
135 Ga0075435_100026833 3300007076 Bacteria 4498
136 Ga0075435_100320496 3300007076 Bacteria 1327
137 Ga0099794_10000024 3300007265 Bacteria 62816
138 Ga0099794_10008611 3300007265 Bacteria 4246
139 Ga0099794_10019571 3300007265 Bacteria 3053
140 Ga0099794_10022756 3300007265 Bacteria 2859
141 Ga0099794_10025341 3300007265 Bacteria 2731
142 Ga0099794_10034085 3300007265 Bacteria 2397
143 Ga0099794_10038174 3300007265 Bacteria 2275
144 Ga0099794_10156599 3300007265 Bacteria 1158
145 Ga0099794_10180667 3300007265 Unclassified 1077
146 Ga0099795_10052807 3300007788 Bacteria 1486
147 Ga0105240_10019155 3300009093 Bacteria 9151
148 Ga0105240_10107892 3300009093 Unclassified 3375
149 Ga0105240_10127895 3300009093 Bacteria 3050
150 Ga0105240_10166717 3300009093 Bacteria 2612
151 Ga0111539_10036950 3300009094 Bacteria 5901
152 Ga0111539_10087776 3300009094 Bacteria 3654
153 Ga0111539_10242521 3300009094 Bacteria 2098
154 Ga0114129_10000813 3300009147 Bacteria 40171
155 Ga0114129_10497126 3300009147 Bacteria 1593
156 Ga0105243_10088706 3300009148 Bacteria 2541
157 Ga0105243_10221331 3300009148 Bacteria 1673
158 Ga0105241_10010482 3300009174 Bacteria 6798
159 Ga0105241_10399020 3300009174 Bacteria 1206
160 Ga0105242_10003180 3300009176 Bacteria 12809
161 Ga0105242_10009724 3300009176 Bacteria 7368
162 Ga0105242_10197340 3300009176 Bacteria 1785
163 Ga0105248_10038655 3300009177 Bacteria 5341
164 Ga0105248_10131589 3300009177 Bacteria 2822
165 Ga0105248_10150313 3300009177 Bacteria 2627
166 Ga0105248_10873815 3300009177 Bacteria 1015
167 Ga0105237_10002957 3300009545 Bacteria 20562
168 Ga0105237_10320330 3300009545 Bacteria 1554
169 Ga0105238_10010890 3300009551 Bacteria 9140
170 Ga0105238_10095210 3300009551 Bacteria 2965
171 Ga0105239_10218894 3300010375 Unclassified 2135
172 Ga0105239_10327738 3300010375 Bacteria 1727
173 Ga0105246_10406281 3300011119 Bacteria 1132
174 Ga0157374_10001476 3300013296 Bacteria 19869
175 Ga0157374_10529450 3300013296 Bacteria 1185
176 Ga0157378_10000098 3300013297 Bacteria 81734
177 Ga0157378_10035553 3300013297 Bacteria 4407
178 Ga0157378_10452304 3300013297 Unclassified 1275
179 Ga0157378_10528185 3300013297 Bacteria 1182
180 Ga0163162_10000082 3300013306 Bacteria 86888
181 Ga0163162_10001017 3300013306 Bacteria 26052
182 Ga0163162_10151142 3300013306 Bacteria 2440
183 Ga0163162_10501270 3300013306 Bacteria 1344
184 Ga0157372_10029584 3300013307 Bacteria 5983
185 Ga0157372_10494410 3300013307 Bacteria 1426
186 Ga0157375_10000134 3300013308 Bacteria 73895
187 Ga0157375_10054619 3300013308 Bacteria 3934
188 Ga0157375_10776425 3300013308 Bacteria 1108
189 Ga0182008_10040238 3300014497 Bacteria 2334
190 Ga0157379_10002952 3300014968 Bacteria 14340
191 Ga0157376_10001080 3300014969 Bacteria 17869
192 Ga0157376_10030894 3300014969 Bacteria 4283
193 Ga0182006_1022855 3300015261 Bacteria 2594
194 Ga0182007_10005452 3300015262 Bacteria 5584
195 Ga0163161_10027682 3300017792 Bacteria 4022
196 Ga0206350_11503795 3300020080 Unclassified 2776
197 Ga0224712_10000370 3300022467 Bacteria 8662
198 Ga0209784_100147 3300025224 Bacteria 64246
199 Ga0209566_100041 3300025225 Bacteria 289634
200 Ga0209147_100111 3300025229 Bacteria 145185
201 Ga0209025_1030910 3300025294 Bacteria 2549
202 Ga0207653_10002163 3300025885 Bacteria 6250
203 Ga0207653_10055322 3300025885 Bacteria 1328
204 Ga0207692_10038373 3300025898 Bacteria 2349
205 Ga0207642_10025009 3300025899 Unclassified 2409
206 Ga0207699_10000010 3300025906 Bacteria 295869
207 Ga0207699_10117707 3300025906 Bacteria 1713
208 Ga0207699_10167782 3300025906 Bacteria 1466
209 Ga0207645_10002749 3300025907 Bacteria 13705
210 Ga0207643_10054102 3300025908 Bacteria 2281
211 Ga0207684_10000032 3300025910 Bacteria 293234
212 Ga0207684_10001475 3300025910 Bacteria 25313
213 Ga0207684_10002192 3300025910 Bacteria 19973
214 Ga0207684_10005406 3300025910 Bacteria 11792
215 Ga0207684_10034256 3300025910 Bacteria 4315
216 Ga0207684_10045717 3300025910 Bacteria 3713
217 Ga0207654_10047663 3300025911 Bacteria 2449
218 Ga0207654_10505363 3300025911 Bacteria 854
219 Ga0207707_10016957 3300025912 Bacteria 6346
220 Ga0207707_10054064 3300025912 Bacteria 3495
221 Ga0207695_10000623 3300025913 Bacteria 71205
222 Ga0207695_10011350 3300025913 Bacteria 10798
223 Ga0207695_10051622 3300025913 Bacteria 4315
224 Ga0207695_10092308 3300025913 Bacteria 3038
225 Ga0207671_10021841 3300025914 Bacteria 4849
226 Ga0207693_10023573 3300025915 Bacteria 4886
227 Ga0207663_10048036 3300025916 Bacteria 2639
228 Ga0207663_10150591 3300025916 Bacteria 1632
229 Ga0207663_10342544 3300025916 Bacteria 1129
230 Ga0207660_10134143 3300025917 Bacteria 1887
231 Ga0207657_10000254 3300025919 Bacteria 56893
232 Ga0207649_10127806 3300025920 Bacteria 1722
233 Ga0207652_10033183 3300025921 Bacteria 4346
234 Ga0207652_10051345 3300025921 Bacteria 3535
235 Ga0207646_10001054 3300025922 Bacteria 35091
236 Ga0207646_10020112 3300025922 Bacteria 6191
237 Ga0207646_10040310 3300025922 Bacteria 4200
238 Ga0207646_10080253 3300025922 Bacteria 2917
239 Ga0207646_10118161 3300025922 Bacteria 2382
240 Ga0207646_10146696 3300025922 Bacteria 2126
241 Ga0207646_10561518 3300025922 Bacteria 1026
242 Ga0207681_10145239 3300025923 Bacteria 1772
243 Ga0207694_10015358 3300025924 Bacteria 5776
244 Ga0207650_10143063 3300025925 Bacteria 1882
245 Ga0207687_10011430 3300025927 Bacteria 5802
246 Ga0207700_10387784 3300025928 Bacteria 1222
247 Ga0207664_10136954 3300025929 Bacteria 2067
248 Ga0207644_10004058 3300025931 Bacteria 9499
249 Ga0207644_10125271 3300025931 Unclassified 1960
250 Ga0207706_10038032 3300025933 Bacteria 4270
251 Ga0207686_10024021 3300025934 Bacteria 3526
252 Ga0207686_10041185 3300025934 Bacteria 2815
253 Ga0207686_10323645 3300025934 Bacteria 1153
254 Ga0207709_10003833 3300025935 Bacteria 8817
255 Ga0207709_10444109 3300025935 Bacteria 1001
256 Ga0207704_10000189 3300025938 Bacteria 32372
257 Ga0207665_10000115 3300025939 Bacteria 52837
258 Ga0207711_10003267 3300025941 Bacteria 14112
259 Ga0207711_10371127 3300025941 Unclassified 1327
260 Ga0207689_10043734 3300025942 Bacteria 3702
261 Ga0207661_10155218 3300025944 Bacteria 1982
262 Ga0207679_10178861 3300025945 Bacteria 1753
263 Ga0207667_10001774 3300025949 Bacteria 27165
264 Ga0207667_10005697 3300025949 Bacteria 15190
265 Ga0207651_10004706 3300025960 Bacteria 6929
266 Ga0207640_10392251 3300025981 Bacteria 1128
267 Ga0207658_10027376 3300025986 Bacteria 4004
268 Ga0207658_10247374 3300025986 Bacteria 1514
269 Ga0207658_10847230 3300025986 Unclassified 831
270 Ga0207677_10129246 3300026023 Bacteria 1915
271 Ga0207703_10154664 3300026035 Bacteria 2003
272 Ga0207639_10028671 3300026041 Bacteria 4067
273 Ga0207702_10000314 3300026078 Bacteria 55437
274 Ga0207702_10200988 3300026078 Bacteria 1847
275 Ga0207641_10108675 3300026088 Bacteria 2455
276 Ga0207641_10999348 3300026088 Unclassified 833
277 Ga0207648_10034463 3300026089 Unclassified 4463
278 Ga0207648_10434081 3300026089 Bacteria 1194
279 Ga0207674_10010550 3300026116 Bacteria 10456
280 Ga0207674_10080000 3300026116 Bacteria 3272
281 Ga0207675_100281020 3300026118 Bacteria 1617
282 Ga0207683_10027106 3300026121 Bacteria 4952
283 Ga0207698_10075279 3300026142 Bacteria 2697
284 Ga0209588_1000007 3300027671 Bacteria 183924
285 Ga0209588_1000379 3300027671 Bacteria 11568
286 Ga0209588_1005540 3300027671 Bacteria 3624
287 Ga0209588_1020841 3300027671 Bacteria 2054
288 Ga0209588_1035334 3300027671 Bacteria 1606
289 Ga0209588_1038952 3300027671 Bacteria 1532
290 Ga0207428_10038761 3300027907 Bacteria 3872
291 Ga0268266_10000032 3300028379 Bacteria 395079
292 Ga0268265_10015715 3300028380 Bacteria 5185
293 Ga0268264_10045924 3300028381 Bacteria 3628
294 Ga0265760_10003454 3300031090 Unclassified 4586
295 Ga0265760_10004198 3300031090 Bacteria 4147
296 Ga0307416_100262744 3300032002 Bacteria 1688
297 Ga0307416_100355262 3300032002 Bacteria 1485
298 Ga0307510_10001152 3300033180 Bacteria 28416
299 Ga0316212_1000411 3300033547 Bacteria 5167
300 Ga0373948_0031350 3300034817 Bacteria 1073
301 Ga0373926_0009409 3300035083 Bacteria 3267
302 Ga0373946_0000969 3300035171 Bacteria 9838
303 Ga0373927_0000952 3300035695 Bacteria 22046
304 Ga0373947_0002119 3300035725 Bacteria 12098
305 Ga0373937_0019459 3300036401 Bacteria 6078
306 Ga0373925_0001097 3300037068 Bacteria 24247
307 Ga0373925_0017715 3300037068 Bacteria 5168
308 Ga0373925_0385091 3300037068 Bacteria 1142
309 Ga0395899_0026199 3300037312 Bacteria 4400
310 Ga0395899_0166768 3300037312 Bacteria 1553
311 Ga0395900_0008131 3300037418 Bacteria 10800
312 Ga0395898_0259348 3300037466 Bacteria 1658
313 Ga0395905_0000716 3300037471 Bacteria 43859
314 Ga0395905_0017061 3300037471 Bacteria 6894
315 Ga0395901_0001250 3300038443 Bacteria 27039
316 Ga0436361_0893758 3300039447 Bacteria 1114
317 Ga0436361_1036667 3300039447 Bacteria 4040
318 Ga0439441_007564 3300042001 Bacteria 1754
319 Ga0439448_0010775 3300042005 Bacteria 2716
320 Ga0439449_0117525 3300042007 Bacteria 986
321 Ga0451577_0224176 3300042876 Bacteria 1699
322 Ga0466963_0000098 3300044694 Bacteria 30946
323 Ga0453684_0173165 3300044712 Bacteria 2541
324 Ga0466971_0029283 3300044719 Bacteria 2463
325 Ga0466957_0040445 3300044842 Bacteria 2816
326 Ga0466957_0091134 3300044842 Bacteria 1910
327 Ga0466957_0093853 3300044842 Bacteria 1884
328 Ga0466960_0054063 3300044901 Bacteria 1948
329 Ga0466960_0096700 3300044901 Bacteria 1514
330 Ga0451576_0007766 3300045051 Bacteria 12726
331 Ga0451576_0356065 3300045051 Bacteria 1532
332 Ga0451576_0931500 3300045051 Bacteria 911
333 Ga0466958_0026281 3300045836 Bacteria 3440
334 Ga0466967_0003257 3300045976 Bacteria 10514
335 Ga0466967_0016631 3300045976 Bacteria 5809
336 Ga0466967_0094129 3300045976 Bacteria 2727
337 Ga0466967_0825801 3300045976 Unclassified 921
338 Ga0495653_0221049 3300046463 Unclassified 1273
339 Ga0495580_0005966 3300046472 Bacteria 9984
340 Ga0495582_0073861 3300046473 Bacteria 1888
341 Ga0495630_0026255 3300046517 Bacteria 4311
342 Ga0495666_0028262 3300046526 Bacteria 2759
343 Ga0495652_0186086 3300046529 Unclassified 1589
344 Ga0495640_0108624 3300046533 Bacteria 1815
345 Ga0495586_0091509 3300046535 Bacteria 1681
346 Ga0495658_0032112 3300046683 Bacteria 2865
347 Ga0495674_0429152 3300047319 Unclassified 1064
348 Ga0495683_0056035 3300047323 Bacteria 1961
349 Ga0495684_0175764 3300047471 Bacteria 1589
350 Ga0495602_0016602 3300048088 Bacteria 7402
351 Ga0496101_0006315 3300048904 Bacteria 7628
352 Ga0496101_0166899 3300048904 Bacteria 1690
353 Ga0496102_0078794 3300048905 Bacteria 3033
354 Ga0496102_0510651 3300048905 Bacteria 1124
355 Ga0496104_0056673 3300048907 Bacteria 3707
356 Ga0496104_0059308 3300048907 Unclassified 3623
357 Ga0496105_0490087 3300048908 Bacteria 966
358 Ga0496106_0023601 3300048909 Bacteria 4569
359 Ga0496106_0794828 3300048909 Bacteria 751
360 Ga0496108_0010299 3300048911 Bacteria 7590
361 Ga0496108_0026129 3300048911 Bacteria 4816
362 Ga0496109_0032853 3300048912 Bacteria 4667
363 Ga0496112_0037382 3300048915 Bacteria 4739
364 Ga0496112_0229035 3300048915 Unclassified 1813
365 Ga0496113_0133095 3300048916 Unclassified 1952
366 Ga0496114_0066427 3300048917 Bacteria 3023
367 Ga0496114_0382918 3300048917 Bacteria 1245
368 Ga0496115_0447980 3300048918 Bacteria 1043
369 Ga0496116_0000189 3300048919 Bacteria 122859
370 Ga0496116_0004879 3300048919 Bacteria 12652
371 Ga0496117_0013809 3300048920 Bacteria 7012
372 Ga0496118_0007074 3300048921 Bacteria 12054
373 Ga0496121_0001568 3300048924 Bacteria 38102
374 Ga0496123_0017067 3300048926 Bacteria 5862
375 Ga0496124_0012244 3300048927 Bacteria 8481
376 Ga0496125_0012885 3300048928 Bacteria 8259
377 Ga0496125_0064971 3300048928 Bacteria 2895
378 Ga0496126_0002481 3300048929 Bacteria 24825
379 Ga0501039_0416726 3300049575 Bacteria 1055
380 Ga0501040_0006797 3300049576 Bacteria 7417
381 Ga0501040_0506307 3300049576 Bacteria 870
382 Ga0501041_0119850 3300049577 Bacteria 1635
383 Ga0501046_0033553 3300049580 Bacteria 4146
384 Ga0501046_0118632 3300049580 Bacteria 2015
385 Ga0501048_0382845 3300049582 Bacteria 1005
386 Ga0501067_0001930 3300049583 Bacteria 11400
387 Ga0501067_0056834 3300049583 Bacteria 2167
388 Ga0501069_0163201 3300049585 Bacteria 1283
389 Ga0501070_0323160 3300049586 Bacteria 1255
390 Ga0501072_0239637 3300049588 Bacteria 1444
391 Ga0501072_0580872 3300049588 Bacteria 884
392 Ga0501074_0282089 3300049590 Bacteria 1181
393 Ga0501075_0063704 3300049591 Bacteria 2780
394 Ga0501075_0069212 3300049591 Bacteria 2667
395 Ga0501075_0189997 3300049591 Bacteria 1566
396 Ga0501075_0214213 3300049591 Bacteria 1469
397 Ga0501075_0544867 3300049591 Bacteria 885
398 Ga0501076_0096358 3300049592 Bacteria 2383
399 Ga0501076_0228463 3300049592 Bacteria 1521
400 Ga0501077_0029636 3300049593 Bacteria 3480
401 Ga0501077_0116015 3300049593 Bacteria 1697
402 Ga0501077_0116531 3300049593 Bacteria 1693
403 Ga0501079_0044554 3300049741 Bacteria 3423
404 Ga0501079_0051199 3300049741 Bacteria 3188
405 Ga0501079_0323499 3300049741 Bacteria 1207
406 Ga0501083_0062269 3300049744 Bacteria 2490
407 Ga0501035_0217433 3300049822 Bacteria 1633
408 Ga0501045_0049980 3300049824 Bacteria 3050
409 Ga0501045_0112138 3300049824 Bacteria 2022
410 nmdc:mga05p37_56200_c1 3300050507 Bacteria 4845
411 nmdc:mga05p37_74300_c1 3300050507 Bacteria 4184
412 nmdc:mga09592_130421_c1 3300050508 Bacteria 2162
413 nmdc:mga0qj67_143248_c1 3300050509 Unclassified 1938
414 nmdc:mga0qj67_450762_c1 3300050509 Bacteria 1036
415 nmdc:mga06r32_106674_c1 3300050510 Bacteria 2752
416 nmdc:mga06r32_19964_c1 3300050510 Bacteria 6160
417 nmdc:mga06r32_279547_c1 3300050510 Bacteria 1656
418 nmdc:mga06r32_346261_c1 3300050510 Bacteria 1471
419 nmdc:mga08y16_160048_c1 3300050511 Bacteria 2339
420 nmdc:mga08y16_26800_c1 3300050511 Bacteria 6073
421 nmdc:mga08y16_7197_c1 3300050511 Bacteria 11674
422 nmdc:mga0n895_235826_c1 3300050512 Bacteria 1857
423 nmdc:mga0n895_424896_c1 3300050512 Bacteria 1343
424 nmdc:mga0n895_445845_c1 3300050512 Bacteria 1307
425 nmdc:mga0n895_59916_c1 3300050512 Bacteria 3756
426 nmdc:mga0rr50_288605_c1 3300050513 Bacteria 1370
427 nmdc:mga0rr50_381804_c1 3300050513 Unclassified 1188
428 nmdc:mga0rr50_683070_c1 3300050513 Unclassified 876
429 nmdc:mga0rr50_8492_c1 3300050513 Bacteria 6398
430 nmdc:mga08x19_12512_c1 3300050514 Bacteria 5114
431 nmdc:mga08x19_252780_c1 3300050514 Bacteria 1217
432 nmdc:mga08x19_29323_c1 3300050514 Bacteria 3451
433 nmdc:mga08x19_43187_c1 3300050514 Bacteria 2876
434 nmdc:mga08x19_4919_c1 3300050514 Bacteria 7889
435 nmdc:mga08x19_645_c1 3300050514 Bacteria 22518
436 nmdc:mga0a205_191526_c1 3300050515 Bacteria 1937
437 Ga0501084_0042565 3300054114 Bacteria 3799
438 Ga0501084_0161334 3300054114 Bacteria 1891
439 Ga0501084_0530678 3300054114 Bacteria 995
440 Ga0501082_0064634 3300060353 Bacteria 3151
441 Ga0501082_0230342 3300060353 Bacteria 1612
442 Ga0501082_0326032 3300060353 Bacteria 1338
443 Ga0501082_0526301 3300060353 Bacteria 1034
444 Ga0501082_0605327 3300060353 Bacteria 959
445 Ga0466962_0076911 3300061719 Bacteria 1595
446 Ga0530510_0072122 3300061734 Bacteria 2507
447 Ga0530510_0088688 3300061734 Bacteria 2255
448 Ga0530510_0428567 3300061734 Bacteria 999

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_0429152 Ga0495674_0429152_412_1044 209
2 3300037471 Ga0395905_0017061 Ga0395905_0017061_790_1422 210
3 3300045976 Ga0466967_0016631 Ga0466967_0016631_1611_2318 215
4 3300044719 Ga0466971_0029283 Ga0466971_0029283_1128_1835 218
5 3300044842 Ga0466957_0091134 Ga0466957_0091134_291_998 218
6 3300045976 Ga0466967_0003257 Ga0466967_0003257_324_1031 218
7 3300006871 Ga0075434_100014168 Ga0075434_1000141686 220
8 3300007076 Ga0075435_100026833 Ga0075435_1000268334 220
9 3300025920 Ga0207649_10127806 Ga0207649_101278062 220
10 3300025945 Ga0207679_10178861 Ga0207679_101788612 220
11 3300049583 Ga0501067_0001930 Ga0501067_0001930_7459_8166 220
12 3300049585 Ga0501069_0163201 Ga0501069_0163201_509_1216 220
13 3300050512 nmdc:mga0n895_59916_c1 nmdc:mga0n895_59916_c1_819_1526 220
14 3300050513 nmdc:mga0rr50_8492_c1 nmdc:mga0rr50_8492_c1_100_807 220
15 3300050514 nmdc:mga08x19_43187_c1 nmdc:mga08x19_43187_c1_1402_2109 220
16 3300061734 Ga0530510_0072122 Ga0530510_0072122_907_1614 220
17 3300009147 Ga0114129_10497126 Ga0114129_104971262 223
18 3300048919 Ga0496116_0004879 Ga0496116_0004879_2036_2764 223
19 3300048928 Ga0496125_0064971 Ga0496125_0064971_2114_2842 223
20 3300050507 nmdc:mga05p37_56200_c1 nmdc:mga05p37_56200_c1_1507_2184 223
21 3300005335 Ga0070666_10175325 Ga0070666_101753252 229
22 3300005355 Ga0070671_100006354 Ga0070671_1000063548 229
23 3300005367 Ga0070667_100008627 Ga0070667_1000086274 229
24 3300005841 Ga0068863_100097064 Ga0068863_1000970642 229
25 3300006237 Ga0097621_100000489 Ga0097621_1000004898 229
26 3300006358 Ga0068871_100000419 Ga0068871_10000041914 229
27 3300009176 Ga0105242_10197340 Ga0105242_101973402 229
28 3300009177 Ga0105248_10131589 Ga0105248_101315892 229
29 3300013297 Ga0157378_10452304 Ga0157378_104523042 229
30 3300013306 Ga0163162_10001017 Ga0163162_1000101710 229
31 3300013308 Ga0157375_10000134 Ga0157375_1000013448 229
32 3300014968 Ga0157379_10002952 Ga0157379_100029525 229
33 3300014969 Ga0157376_10001080 Ga0157376_100010806 229
34 3300017792 Ga0163161_10027682 Ga0163161_100276822 229
35 3300025899 Ga0207642_10025009 Ga0207642_100250091 229
36 3300025931 Ga0207644_10004058 Ga0207644_100040589 229
37 3300025934 Ga0207686_10323645 Ga0207686_103236452 229
38 3300025941 Ga0207711_10371127 Ga0207711_103711272 229
39 3300025986 Ga0207658_10027376 Ga0207658_100273764 229
40 3300026088 Ga0207641_10108675 Ga0207641_101086752 229
41 3300048904 Ga0496101_0006315 Ga0496101_0006315_6147_6839 229
42 3300048909 Ga0496106_0794828 Ga0496106_0794828_16_708 229
43 3300048917 Ga0496114_0382918 Ga0496114_0382918_322_1014 229
44 3300037418 Ga0395900_0008131 Ga0395900_0008131_8650_9348 232
45 3300037466 Ga0395898_0259348 Ga0395898_0259348_365_1063 232
46 3300037471 Ga0395905_0000716 Ga0395905_0000716_40158_40856 232
47 3300038443 Ga0395901_0001250 Ga0395901_0001250_22528_23226 232
48 3300002077 JGI24744J21845_10003244 JGI24744J21845_100032446 233
49 3300005328 Ga0070676_10000619 Ga0070676_1000061914 233
50 3300005338 Ga0068868_100019537 Ga0068868_1000195371 233
51 3300005354 Ga0070675_100309106 Ga0070675_1003091063 233
52 3300005364 Ga0070673_100007135 Ga0070673_1000071356 233
53 3300005459 Ga0068867_100007963 Ga0068867_1000079637 233
54 3300005539 Ga0068853_100021383 Ga0068853_1000213835 233
55 3300005544 Ga0070686_100032952 Ga0070686_1000329523 233
56 3300005548 Ga0070665_100000010 Ga0070665_100000010282 233
57 3300005563 Ga0068855_100068188 Ga0068855_1000681885 233
58 3300005616 Ga0068852_100044537 Ga0068852_1000445373 233
59 3300005718 Ga0068866_10066464 Ga0068866_100664641 233
60 3300005840 Ga0068870_10390113 Ga0068870_103901131 233
61 3300006237 Ga0097621_100000247 Ga0097621_10000024737 233
62 3300006881 Ga0068865_100000076 Ga0068865_10000007639 233
63 3300007265 Ga0099794_10019571 Ga0099794_100195712 233
64 3300007265 Ga0099794_10022756 Ga0099794_100227564 233
65 3300007788 Ga0099795_10052807 Ga0099795_100528072 233
66 3300009093 Ga0105240_10107892 Ga0105240_101078922 233
67 3300009093 Ga0105240_10127895 Ga0105240_101278952 233
68 3300009094 Ga0111539_10036950 Ga0111539_100369505 233
69 3300009148 Ga0105243_10088706 Ga0105243_100887062 233
70 3300009174 Ga0105241_10010482 Ga0105241_100104826 233
71 3300009174 Ga0105241_10399020 Ga0105241_103990202 233
72 3300009176 Ga0105242_10003180 Ga0105242_1000318014 233
73 3300009177 Ga0105248_10150313 Ga0105248_101503132 233
74 3300009545 Ga0105237_10002957 Ga0105237_1000295720 233
75 3300009551 Ga0105238_10010890 Ga0105238_1001089010 233
76 3300009551 Ga0105238_10095210 Ga0105238_100952103 233
77 3300010375 Ga0105239_10218894 Ga0105239_102188942 233
78 3300011119 Ga0105246_10406281 Ga0105246_104062811 233
79 3300013296 Ga0157374_10001476 Ga0157374_1000147619 233
80 3300013297 Ga0157378_10000098 Ga0157378_100000986 233
81 3300013297 Ga0157378_10035553 Ga0157378_100355533 233
82 3300013297 Ga0157378_10528185 Ga0157378_105281852 233
83 3300013306 Ga0163162_10000082 Ga0163162_1000008212 233
84 3300013306 Ga0163162_10151142 Ga0163162_101511422 233
85 3300013306 Ga0163162_10501270 Ga0163162_105012701 233
86 3300013307 Ga0157372_10029584 Ga0157372_100295844 233
87 3300013308 Ga0157375_10054619 Ga0157375_100546193 233
88 3300014497 Ga0182008_10040238 Ga0182008_100402382 233
89 3300014969 Ga0157376_10030894 Ga0157376_100308943 233
90 3300015261 Ga0182006_1022855 Ga0182006_10228552 233
91 3300015262 Ga0182007_10005452 Ga0182007_100054522 233
92 3300025907 Ga0207645_10002749 Ga0207645_100027493 233
93 3300025911 Ga0207654_10047663 Ga0207654_100476633 233
94 3300025913 Ga0207695_10092308 Ga0207695_100923083 233
95 3300025914 Ga0207671_10021841 Ga0207671_100218414 233
96 3300025924 Ga0207694_10015358 Ga0207694_100153584 233
97 3300025931 Ga0207644_10125271 Ga0207644_101252713 233
98 3300025934 Ga0207686_10041185 Ga0207686_100411852 233
99 3300025938 Ga0207704_10000189 Ga0207704_100001894 233
100 3300025949 Ga0207667_10005697 Ga0207667_1000569712 233
101 3300025960 Ga0207651_10004706 Ga0207651_100047066 233
102 3300025986 Ga0207658_10847230 Ga0207658_108472301 233
103 3300026041 Ga0207639_10028671 Ga0207639_100286715 233
104 3300026088 Ga0207641_10999348 Ga0207641_109993481 233
105 3300026089 Ga0207648_10034463 Ga0207648_100344633 233
106 3300026121 Ga0207683_10027106 Ga0207683_100271066 233
107 3300028379 Ga0268266_10000032 Ga0268266_10000032294 233
108 3300033180 Ga0307510_10001152 Ga0307510_1000115214 233
109 3300042005 Ga0439448_0010775 Ga0439448_0010775_1202_1903 233
110 3300047323 Ga0495683_0056035 Ga0495683_0056035_486_1187 233
111 3300048905 Ga0496102_0078794 Ga0496102_0078794_1418_2131 233
112 3300048907 Ga0496104_0059308 Ga0496104_0059308_2100_2831 233
113 3300048908 Ga0496105_0490087 Ga0496105_0490087_102_833 233
114 3300048909 Ga0496106_0023601 Ga0496106_0023601_3001_3714 233
115 3300048911 Ga0496108_0026129 Ga0496108_0026129_2392_3123 233
116 3300048915 Ga0496112_0229035 Ga0496112_0229035_900_1613 233
117 3300048916 Ga0496113_0133095 Ga0496113_0133095_653_1384 233
118 3300049576 Ga0501040_0006797 Ga0501040_0006797_4919_5635 233
119 3300050509 nmdc:mga0qj67_143248_c1 nmdc:mga0qj67_143248_c1_1144_1863 233
120 3300050510 nmdc:mga06r32_19964_c1 nmdc:mga06r32_19964_c1_2007_2726 233
121 3300050511 nmdc:mga08y16_160048_c1 nmdc:mga08y16_160048_c1_291_1010 233
122 3300054114 Ga0501084_0530678 Ga0501084_0530678_158_874 233
123 3300005329 Ga0070683_100101853 Ga0070683_1001018531 234
124 3300005338 Ga0068868_100116604 Ga0068868_1001166042 234
125 3300005435 Ga0070714_100076396 Ga0070714_1000763961 234
126 3300005439 Ga0070711_100130101 Ga0070711_1001301012 234
127 3300005458 Ga0070681_10087352 Ga0070681_100873523 234
128 3300005530 Ga0070679_100041420 Ga0070679_1000414203 234
129 3300005539 Ga0068853_100187186 Ga0068853_1001871862 234
130 3300005563 Ga0068855_100081962 Ga0068855_1000819627 234
131 3300005578 Ga0068854_100039495 Ga0068854_1000394953 234
132 3300005578 Ga0068854_100058842 Ga0068854_1000588422 234
133 3300006163 Ga0070715_10240573 Ga0070715_102405732 234
134 3300006175 Ga0070712_100013192 Ga0070712_1000131922 234
135 3300009093 Ga0105240_10019155 Ga0105240_1001915512 234
136 3300009093 Ga0105240_10166717 Ga0105240_101667172 234
137 3300009177 Ga0105248_10873815 Ga0105248_108738152 234
138 3300009545 Ga0105237_10320330 Ga0105237_103203303 234
139 3300010375 Ga0105239_10327738 Ga0105239_103277382 234
140 3300013296 Ga0157374_10529450 Ga0157374_105294501 234
141 3300013307 Ga0157372_10494410 Ga0157372_104944102 234
142 3300025898 Ga0207692_10038373 Ga0207692_100383732 234
143 3300025911 Ga0207654_10505363 Ga0207654_105053631 234
144 3300025912 Ga0207707_10016957 Ga0207707_100169577 234
145 3300025913 Ga0207695_10011350 Ga0207695_1001135012 234
146 3300025913 Ga0207695_10051622 Ga0207695_100516221 234
147 3300025915 Ga0207693_10023573 Ga0207693_100235734 234
148 3300025916 Ga0207663_10048036 Ga0207663_100480363 234
149 3300025921 Ga0207652_10051345 Ga0207652_100513451 234
150 3300025927 Ga0207687_10011430 Ga0207687_100114305 234
151 3300025929 Ga0207664_10136954 Ga0207664_101369542 234
152 3300025981 Ga0207640_10392251 Ga0207640_103922512 234
153 3300026023 Ga0207677_10129246 Ga0207677_101292462 234
154 3300026078 Ga0207702_10200988 Ga0207702_102009883 234
155 3300026142 Ga0207698_10075279 Ga0207698_100752792 234
156 3300044694 Ga0466963_0000098 Ga0466963_0000098_700_1407 234
157 3300044842 Ga0466957_0040445 Ga0466957_0040445_517_1224 234
158 3300044842 Ga0466957_0093853 Ga0466957_0093853_725_1432 234
159 3300044901 Ga0466960_0054063 Ga0466960_0054063_357_1064 234
160 3300044901 Ga0466960_0096700 Ga0466960_0096700_195_902 234
161 3300045836 Ga0466958_0026281 Ga0466958_0026281_545_1252 234
162 3300045976 Ga0466967_0094129 Ga0466967_0094129_1040_1747 234
163 3300046529 Ga0495652_0186086 Ga0495652_0186086_128_835 234
164 3300046533 Ga0495640_0108624 Ga0495640_0108624_607_1314 234
165 3300048904 Ga0496101_0166899 Ga0496101_0166899_425_1132 234
166 3300048905 Ga0496102_0510651 Ga0496102_0510651_223_930 234
167 3300048907 Ga0496104_0056673 Ga0496104_0056673_1406_2113 234
168 3300048911 Ga0496108_0010299 Ga0496108_0010299_3247_3954 234
169 3300048912 Ga0496109_0032853 Ga0496109_0032853_583_1290 234
170 3300048915 Ga0496112_0037382 Ga0496112_0037382_843_1550 234
171 3300048917 Ga0496114_0066427 Ga0496114_0066427_1369_2076 234
172 3300048918 Ga0496115_0447980 Ga0496115_0447980_300_1007 234
173 3300049586 Ga0501070_0323160 Ga0501070_0323160_21_728 234
174 3300061719 Ga0466962_0076911 Ga0466962_0076911_541_1248 234
175 3300005458 Ga0070681_10181981 Ga0070681_101819811 235
176 3300005563 Ga0068855_100000498 Ga0068855_10000049846 235
177 3300025949 Ga0207667_10001774 Ga0207667_100017744 235
178 3300026078 Ga0207702_10000314 Ga0207702_1000031428 235
179 3300049588 Ga0501072_0580872 Ga0501072_0580872_104_820 235
180 3300049591 Ga0501075_0544867 Ga0501075_0544867_42_758 235
181 3300049824 Ga0501045_0049980 Ga0501045_0049980_2026_2751 235
182 3300060353 Ga0501082_0326032 Ga0501082_0326032_60_776 235
183 2162886012 MBSR1b_contig_5305914 MBSR1b_0655.00003590 236
184 3300005293 Ga0065715_10134717 Ga0065715_101347173 236
185 3300005327 Ga0070658_10051737 Ga0070658_100517373 236
186 3300005329 Ga0070683_100196908 Ga0070683_1001969083 236
187 3300005334 Ga0068869_100019015 Ga0068869_1000190154 236
188 3300005336 Ga0070680_100132565 Ga0070680_1001325652 236
189 3300005339 Ga0070660_100116205 Ga0070660_1001162051 236
190 3300005344 Ga0070661_100083642 Ga0070661_1000836423 236
191 3300005345 Ga0070692_10052401 Ga0070692_100524011 236
192 3300005353 Ga0070669_100132987 Ga0070669_1001329873 236
193 3300005366 Ga0070659_100041895 Ga0070659_1000418953 236
194 3300005406 Ga0070703_10088170 Ga0070703_100881702 236
195 3300005434 Ga0070709_10000103 Ga0070709_1000010325 236
196 3300005434 Ga0070709_10034804 Ga0070709_100348043 236
197 3300005436 Ga0070713_100014552 Ga0070713_1000145527 236
198 3300005436 Ga0070713_100102199 Ga0070713_1001021992 236
199 3300005436 Ga0070713_100124330 Ga0070713_1001243302 236
200 3300005444 Ga0070694_100157141 Ga0070694_1001571412 236
201 3300005445 Ga0070708_100001533 Ga0070708_1000015333 236
202 3300005445 Ga0070708_100001851 Ga0070708_10000185118 236
203 3300005445 Ga0070708_100030962 Ga0070708_1000309623 236
204 3300005445 Ga0070708_100650092 Ga0070708_1006500922 236
205 3300005445 Ga0070708_100741111 Ga0070708_1007411111 236
206 3300005457 Ga0070662_100005626 Ga0070662_1000056262 236
207 3300005458 Ga0070681_10126006 Ga0070681_101260062 236
208 3300005459 Ga0068867_100100516 Ga0068867_1001005163 236
209 3300005467 Ga0070706_100000003 Ga0070706_100000003186 236
210 3300005467 Ga0070706_100001737 Ga0070706_10000173719 236
211 3300005467 Ga0070706_100117989 Ga0070706_1001179891 236
212 3300005467 Ga0070706_100149388 Ga0070706_1001493883 236
213 3300005467 Ga0070706_100310707 Ga0070706_1003107072 236
214 3300005468 Ga0070707_100006616 Ga0070707_1000066163 236
215 3300005468 Ga0070707_100007093 Ga0070707_1000070939 236
216 3300005468 Ga0070707_100008529 Ga0070707_1000085294 236
217 3300005468 Ga0070707_100089024 Ga0070707_1000890243 236
218 3300005468 Ga0070707_100189515 Ga0070707_1001895153 236
219 3300005468 Ga0070707_100338456 Ga0070707_1003384561 236
220 3300005471 Ga0070698_100008343 Ga0070698_10000834311 236
221 3300005471 Ga0070698_100025761 Ga0070698_1000257616 236
222 3300005471 Ga0070698_100048778 Ga0070698_1000487783 236
223 3300005471 Ga0070698_100171452 Ga0070698_1001714522 236
224 3300005471 Ga0070698_100301285 Ga0070698_1003012853 236
225 3300005518 Ga0070699_100006289 Ga0070699_1000062897 236
226 3300005518 Ga0070699_100017797 Ga0070699_1000177977 236
227 3300005518 Ga0070699_100056848 Ga0070699_1000568482 236
228 3300005518 Ga0070699_100073066 Ga0070699_1000730662 236
229 3300005518 Ga0070699_100290657 Ga0070699_1002906572 236
230 3300005530 Ga0070679_100013169 Ga0070679_1000131693 236
231 3300005535 Ga0070684_100199728 Ga0070684_1001997282 236
232 3300005536 Ga0070697_100002968 Ga0070697_1000029688 236
233 3300005536 Ga0070697_100005220 Ga0070697_1000052209 236
234 3300005536 Ga0070697_100005819 Ga0070697_1000058198 236
235 3300005536 Ga0070697_100033336 Ga0070697_1000333363 236
236 3300005536 Ga0070697_100180195 Ga0070697_1001801953 236
237 3300005536 Ga0070697_100325232 Ga0070697_1003252322 236
238 3300005539 Ga0068853_100208085 Ga0068853_1002080852 236
239 3300005545 Ga0070695_100001936 Ga0070695_1000019369 236
240 3300005545 Ga0070695_100020213 Ga0070695_1000202135 236
241 3300005545 Ga0070695_100049712 Ga0070695_1000497121 236
242 3300005545 Ga0070695_100086954 Ga0070695_1000869541 236
243 3300005546 Ga0070696_100001067 Ga0070696_1000010677 236
244 3300005547 Ga0070693_100000202 Ga0070693_10000020218 236
245 3300005547 Ga0070693_100063772 Ga0070693_1000637721 236
246 3300005549 Ga0070704_100255727 Ga0070704_1002557272 236
247 3300005563 Ga0068855_100090581 Ga0068855_1000905813 236
248 3300005577 Ga0068857_100010038 Ga0068857_1000100389 236
249 3300005578 Ga0068854_100014171 Ga0068854_1000141714 236
250 3300005614 Ga0068856_100328320 Ga0068856_1003283202 236
251 3300005616 Ga0068852_100511830 Ga0068852_1005118302 236
252 3300005617 Ga0068859_100044888 Ga0068859_1000448884 236
253 3300005617 Ga0068859_100301494 Ga0068859_1003014942 236
254 3300005718 Ga0068866_10047022 Ga0068866_100470222 236
255 3300005719 Ga0068861_100104460 Ga0068861_1001044602 236
256 3300005840 Ga0068870_10011700 Ga0068870_100117002 236
257 3300005841 Ga0068863_100086693 Ga0068863_1000866931 236
258 3300005843 Ga0068860_100005538 Ga0068860_1000055385 236
259 3300005844 Ga0068862_100016424 Ga0068862_1000164249 236
260 3300005937 Ga0081455_10000614 Ga0081455_100006143 236
261 3300006028 Ga0070717_10232017 Ga0070717_102320171 236
262 3300006028 Ga0070717_10343043 Ga0070717_103430432 236
263 3300006173 Ga0070716_100000038 Ga0070716_10000003842 236
264 3300006173 Ga0070716_100253043 Ga0070716_1002530431 236
265 3300006847 Ga0075431_100081295 Ga0075431_1000812954 236
266 3300006847 Ga0075431_100128505 Ga0075431_1001285052 236
267 3300006847 Ga0075431_100138374 Ga0075431_1001383742 236
268 3300006852 Ga0075433_10156411 Ga0075433_101564113 236
269 3300006852 Ga0075433_10359367 Ga0075433_103593672 236
270 3300006871 Ga0075434_100283229 Ga0075434_1002832292 236
271 3300006871 Ga0075434_100310520 Ga0075434_1003105202 236
272 3300006871 Ga0075434_100319852 Ga0075434_1003198522 236
273 3300006871 Ga0075434_100326237 Ga0075434_1003262372 236
274 3300006880 Ga0075429_100111168 Ga0075429_1001111682 236
275 3300006914 Ga0075436_100001499 Ga0075436_1000014994 236
276 3300006914 Ga0075436_100006563 Ga0075436_1000065633 236
277 3300006914 Ga0075436_100039744 Ga0075436_1000397443 236
278 3300006914 Ga0075436_100107328 Ga0075436_1001073282 236
279 3300006931 Ga0097620_100044889 Ga0097620_1000448893 236
280 3300006931 Ga0097620_100301507 Ga0097620_1003015072 236
281 3300007076 Ga0075435_100320496 Ga0075435_1003204963 236
282 3300007265 Ga0099794_10000024 Ga0099794_1000002455 236
283 3300007265 Ga0099794_10008611 Ga0099794_100086112 236
284 3300007265 Ga0099794_10025341 Ga0099794_100253412 236
285 3300007265 Ga0099794_10034085 Ga0099794_100340854 236
286 3300007265 Ga0099794_10038174 Ga0099794_100381742 236
287 3300007265 Ga0099794_10156599 Ga0099794_101565992 236
288 3300007265 Ga0099794_10180667 Ga0099794_101806671 236
289 3300009094 Ga0111539_10087776 Ga0111539_100877763 236
290 3300009094 Ga0111539_10242521 Ga0111539_102425212 236
291 3300009147 Ga0114129_10000813 Ga0114129_1000081335 236
292 3300009148 Ga0105243_10221331 Ga0105243_102213312 236
293 3300009176 Ga0105242_10009724 Ga0105242_100097247 236
294 3300009177 Ga0105248_10038655 Ga0105248_100386552 236
295 3300013308 Ga0157375_10776425 Ga0157375_107764252 236
296 3300020080 Ga0206350_11503795 Ga0206350_115037952 236
297 3300022467 Ga0224712_10000370 Ga0224712_100003709 236
298 3300025224 Ga0209784_100147 Ga0209784_10014710 236
299 3300025225 Ga0209566_100041 Ga0209566_100041157 236
300 3300025229 Ga0209147_100111 Ga0209147_10011137 236
301 3300025294 Ga0209025_1030910 Ga0209025_10309102 236
302 3300025885 Ga0207653_10002163 Ga0207653_100021633 236
303 3300025885 Ga0207653_10055322 Ga0207653_100553222 236
304 3300025906 Ga0207699_10000010 Ga0207699_1000001043 236
305 3300025906 Ga0207699_10117707 Ga0207699_101177071 236
306 3300025906 Ga0207699_10167782 Ga0207699_101677821 236
307 3300025908 Ga0207643_10054102 Ga0207643_100541024 236
308 3300025910 Ga0207684_10000032 Ga0207684_10000032193 236
309 3300025910 Ga0207684_10001475 Ga0207684_1000147510 236
310 3300025910 Ga0207684_10002192 Ga0207684_1000219211 236
311 3300025910 Ga0207684_10005406 Ga0207684_100054069 236
312 3300025910 Ga0207684_10034256 Ga0207684_100342562 236
313 3300025910 Ga0207684_10045717 Ga0207684_100457172 236
314 3300025912 Ga0207707_10054064 Ga0207707_100540642 236
315 3300025913 Ga0207695_10000623 Ga0207695_1000062320 236
316 3300025916 Ga0207663_10150591 Ga0207663_101505912 236
317 3300025916 Ga0207663_10342544 Ga0207663_103425442 236
318 3300025917 Ga0207660_10134143 Ga0207660_101341431 236
319 3300025919 Ga0207657_10000254 Ga0207657_100002549 236
320 3300025921 Ga0207652_10033183 Ga0207652_100331833 236
321 3300025922 Ga0207646_10001054 Ga0207646_100010541 236
322 3300025922 Ga0207646_10020112 Ga0207646_100201121 236
323 3300025922 Ga0207646_10040310 Ga0207646_100403102 236
324 3300025922 Ga0207646_10080253 Ga0207646_100802532 236
325 3300025922 Ga0207646_10118161 Ga0207646_101181612 236
326 3300025922 Ga0207646_10146696 Ga0207646_101466962 236
327 3300025922 Ga0207646_10561518 Ga0207646_105615182 236
328 3300025923 Ga0207681_10145239 Ga0207681_101452392 236
329 3300025925 Ga0207650_10143063 Ga0207650_101430632 236
330 3300025928 Ga0207700_10387784 Ga0207700_103877842 236
331 3300025933 Ga0207706_10038032 Ga0207706_100380322 236
332 3300025934 Ga0207686_10024021 Ga0207686_100240214 236
333 3300025935 Ga0207709_10003833 Ga0207709_100038338 236
334 3300025935 Ga0207709_10444109 Ga0207709_104441092 236
335 3300025939 Ga0207665_10000115 Ga0207665_1000011520 236
336 3300025941 Ga0207711_10003267 Ga0207711_100032677 236
337 3300025942 Ga0207689_10043734 Ga0207689_100437344 236
338 3300025944 Ga0207661_10155218 Ga0207661_101552182 236
339 3300025986 Ga0207658_10247374 Ga0207658_102473742 236
340 3300026035 Ga0207703_10154664 Ga0207703_101546642 236
341 3300026089 Ga0207648_10434081 Ga0207648_104340812 236
342 3300026116 Ga0207674_10010550 Ga0207674_100105503 236
343 3300026116 Ga0207674_10080000 Ga0207674_100800002 236
344 3300026118 Ga0207675_100281020 Ga0207675_1002810202 236
345 3300027671 Ga0209588_1000007 Ga0209588_1000007143 236
346 3300027671 Ga0209588_1000379 Ga0209588_10003795 236
347 3300027671 Ga0209588_1005540 Ga0209588_10055402 236
348 3300027671 Ga0209588_1020841 Ga0209588_10208412 236
349 3300027671 Ga0209588_1035334 Ga0209588_10353342 236
350 3300027671 Ga0209588_1038952 Ga0209588_10389522 236
351 3300027907 Ga0207428_10038761 Ga0207428_100387612 236
352 3300028380 Ga0268265_10015715 Ga0268265_100157152 236
353 3300028381 Ga0268264_10045924 Ga0268264_100459242 236
354 3300031090 Ga0265760_10003454 Ga0265760_100034543 236
355 3300031090 Ga0265760_10004198 Ga0265760_100041982 236
356 3300032002 Ga0307416_100262744 Ga0307416_1002627442 236
357 3300032002 Ga0307416_100355262 Ga0307416_1003552621 236
358 3300033547 Ga0316212_1000411 Ga0316212_10004115 236
359 3300034817 Ga0373948_0031350 Ga0373948_0031350_90_824 236
360 3300035083 Ga0373926_0009409 Ga0373926_0009409_636_1379 236
361 3300035171 Ga0373946_0000969 Ga0373946_0000969_8199_8942 236
362 3300035695 Ga0373927_0000952 Ga0373927_0000952_12949_13692 236
363 3300035725 Ga0373947_0002119 Ga0373947_0002119_8199_8942 236
364 3300036401 Ga0373937_0019459 Ga0373937_0019459_1550_2293 236
365 3300037068 Ga0373925_0001097 Ga0373925_0001097_8274_9017 236
366 3300037068 Ga0373925_0017715 Ga0373925_0017715_1707_2420 236
367 3300037068 Ga0373925_0385091 Ga0373925_0385091_11_724 236
368 3300037312 Ga0395899_0026199 Ga0395899_0026199_1735_2448 236
369 3300037312 Ga0395899_0166768 Ga0395899_0166768_321_1034 236
370 3300039447 Ga0436361_0893758 Ga0436361_0893758_153_1040 236
371 3300039447 Ga0436361_1036667 Ga0436361_1036667_2196_2924 236
372 3300042001 Ga0439441_007564 Ga0439441_007564_952_1662 236
373 3300042007 Ga0439449_0117525 Ga0439449_0117525_138_851 236
374 3300042876 Ga0451577_0224176 Ga0451577_0224176_484_1218 236
375 3300044712 Ga0453684_0173165 Ga0453684_0173165_1773_2507 236
376 3300045051 Ga0451576_0007766 Ga0451576_0007766_4204_4938 236
377 3300045051 Ga0451576_0356065 Ga0451576_0356065_616_1350 236
378 3300045051 Ga0451576_0931500 Ga0451576_0931500_130_864 236
379 3300045976 Ga0466967_0825801 Ga0466967_0825801_23_775 236
380 3300046463 Ga0495653_0221049 Ga0495653_0221049_223_999 236
381 3300046472 Ga0495580_0005966 Ga0495580_0005966_7248_7961 236
382 3300046473 Ga0495582_0073861 Ga0495582_0073861_839_1552 236
383 3300046517 Ga0495630_0026255 Ga0495630_0026255_1816_2559 236
384 3300046526 Ga0495666_0028262 Ga0495666_0028262_766_1509 236
385 3300046535 Ga0495586_0091509 Ga0495586_0091509_755_1468 236
386 3300046683 Ga0495658_0032112 Ga0495658_0032112_297_1010 236
387 3300047471 Ga0495684_0175764 Ga0495684_0175764_519_1232 236
388 3300048088 Ga0495602_0016602 Ga0495602_0016602_764_1540 236
389 3300048919 Ga0496116_0000189 Ga0496116_0000189_36277_36990 236
390 3300048920 Ga0496117_0013809 Ga0496117_0013809_3559_4272 236
391 3300048921 Ga0496118_0007074 Ga0496118_0007074_7013_7726 236
392 3300048924 Ga0496121_0001568 Ga0496121_0001568_1215_1928 236
393 3300048926 Ga0496123_0017067 Ga0496123_0017067_3566_4294 236
394 3300048927 Ga0496124_0012244 Ga0496124_0012244_1637_2350 236
395 3300048928 Ga0496125_0012885 Ga0496125_0012885_3612_4325 236
396 3300048929 Ga0496126_0002481 Ga0496126_0002481_9063_9776 236
397 3300049575 Ga0501039_0416726 Ga0501039_0416726_106_840 236
398 3300049576 Ga0501040_0506307 Ga0501040_0506307_98_817 236
399 3300049577 Ga0501041_0119850 Ga0501041_0119850_400_1110 236
400 3300049580 Ga0501046_0033553 Ga0501046_0033553_484_1263 236
401 3300049580 Ga0501046_0118632 Ga0501046_0118632_1104_1838 236
402 3300049582 Ga0501048_0382845 Ga0501048_0382845_31_741 236
403 3300049583 Ga0501067_0056834 Ga0501067_0056834_716_1426 236
404 3300049588 Ga0501072_0239637 Ga0501072_0239637_172_882 236
405 3300049590 Ga0501074_0282089 Ga0501074_0282089_21_755 236
406 3300049591 Ga0501075_0063704 Ga0501075_0063704_1768_2502 236
407 3300049591 Ga0501075_0069212 Ga0501075_0069212_1801_2535 236
408 3300049591 Ga0501075_0189997 Ga0501075_0189997_331_1041 236
409 3300049591 Ga0501075_0214213 Ga0501075_0214213_692_1426 236
410 3300049592 Ga0501076_0096358 Ga0501076_0096358_21_755 236
411 3300049592 Ga0501076_0228463 Ga0501076_0228463_745_1479 236
412 3300049593 Ga0501077_0029636 Ga0501077_0029636_1665_2375 236
413 3300049593 Ga0501077_0116015 Ga0501077_0116015_802_1536 236
414 3300049593 Ga0501077_0116531 Ga0501077_0116531_259_993 236
415 3300049741 Ga0501079_0044554 Ga0501079_0044554_681_1415 236
416 3300049741 Ga0501079_0051199 Ga0501079_0051199_672_1382 236
417 3300049741 Ga0501079_0323499 Ga0501079_0323499_186_920 236
418 3300049744 Ga0501083_0062269 Ga0501083_0062269_1055_1789 236
419 3300049822 Ga0501035_0217433 Ga0501035_0217433_33_767 236
420 3300049824 Ga0501045_0112138 Ga0501045_0112138_1092_1802 236
421 3300050507 nmdc:mga05p37_74300_c1 nmdc:mga05p37_74300_c1_461_1207 236
422 3300050508 nmdc:mga09592_130421_c1 nmdc:mga09592_130421_c1_652_1374 236
423 3300050509 nmdc:mga0qj67_450762_c1 nmdc:mga0qj67_450762_c1_32_778 236
424 3300050510 nmdc:mga06r32_106674_c1 nmdc:mga06r32_106674_c1_1879_2613 236
425 3300050510 nmdc:mga06r32_279547_c1 nmdc:mga06r32_279547_c1_212_922 236
426 3300050510 nmdc:mga06r32_346261_c1 nmdc:mga06r32_346261_c1_148_870 236
427 3300050511 nmdc:mga08y16_26800_c1 nmdc:mga08y16_26800_c1_1686_2417 236
428 3300050511 nmdc:mga08y16_7197_c1 nmdc:mga08y16_7197_c1_624_1349 236
429 3300050512 nmdc:mga0n895_235826_c1 nmdc:mga0n895_235826_c1_781_1515 236
430 3300050512 nmdc:mga0n895_424896_c1 nmdc:mga0n895_424896_c1_240_986 236
431 3300050512 nmdc:mga0n895_445845_c1 nmdc:mga0n895_445845_c1_307_1017 236
432 3300050513 nmdc:mga0rr50_288605_c1 nmdc:mga0rr50_288605_c1_550_1323 236
433 3300050513 nmdc:mga0rr50_381804_c1 nmdc:mga0rr50_381804_c1_178_921 236
434 3300050513 nmdc:mga0rr50_683070_c1 nmdc:mga0rr50_683070_c1_31_780 236
435 3300050514 nmdc:mga08x19_12512_c1 nmdc:mga08x19_12512_c1_2518_3261 236
436 3300050514 nmdc:mga08x19_252780_c1 nmdc:mga08x19_252780_c1_218_994 236
437 3300050514 nmdc:mga08x19_29323_c1 nmdc:mga08x19_29323_c1_1021_1755 236
438 3300050514 nmdc:mga08x19_4919_c1 nmdc:mga08x19_4919_c1_1904_2632 236
439 3300050514 nmdc:mga08x19_645_c1 nmdc:mga08x19_645_c1_20408_21151 236
440 3300050515 nmdc:mga0a205_191526_c1 nmdc:mga0a205_191526_c1_315_1025 236
441 3300054114 Ga0501084_0042565 Ga0501084_0042565_1505_2239 236
442 3300054114 Ga0501084_0161334 Ga0501084_0161334_184_894 236
443 3300060353 Ga0501082_0064634 Ga0501082_0064634_185_919 236
444 3300060353 Ga0501082_0230342 Ga0501082_0230342_447_1157 236
445 3300060353 Ga0501082_0526301 Ga0501082_0526301_145_879 236
446 3300060353 Ga0501082_0605327 Ga0501082_0605327_155_889 236
447 3300061734 Ga0530510_0088688 Ga0530510_0088688_222_932 236
448 3300061734 Ga0530510_0428567 Ga0530510_0428567_93_815 236
449 iso_pu_bacteria 2721755487 2722726856 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

80

252

0.98

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

143

250

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6st3-assembly1.cif.gz_A hif prolyl hydroxylase 2 (phd2/ egln1) in complex with 4-hydroxy-n-(4-phenoxybenzyl)-2-(1h-pyrazol-1-yl)pyrimidine-5-carboxamide 0.7125 7 229
5l9b-assembly1.cif.gz_A hif prolyl hydroxylase 2 (phd2/ egln1) in complex with 2-oxoglutarate (2og) and hif-1alpha codd (556-574) 0.6924 7 229
3oui-assembly1.cif.gz_A phd2-r717 with 40787422 0.6869 7 229
5v18-assembly1.cif.gz_A structure of phd2 in complex with 1,2,4-triazolo-[1,5-a]pyridine 0.6822 3 234
4j25-assembly7.cif.gz_G crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) 0.6781 13 236
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9476 52 235 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9423 52 235 2.60.120.590
af_Z4YHZ5_296_475_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6964 25 229 2.60.120.620
af_A0A0R0I0F2_21_185_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6899 126 231 2.60.120.10
af_Q9VVQ4_306_472_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6888 25 231 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A0A7PC52-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9941 29 236 GO:0016491
GO:0046872
AF-A0A017TEZ0-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9935 4 236
AF-A0A4V2VQR4-F1-model_v4 deleted 0.9935 4 236
AF-A0A2V6QXL5-F1-model_v4 Prolyl 4-hydroxylase subunit alpha 0.9934 22 236
AF-A0A1I2YLY0-F1-model_v4 O-6-methylguanine DNA methyltransferase 0.9933 3 236 GO:0003700
GO:0003908
GO:0006281
GO:0032259
GO:0043565

Feature Viewer

pLDDT pTM Quality
96.42 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map