F446163

General Info

Members Datasets Scaffolds Average Seq Length
448 272 896 131

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10846218|Ga0157369_108462182
Length 140
Sequence MSLPEFSAIGIAGSGMTVYRKWLDAISDNLSNMNDASPTSGPAFQAEYVQAAAQTDPGTGEGAGVAVARTVRSGDTTGRVVYEPDNPLADKDGNVRYPDIDMASQMGQMIMAQRGYEANISVIDRAKDAYEAALQLGKNV

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
142 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
217 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
220 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
267 2643221679 Angustibacter sp. Root456 Isolate Unclassified
268 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
269 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
270 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
271 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
272 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.91
Metatranscriptomes 18.53
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 5.8
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10846218 3300013105 Bacteria 939
2 JGI25406J46586_10007686 3300003203 Bacteria 4902
3 JGI25406J46586_10050703 3300003203 Bacteria 1393
4 Ga0070658_10944933 3300005327 Bacteria 750
5 Ga0070676_10686963 3300005328 Bacteria 746
6 Ga0070676_11134306 3300005328 Bacteria 592
7 Ga0070683_100002780 3300005329 Bacteria 13989
8 Ga0070683_100006849 3300005329 Bacteria 9576
9 Ga0070683_100580106 3300005329 Bacteria 1073
10 Ga0068869_100150997 3300005334 Bacteria 1802
11 Ga0070682_100401168 3300005337 Bacteria 1037
12 Ga0070682_101596756 3300005337 Bacteria 564
13 Ga0068868_100001060 3300005338 Bacteria 18838
14 Ga0070661_100017172 3300005344 Bacteria 5130
15 Ga0070692_10015980 3300005345 Bacteria 3562
16 Ga0070668_100024622 3300005347 Bacteria 4561
17 Ga0070668_100036919 3300005347 Bacteria 3730
18 Ga0070669_100032731 3300005353 Bacteria 3756
19 Ga0070675_100068194 3300005354 Bacteria 2945
20 Ga0070675_101292314 3300005354 Bacteria 672
21 Ga0070675_101537048 3300005354 Bacteria 614
22 Ga0070659_100015981 3300005366 Bacteria 5629
23 Ga0070700_100001009 3300005441 Bacteria 13911
24 Ga0070663_100005395 3300005455 Bacteria 7596
25 Ga0070663_100656221 3300005455 Bacteria 888
26 Ga0070663_100890817 3300005455 Bacteria 768
27 Ga0070678_100132096 3300005456 Bacteria 1985
28 Ga0070662_100026732 3300005457 Bacteria 3999
29 Ga0070681_10298829 3300005458 Bacteria 1520
30 Ga0070679_100384963 3300005530 Bacteria 1349
31 Ga0070684_100020415 3300005535 Bacteria 5497
32 Ga0070684_100052179 3300005535 Bacteria 3555
33 Ga0070684_100263513 3300005535 Bacteria 1577
34 Ga0070672_100608037 3300005543 Bacteria 953
35 Ga0070695_100627313 3300005545 Bacteria 846
36 Ga0070665_100323426 3300005548 Bacteria 1547
37 Ga0070665_101487884 3300005548 Bacteria 686
38 Ga0070664_100053394 3300005564 Bacteria 3425
39 Ga0070664_101538873 3300005564 Bacteria 630
40 Ga0068857_100029911 3300005577 Bacteria 4807
41 Ga0068857_100096172 3300005577 Bacteria 2654
42 Ga0070702_100357155 3300005615 Bacteria 1031
43 Ga0068852_100303321 3300005616 Bacteria 1546
44 Ga0068852_101740041 3300005616 Bacteria 646
45 Ga0068859_100088661 3300005617 Bacteria 3143
46 Ga0068864_100326135 3300005618 Bacteria 1443
47 Ga0068851_10234819 3300005834 Bacteria 1035
48 Ga0068863_100127572 3300005841 Bacteria 2428
49 Ga0068858_100740378 3300005842 Bacteria 957
50 Ga0068860_100223139 3300005843 Bacteria 1830
51 Ga0068862_100015985 3300005844 Bacteria 6239
52 Ga0068862_100070037 3300005844 Bacteria 3028
53 Ga0081455_10352015 3300005937 Bacteria 1038
54 Ga0081540_1005326 3300005983 Bacteria 9625
55 Ga0081539_10000362 3300005985 Bacteria 99991
56 Ga0081539_10002824 3300005985 Bacteria 23209
57 Ga0081539_10003288 3300005985 Bacteria 20253
58 Ga0081539_10041213 3300005985 Bacteria 2701
59 Ga0081539_10077080 3300005985 Bacteria 1764
60 Ga0070717_10133320 3300006028 Bacteria 2138
61 Ga0070717_10168348 3300006028 Bacteria 1904
62 Ga0070717_10710707 3300006028 Bacteria 913
63 Ga0070712_100935403 3300006175 Bacteria 748
64 Ga0097621_100579213 3300006237 Bacteria 1024
65 Ga0075428_100351990 3300006844 Bacteria 1581
66 Ga0075429_100075606 3300006880 Bacteria 2934
67 Ga0097620_100088662 3300006931 Bacteria 3143
68 Ga0111539_10001759 3300009094 Bacteria 28758
69 Ga0105245_10002492 3300009098 Bacteria 16613
70 Ga0105245_11288156 3300009098 Bacteria 780
71 Ga0114129_12620333 3300009147 Bacteria 601
72 Ga0105243_12582851 3300009148 Bacteria 547
73 Ga0105248_12100383 3300009177 Bacteria 642
74 Ga0105237_10397067 3300009545 Bacteria 1384
75 Ga0105237_12437131 3300009545 Bacteria 533
76 Ga0105249_10054519 3300009553 Bacteria 3656
77 Ga0105249_10644409 3300009553 Bacteria 1117
78 Ga0105239_10263729 3300010375 Bacteria 1936
79 Ga0105239_11595727 3300010375 Bacteria 755
80 Ga0105246_10124027 3300011119 Bacteria 1919
81 Ga0105246_10555518 3300011119 Bacteria 985
82 Ga0157371_10080479 3300013102 Bacteria 2307
83 Ga0157369_10040573 3300013105 Bacteria 5081
84 Ga0157369_10393040 3300013105 Bacteria 1439
85 Ga0157369_10917296 3300013105 Bacteria 898
86 Ga0157369_11252621 3300013105 Bacteria 756
87 Ga0163162_10141896 3300013306 Bacteria 2516
88 Ga0163162_11576656 3300013306 Bacteria 749
89 Ga0163162_12327135 3300013306 Bacteria 616
90 Ga0157372_11022799 3300013307 Bacteria 957
91 Ga0157372_12046792 3300013307 Bacteria 658
92 Ga0157372_12430129 3300013307 Bacteria 602
93 Ga0157375_10724684 3300013308 Bacteria 1147
94 Ga0157375_12004967 3300013308 Bacteria 688
95 Ga0163163_10319507 3300014325 Bacteria 1606
96 Ga0163163_11803419 3300014325 Bacteria 672
97 Ga0157380_10234019 3300014326 Bacteria 1652
98 Ga0182008_10236908 3300014497 Bacteria 938
99 Ga0157377_10004125 3300014745 Bacteria 6637
100 Ga0157376_11413150 3300014969 Bacteria 728
101 Ga0157376_12949292 3300014969 Bacteria 515
102 Ga0197907_11141036 3300020069 Bacteria 853
103 Ga0206349_1301316 3300020075 Bacteria 564
104 Ga0206349_1439826 3300020075 Bacteria 714
105 Ga0206351_10232735 3300020077 Bacteria 813
106 Ga0206352_10520262 3300020078 Bacteria 1571
107 Ga0206352_10753801 3300020078 Bacteria 769
108 Ga0206352_10888319 3300020078 Bacteria 995
109 Ga0206353_10324810 3300020082 Bacteria 1570
110 Ga0224712_10113784 3300022467 Bacteria 1164
111 Ga0207656_10103158 3300025321 Bacteria 1310
112 Ga0207645_10577879 3300025907 Bacteria 763
113 Ga0207643_10546993 3300025908 Bacteria 743
114 Ga0207707_10178580 3300025912 Bacteria 1854
115 Ga0207695_11293763 3300025913 Bacteria 609
116 Ga0207671_10172699 3300025914 Bacteria 1679
117 Ga0207660_10300770 3300025917 Bacteria 1277
118 Ga0207657_10174332 3300025919 Bacteria 1741
119 Ga0207649_11093924 3300025920 Bacteria 629
120 Ga0207652_11656981 3300025921 Bacteria 544
121 Ga0207681_10018356 3300025923 Bacteria 4408
122 Ga0207659_10029724 3300025926 Bacteria 3727
123 Ga0207659_10520229 3300025926 Bacteria 1009
124 Ga0207659_10798847 3300025926 Bacteria 810
125 Ga0207659_11023666 3300025926 Bacteria 711
126 Ga0207687_10002762 3300025927 Bacteria 11903
127 Ga0207700_11557201 3300025928 Bacteria 586
128 Ga0207706_10002613 3300025933 Bacteria 17538
129 Ga0207669_10303451 3300025937 Bacteria 1215
130 Ga0207704_10254783 3300025938 Bacteria 1320
131 Ga0207691_10769001 3300025940 Bacteria 810
132 Ga0207689_10182634 3300025942 Unclassified 1730
133 Ga0207661_10004932 3300025944 Bacteria 9358
134 Ga0207661_10095882 3300025944 Bacteria 2481
135 Ga0207679_10025580 3300025945 Bacteria 4062
136 Ga0207679_10052380 3300025945 Bacteria 2993
137 Ga0207679_10356298 3300025945 Bacteria 1277
138 Ga0207712_10046461 3300025961 Bacteria 3010
139 Ga0207668_10008026 3300025972 Bacteria 6284
140 Ga0207668_10160484 3300025972 Bacteria 1751
141 Ga0207640_11422462 3300025981 Bacteria 622
142 Ga0207658_11672151 3300025986 Bacteria 582
143 Ga0207677_10004035 3300026023 Bacteria 7837
144 Ga0207677_10218481 3300026023 Bacteria 1527
145 Ga0207703_11322942 3300026035 Bacteria 693
146 Ga0207678_10024699 3300026067 Bacteria 5247
147 Ga0207678_10208322 3300026067 Bacteria 1672
148 Ga0207678_10441907 3300026067 Bacteria 1130
149 Ga0207678_10560746 3300026067 Bacteria 999
150 Ga0207678_11744629 3300026067 Bacteria 546
151 Ga0207708_10004150 3300026075 Bacteria 10657
152 Ga0207702_10351769 3300026078 Bacteria 1410
153 Ga0207702_10608207 3300026078 Bacteria 1073
154 Ga0207641_10090360 3300026088 Bacteria 2678
155 Ga0207676_10211127 3300026095 Bacteria 1722
156 Ga0207674_10030790 3300026116 Bacteria 5640
157 Ga0207674_10188443 3300026116 Bacteria 2013
158 Ga0207674_10786543 3300026116 Bacteria 918
159 Ga0207675_100177256 3300026118 Bacteria 2040
160 Ga0207683_10161047 3300026121 Bacteria 2029
161 Ga0207683_10265347 3300026121 Bacteria 1568
162 Ga0207698_10124283 3300026142 Bacteria 2191
163 Ga0207698_10607855 3300026142 Bacteria 1078
164 Ga0207428_10104526 3300027907 Bacteria 2185
165 Ga0268266_10049404 3300028379 Bacteria 3608
166 Ga0268266_10487527 3300028379 Bacteria 1176
167 Ga0268265_10004616 3300028380 Bacteria 9513
168 Ga0268265_10028142 3300028380 Bacteria 4021
169 Ga0268264_10266392 3300028381 Bacteria 1599
170 Ga0307517_10047903 3300028786 Bacteria 4414
171 Ga0307515_10000119 3300028794 Bacteria 189566
172 Ga0307515_10040300 3300028794 Bacteria 7391
173 Ga0307515_10055224 3300028794 Bacteria 5809
174 Ga0307515_10209713 3300028794 Bacteria 1796
175 Ga0307512_10003106 3300030522 Bacteria 19822
176 Ga0307513_10008871 3300031456 Bacteria 12789
177 Ga0307513_10026848 3300031456 Bacteria 6624
178 Ga0307509_10005061 3300031507 Bacteria 18554
179 Ga0307508_10003140 3300031616 Bacteria 16931
180 Ga0307508_10090907 3300031616 Bacteria 2640
181 Ga0307508_10119274 3300031616 Bacteria 2240
182 Ga0307516_10000149 3300031730 Bacteria 86821
183 Ga0307516_10013158 3300031730 Bacteria 8838
184 Ga0307516_10114125 3300031730 Bacteria 2499
185 Ga0307516_10185475 3300031730 Bacteria 1811
186 Ga0307516_10573776 3300031730 Bacteria 782
187 Ga0307405_10104399 3300031731 Bacteria 1907
188 Ga0307413_10049447 3300031824 Bacteria 2520
189 Ga0307413_10105968 3300031824 Bacteria 1870
190 Ga0307413_10116905 3300031824 Bacteria 1798
191 Ga0307413_10150128 3300031824 Bacteria 1622
192 Ga0307410_10131340 3300031852 Bacteria 1840
193 Ga0307410_10223519 3300031852 Bacteria 1450
194 Ga0307410_11501611 3300031852 Bacteria 593
195 Ga0326468_10001613 3300031889 Bacteria 1940
196 Ga0307406_10011658 3300031901 Bacteria 4990
197 Ga0307406_10036451 3300031901 Bacteria 3031
198 Ga0307406_10043567 3300031901 Bacteria 2808
199 Ga0307406_10431467 3300031901 Bacteria 1052
200 Ga0307406_10482487 3300031901 Bacteria 1001
201 Ga0307406_10507759 3300031901 Bacteria 979
202 Ga0307406_10862853 3300031901 Bacteria 768
203 Ga0307409_100004646 3300031995 Bacteria 7758
204 Ga0307409_100120215 3300031995 Bacteria 2223
205 Ga0307409_100265943 3300031995 Bacteria 1577
206 Ga0307409_100490839 3300031995 Bacteria 1194
207 Ga0307409_100682489 3300031995 Bacteria 1024
208 Ga0307409_100875957 3300031995 Bacteria 910
209 Ga0307409_102775917 3300031995 Bacteria 518
210 Ga0307416_100066611 3300032002 Bacteria 2966
211 Ga0307416_100201451 3300032002 Bacteria 1889
212 Ga0307414_10477538 3300032004 Bacteria 1099
213 Ga0307411_11194580 3300032005 Bacteria 689
214 Ga0307411_11399790 3300032005 Bacteria 640
215 Ga0307411_11447976 3300032005 Bacteria 630
216 Ga0307415_100009658 3300032126 Bacteria 5424
217 Ga0307415_100021540 3300032126 Bacteria 3964
218 Ga0307415_100063268 3300032126 Bacteria 2570
219 Ga0307415_100072938 3300032126 Bacteria 2420
220 Ga0307415_100077328 3300032126 Bacteria 2363
221 Ga0307415_100294282 3300032126 Bacteria 1342
222 Ga0307415_100533648 3300032126 Bacteria 1032
223 Ga0307415_100564799 3300032126 Bacteria 1006
224 Ga0307415_101775638 3300032126 Bacteria 596
225 Ga0307507_10019691 3300033179 Bacteria 7591
226 Ga0307510_10120255 3300033180 Bacteria 2334
227 Ga0373948_0005091 3300034817 Bacteria 2111
228 Ga0373938_0008425 3300034957 Bacteria 1841
229 Ga0373940_0023307 3300035088 Bacteria 1596
230 Ga0373951_0037008 3300035091 Bacteria 1166
231 Ga0373939_0289382 3300035114 Bacteria 650
232 Ga0373941_0217192 3300035115 Bacteria 733
233 Ga0373956_0002629 3300035119 Bacteria 7275
234 Ga0373942_0000067 3300035207 Bacteria 21955
235 Ga0373962_0002536 3300035242 Bacteria 4333
236 Ga0373935_0031206 3300035692 Bacteria 3306
237 Ga0395898_0115712 3300037466 Bacteria 2569
238 Ga0436364_0379070 3300037853 Bacteria 1788
239 Ga0395901_0247455 3300038443 Bacteria 1858
240 Ga0451793_1205411 3300041452 Bacteria 2072
241 Ga0451795_1361924 3300041456 Bacteria 504
242 Ga0451804_0136290 3300041463 Bacteria 566
243 Ga0451835_0590597 3300041492 Bacteria 572
244 Ga0451845_0384721 3300041501 Bacteria 854
245 Ga0451843_1186491 3300041509 Bacteria 965
246 Ga0451843_1419315 3300041509 Bacteria 624
247 Ga0451853_1252201 3300041512 Bacteria 11661
248 Ga0451853_3873317 3300041512 Bacteria 510
249 Ga0439448_0145186 3300042005 Bacteria 822
250 Ga0439463_026993 3300042016 Bacteria 1444
251 Ga0466969_0079330 3300044656 Bacteria 1569
252 Ga0466972_0215338 3300044658 Bacteria 899
253 Ga0466965_0058041 3300044683 Bacteria 1930
254 Ga0466966_0132299 3300044684 Bacteria 1527
255 Ga0466966_0276393 3300044684 Bacteria 1010
256 Ga0466963_0149317 3300044694 Bacteria 1622
257 Ga0466968_0042402 3300044735 Bacteria 1924
258 Ga0466970_0071194 3300044765 Bacteria 1870
259 Ga0466970_0918687 3300044765 Bacteria 515
260 Ga0466957_0045428 3300044842 Bacteria 2664
261 Ga0466960_0079531 3300044901 Bacteria 1649
262 Ga0466959_0187026 3300045049 Bacteria 1446
263 Ga0466958_0026155 3300045836 Bacteria 3447
264 Ga0466958_0731146 3300045836 Bacteria 645
265 Ga0466967_0003225 3300045976 Bacteria 10547
266 Ga0466967_0114060 3300045976 Bacteria 2487
267 Ga0466967_0235214 3300045976 Bacteria 1746
268 Ga0466967_0283011 3300045976 Bacteria 1591
269 Ga0466967_1065362 3300045976 Bacteria 805
270 Ga0495582_0646432 3300046473 Bacteria 612
271 Ga0495606_0041862 3300046507 Bacteria 3069
272 Ga0495606_0211231 3300046507 Bacteria 1099
273 Ga0495608_0126938 3300046511 Bacteria 1634
274 Ga0495632_0425418 3300046519 Bacteria 578
275 Ga0495646_0163062 3300046680 Bacteria 1233
276 Ga0495649_0298644 3300046694 Bacteria 820
277 Ga0495581_0316357 3300047315 Bacteria 912
278 Ga0495680_0263777 3300047322 Bacteria 1218
279 Ga0496100_0050920 3300048903 Bacteria 2686
280 Ga0496100_0164597 3300048903 Bacteria 1592
281 Ga0496101_0040689 3300048904 Bacteria 3311
282 Ga0496101_0639971 3300048904 Bacteria 840
283 Ga0496101_0750289 3300048904 Bacteria 770
284 Ga0496102_0087054 3300048905 Bacteria 2886
285 Ga0496103_0037823 3300048906 Bacteria 2959
286 Ga0496103_0162939 3300048906 Bacteria 1431
287 Ga0496104_0391307 3300048907 Bacteria 1302
288 Ga0496104_0497126 3300048907 Bacteria 1131
289 Ga0496105_0087612 3300048908 Bacteria 2572
290 Ga0496105_0234378 3300048908 Bacteria 1491
291 Ga0496107_0104894 3300048910 Bacteria 2075
292 Ga0496108_0147376 3300048911 Bacteria 2030
293 Ga0496108_0823730 3300048911 Bacteria 800
294 Ga0496109_0427515 3300048912 Bacteria 1251
295 Ga0496109_1345848 3300048912 Bacteria 650
296 Ga0496109_1646871 3300048912 Bacteria 576
297 Ga0496110_0396781 3300048913 Bacteria 1258
298 Ga0496110_1403679 3300048913 Bacteria 608
299 Ga0496114_0110550 3300048917 Bacteria 2354
300 Ga0496115_0404320 3300048918 Bacteria 1107
301 Ga0496115_0679568 3300048918 Bacteria 811
302 Ga0496126_0097151 3300048929 Bacteria 2582
303 Ga0501032_0006411 3300049569 Bacteria 8658
304 Ga0501032_0354671 3300049569 Bacteria 945
305 Ga0501032_0405289 3300049569 Bacteria 876
306 Ga0501033_0022254 3300049570 Bacteria 4783
307 Ga0501033_0159261 3300049570 Bacteria 1625
308 Ga0501033_0189726 3300049570 Bacteria 1471
309 Ga0501033_0199225 3300049570 Bacteria 1431
310 Ga0501033_0307179 3300049570 Bacteria 1116
311 Ga0501033_0677828 3300049570 Bacteria 703
312 Ga0501034_0542016 3300049571 Bacteria 1073
313 Ga0501036_0016661 3300049572 Bacteria 6136
314 Ga0501036_0785169 3300049572 Bacteria 785
315 Ga0501037_0010555 3300049573 Bacteria 6784
316 Ga0501038_0012832 3300049574 Bacteria 7649
317 Ga0501039_0008251 3300049575 Bacteria 7936
318 Ga0501042_0032110 3300049578 Bacteria 3716
319 Ga0501042_0198184 3300049578 Bacteria 1448
320 Ga0501042_0712717 3300049578 Bacteria 730
321 Ga0501043_0017008 3300049579 Bacteria 5701
322 Ga0501043_0185788 3300049579 Bacteria 1618
323 Ga0501043_0966820 3300049579 Bacteria 608
324 Ga0501046_0009522 3300049580 Bacteria 8396
325 Ga0501046_0010744 3300049580 Bacteria 7852
326 Ga0501047_0034498 3300049581 Bacteria 4885
327 Ga0501047_0128516 3300049581 Bacteria 2414
328 Ga0501047_0223916 3300049581 Bacteria 1736
329 Ga0501047_0316030 3300049581 Bacteria 1402
330 Ga0501047_0452142 3300049581 Bacteria 1114
331 Ga0501069_0398680 3300049585 Bacteria 814
332 Ga0501070_0058168 3300049586 Bacteria 3204
333 Ga0501070_0931282 3300049586 Bacteria 677
334 Ga0501071_0213958 3300049587 Bacteria 1450
335 Ga0501079_0747510 3300049741 Bacteria 770
336 Ga0501080_0007275 3300049742 Bacteria 9988
337 Ga0501083_0000019 3300049744 Bacteria 147154
338 Ga0501083_0006192 3300049744 Bacteria 8488
339 Ga0501035_0039807 3300049822 Bacteria 4252
340 Ga0501035_0262401 3300049822 Bacteria 1464
341 Ga0501035_0346578 3300049822 Bacteria 1243
342 Ga0501035_1319405 3300049822 Bacteria 556
343 Ga0501044_0010598 3300049823 Bacteria 9999
344 Ga0501044_0134379 3300049823 Bacteria 2466
345 Ga0501044_0611390 3300049823 Bacteria 982
346 nmdc:mga05p37_607455_c1 3300050507 Bacteria 1233
347 nmdc:mga09592_546453_c1 3300050508 Bacteria 995
348 nmdc:mga08y16_5839_c1 3300050511 Bacteria 12900
349 nmdc:mga0a205_1001105_c1 3300050515 Bacteria 683
350 Ga0500646_0207539 3300053090 Bacteria 675
351 Ga0500651_0101749 3300053093 Bacteria 1761
352 Ga0500641_0222270 3300053096 Bacteria 800
353 Ga0500556_0280974 3300053104 Bacteria 653
354 Ga0500562_088728 3300053108 Bacteria 839
355 Ga0500652_005553 3300053131 Bacteria 3982
356 Ga0500559_0001800 3300053136 Bacteria 11749
357 Ga0500559_0176397 3300053136 Bacteria 1006
358 Ga0500568_0000975 3300053139 Bacteria 19702
359 Ga0500573_0083533 3300053140 Bacteria 1813
360 Ga0500577_0002328 3300053142 Bacteria 4837
361 Ga0500588_0004793 3300053146 Bacteria 2954
362 Ga0500588_0132066 3300053146 Bacteria 890
363 Ga0500630_063922 3300053159 Bacteria 1754
364 Ga0500633_0170845 3300053160 Bacteria 816
365 Ga0500611_032783 3300053727 Bacteria 1089
366 Ga0587084_000857 3300059477 Bacteria 2648
367 Ga0587084_046804 3300059477 Bacteria 754
368 Ga0587093_026054 3300059478 Bacteria 814
369 Ga0587070_015867 3300059491 Bacteria 1199
370 Ga0587073_0016881 3300059492 Bacteria 1339
371 Ga0587073_0158503 3300059492 Bacteria 646
372 Ga0587077_010746 3300059493 Bacteria 1423
373 Ga0587077_076600 3300059493 Bacteria 759
374 Ga0587080_055418 3300059503 Bacteria 759
375 Ga0587080_072577 3300059503 Bacteria 691
376 Ga0587082_043882 3300059504 Bacteria 830
377 Ga0587083_0005333 3300059505 Bacteria 1852
378 Ga0587085_003788 3300059506 Bacteria 1675
379 Ga0587085_018375 3300059506 Bacteria 1036
380 Ga0587086_002967 3300059507 Bacteria 1666
381 Ga0587086_011292 3300059507 Bacteria 1093
382 Ga0587086_032059 3300059507 Bacteria 778
383 Ga0587088_006166 3300059508 Bacteria 1606
384 Ga0587088_026825 3300059508 Bacteria 1003
385 Ga0587088_062085 3300059508 Bacteria 759
386 Ga0587089_005228 3300059509 Bacteria 1462
387 Ga0587090_000243 3300059510 Bacteria 4040
388 Ga0587090_045596 3300059510 Bacteria 787
389 Ga0587090_071038 3300059510 Bacteria 680
390 Ga0587090_088625 3300059510 Bacteria 631
391 Ga0587091_013390 3300059511 Bacteria 1316
392 Ga0587092_003243 3300059512 Bacteria 1830
393 Ga0587092_012591 3300059512 Bacteria 1196
394 Ga0587094_002847 3300059513 Bacteria 1823
395 Ga0587098_003421 3300059604 Bacteria 1426
396 Ga0587106_002357 3300059605 Bacteria 1842
397 Ga0587125_004565 3300059607 Bacteria 1236
398 Ga0587125_008990 3300059607 Bacteria 1003
399 Ga0587129_003774 3300059608 Bacteria 970
400 Ga0587099_006416 3300059622 Bacteria 1087
401 Ga0587101_001077 3300059623 Bacteria 2225
402 Ga0587101_017089 3300059623 Bacteria 1001
403 Ga0587101_033045 3300059623 Bacteria 817
404 Ga0587101_142498 3300059623 Bacteria 513
405 Ga0587109_026182 3300059624 Bacteria 1077
406 Ga0587109_043724 3300059624 Bacteria 897
407 Ga0587109_047796 3300059624 Bacteria 868
408 Ga0587115_012351 3300059626 Bacteria 1090
409 Ga0587115_041316 3300059626 Bacteria 721
410 Ga0587115_070887 3300059626 Bacteria 602
411 Ga0587117_005693 3300059627 Bacteria 1359
412 Ga0587117_022858 3300059627 Bacteria 886
413 Ga0587127_005302 3300059629 Bacteria 882
414 Ga0587128_001515 3300059630 Bacteria 2214
415 Ga0587128_005089 3300059630 Bacteria 1556
416 Ga0587130_034757 3300059631 Bacteria 592
417 Ga0587062_001137 3300059639 Bacteria 2191
418 Ga0587062_045594 3300059639 Bacteria 726
419 Ga0587068_003361 3300059641 Bacteria 2036
420 Ga0587072_012005 3300059643 Bacteria 1425
421 Ga0587075_004459 3300059644 Bacteria 1629
422 Ga0587076_028827 3300059645 Bacteria 971
423 Ga0587079_049189 3300059647 Bacteria 879
424 Ga0587100_001388 3300059648 Bacteria 1410
425 Ga0587105_014893 3300059651 Bacteria 634
426 Ga0587107_002926 3300059652 Bacteria 1602
427 Ga0587107_029614 3300059652 Bacteria 825
428 Ga0587108_003772 3300059653 Bacteria 1085
429 Ga0587114_012599 3300059655 Bacteria 1074
430 Ga0587116_04510 3300059656 Bacteria 813
431 Ga0587116_06183 3300059656 Bacteria 734
432 Ga0587119_006966 3300059658 Bacteria 1207
433 Ga0587124_001040 3300059660 Bacteria 1718
434 Ga0587124_004737 3300059660 Bacteria 1061
435 Ga0587071_003192 3300060344 Bacteria 2323
436 Ga0587071_126773 3300060344 Bacteria 615
437 Ga0587111_0001508 3300060346 Bacteria 2826
438 Ga0587111_0002321 3300060346 Bacteria 2514
439 Ga0587111_0017713 3300060346 Bacteria 1331
440 Ga0501082_0542762 3300060353 Bacteria 1017
441 Ga0466962_0030748 3300061719 Bacteria 2571
442 2537899663 2537561592 Bacteria 4348607
443 2644443893 2643221679 Bacteria 3839507
444 2753269952 2751185782 Bacteria 11227053
445 2810363072 2808606700 Bacteria 3482157
446 2939660682 2939657138 Bacteria 3740283
447 2946006926 2946003308 Bacteria 3857229
448 8004027521 8004025490 Bacteria 4327753
449 Ga0157369_10846218
450 JGI25406J46586_10007686
451 JGI25406J46586_10050703
452 Ga0070658_10944933
453 Ga0070676_10686963
454 Ga0070676_11134306
455 Ga0070683_100002780
456 Ga0070683_100006849
457 Ga0070683_100580106
458 Ga0068869_100150997
459 Ga0070682_100401168
460 Ga0070682_101596756
461 Ga0068868_100001060
462 Ga0070661_100017172
463 Ga0070692_10015980
464 Ga0070668_100024622
465 Ga0070668_100036919
466 Ga0070669_100032731
467 Ga0070675_100068194
468 Ga0070675_101292314
469 Ga0070675_101537048
470 Ga0070659_100015981
471 Ga0070700_100001009
472 Ga0070663_100005395
473 Ga0070663_100656221
474 Ga0070663_100890817
475 Ga0070678_100132096
476 Ga0070662_100026732
477 Ga0070681_10298829
478 Ga0070679_100384963
479 Ga0070684_100020415
480 Ga0070684_100052179
481 Ga0070684_100263513
482 Ga0070672_100608037
483 Ga0070695_100627313
484 Ga0070665_100323426
485 Ga0070665_101487884
486 Ga0070664_100053394
487 Ga0070664_101538873
488 Ga0068857_100029911
489 Ga0068857_100096172
490 Ga0070702_100357155
491 Ga0068852_100303321
492 Ga0068852_101740041
493 Ga0068859_100088661
494 Ga0068864_100326135
495 Ga0068851_10234819
496 Ga0068863_100127572
497 Ga0068858_100740378
498 Ga0068860_100223139
499 Ga0068862_100015985
500 Ga0068862_100070037
501 Ga0081455_10352015
502 Ga0081540_1005326
503 Ga0081539_10000362
504 Ga0081539_10002824
505 Ga0081539_10003288
506 Ga0081539_10041213
507 Ga0081539_10077080
508 Ga0070717_10133320
509 Ga0070717_10168348
510 Ga0070717_10710707
511 Ga0070712_100935403
512 Ga0097621_100579213
513 Ga0075428_100351990
514 Ga0075429_100075606
515 Ga0097620_100088662
516 Ga0111539_10001759
517 Ga0105245_10002492
518 Ga0105245_11288156
519 Ga0114129_12620333
520 Ga0105243_12582851
521 Ga0105248_12100383
522 Ga0105237_10397067
523 Ga0105237_12437131
524 Ga0105249_10054519
525 Ga0105249_10644409
526 Ga0105239_10263729
527 Ga0105239_11595727
528 Ga0105246_10124027
529 Ga0105246_10555518
530 Ga0157371_10080479
531 Ga0157369_10040573
532 Ga0157369_10393040
533 Ga0157369_10917296
534 Ga0157369_11252621
535 Ga0163162_10141896
536 Ga0163162_11576656
537 Ga0163162_12327135
538 Ga0157372_11022799
539 Ga0157372_12046792
540 Ga0157372_12430129
541 Ga0157375_10724684
542 Ga0157375_12004967
543 Ga0163163_10319507
544 Ga0163163_11803419
545 Ga0157380_10234019
546 Ga0182008_10236908
547 Ga0157377_10004125
548 Ga0157376_11413150
549 Ga0157376_12949292
550 Ga0197907_11141036
551 Ga0206349_1301316
552 Ga0206349_1439826
553 Ga0206351_10232735
554 Ga0206352_10520262
555 Ga0206352_10753801
556 Ga0206352_10888319
557 Ga0206353_10324810
558 Ga0224712_10113784
559 Ga0207656_10103158
560 Ga0207645_10577879
561 Ga0207643_10546993
562 Ga0207707_10178580
563 Ga0207695_11293763
564 Ga0207671_10172699
565 Ga0207660_10300770
566 Ga0207657_10174332
567 Ga0207649_11093924
568 Ga0207652_11656981
569 Ga0207681_10018356
570 Ga0207659_10029724
571 Ga0207659_10520229
572 Ga0207659_10798847
573 Ga0207659_11023666
574 Ga0207687_10002762
575 Ga0207700_11557201
576 Ga0207706_10002613
577 Ga0207669_10303451
578 Ga0207704_10254783
579 Ga0207691_10769001
580 Ga0207689_10182634
581 Ga0207661_10004932
582 Ga0207661_10095882
583 Ga0207679_10025580
584 Ga0207679_10052380
585 Ga0207679_10356298
586 Ga0207712_10046461
587 Ga0207668_10008026
588 Ga0207668_10160484
589 Ga0207640_11422462
590 Ga0207658_11672151
591 Ga0207677_10004035
592 Ga0207677_10218481
593 Ga0207703_11322942
594 Ga0207678_10024699
595 Ga0207678_10208322
596 Ga0207678_10441907
597 Ga0207678_10560746
598 Ga0207678_11744629
599 Ga0207708_10004150
600 Ga0207702_10351769
601 Ga0207702_10608207
602 Ga0207641_10090360
603 Ga0207676_10211127
604 Ga0207674_10030790
605 Ga0207674_10188443
606 Ga0207674_10786543
607 Ga0207675_100177256
608 Ga0207683_10161047
609 Ga0207683_10265347
610 Ga0207698_10124283
611 Ga0207698_10607855
612 Ga0207428_10104526
613 Ga0268266_10049404
614 Ga0268266_10487527
615 Ga0268265_10004616
616 Ga0268265_10028142
617 Ga0268264_10266392
618 Ga0307517_10047903
619 Ga0307515_10000119
620 Ga0307515_10040300
621 Ga0307515_10055224
622 Ga0307515_10209713
623 Ga0307512_10003106
624 Ga0307513_10008871
625 Ga0307513_10026848
626 Ga0307509_10005061
627 Ga0307508_10003140
628 Ga0307508_10090907
629 Ga0307508_10119274
630 Ga0307516_10000149
631 Ga0307516_10013158
632 Ga0307516_10114125
633 Ga0307516_10185475
634 Ga0307516_10573776
635 Ga0307405_10104399
636 Ga0307413_10049447
637 Ga0307413_10105968
638 Ga0307413_10116905
639 Ga0307413_10150128
640 Ga0307410_10131340
641 Ga0307410_10223519
642 Ga0307410_11501611
643 Ga0326468_10001613
644 Ga0307406_10011658
645 Ga0307406_10036451
646 Ga0307406_10043567
647 Ga0307406_10431467
648 Ga0307406_10482487
649 Ga0307406_10507759
650 Ga0307406_10862853
651 Ga0307409_100004646
652 Ga0307409_100120215
653 Ga0307409_100265943
654 Ga0307409_100490839
655 Ga0307409_100682489
656 Ga0307409_100875957
657 Ga0307409_102775917
658 Ga0307416_100066611
659 Ga0307416_100201451
660 Ga0307414_10477538
661 Ga0307411_11194580
662 Ga0307411_11399790
663 Ga0307411_11447976
664 Ga0307415_100009658
665 Ga0307415_100021540
666 Ga0307415_100063268
667 Ga0307415_100072938
668 Ga0307415_100077328
669 Ga0307415_100294282
670 Ga0307415_100533648
671 Ga0307415_100564799
672 Ga0307415_101775638
673 Ga0307507_10019691
674 Ga0307510_10120255
675 Ga0373948_0005091
676 Ga0373938_0008425
677 Ga0373940_0023307
678 Ga0373951_0037008
679 Ga0373939_0289382
680 Ga0373941_0217192
681 Ga0373956_0002629
682 Ga0373942_0000067
683 Ga0373962_0002536
684 Ga0373935_0031206
685 Ga0395898_0115712
686 Ga0436364_0379070
687 Ga0395901_0247455
688 Ga0451793_1205411
689 Ga0451795_1361924
690 Ga0451804_0136290
691 Ga0451835_0590597
692 Ga0451845_0384721
693 Ga0451843_1186491
694 Ga0451843_1419315
695 Ga0451853_1252201
696 Ga0451853_3873317
697 Ga0439448_0145186
698 Ga0439463_026993
699 Ga0466969_0079330
700 Ga0466972_0215338
701 Ga0466965_0058041
702 Ga0466966_0132299
703 Ga0466966_0276393
704 Ga0466963_0149317
705 Ga0466968_0042402
706 Ga0466970_0071194
707 Ga0466970_0918687
708 Ga0466957_0045428
709 Ga0466960_0079531
710 Ga0466959_0187026
711 Ga0466958_0026155
712 Ga0466958_0731146
713 Ga0466967_0003225
714 Ga0466967_0114060
715 Ga0466967_0235214
716 Ga0466967_0283011
717 Ga0466967_1065362
718 Ga0495582_0646432
719 Ga0495606_0041862
720 Ga0495606_0211231
721 Ga0495608_0126938
722 Ga0495632_0425418
723 Ga0495646_0163062
724 Ga0495649_0298644
725 Ga0495581_0316357
726 Ga0495680_0263777
727 Ga0496100_0050920
728 Ga0496100_0164597
729 Ga0496101_0040689
730 Ga0496101_0639971
731 Ga0496101_0750289
732 Ga0496102_0087054
733 Ga0496103_0037823
734 Ga0496103_0162939
735 Ga0496104_0391307
736 Ga0496104_0497126
737 Ga0496105_0087612
738 Ga0496105_0234378
739 Ga0496107_0104894
740 Ga0496108_0147376
741 Ga0496108_0823730
742 Ga0496109_0427515
743 Ga0496109_1345848
744 Ga0496109_1646871
745 Ga0496110_0396781
746 Ga0496110_1403679
747 Ga0496114_0110550
748 Ga0496115_0404320
749 Ga0496115_0679568
750 Ga0496126_0097151
751 Ga0501032_0006411
752 Ga0501032_0354671
753 Ga0501032_0405289
754 Ga0501033_0022254
755 Ga0501033_0159261
756 Ga0501033_0189726
757 Ga0501033_0199225
758 Ga0501033_0307179
759 Ga0501033_0677828
760 Ga0501034_0542016
761 Ga0501036_0016661
762 Ga0501036_0785169
763 Ga0501037_0010555
764 Ga0501038_0012832
765 Ga0501039_0008251
766 Ga0501042_0032110
767 Ga0501042_0198184
768 Ga0501042_0712717
769 Ga0501043_0017008
770 Ga0501043_0185788
771 Ga0501043_0966820
772 Ga0501046_0009522
773 Ga0501046_0010744
774 Ga0501047_0034498
775 Ga0501047_0128516
776 Ga0501047_0223916
777 Ga0501047_0316030
778 Ga0501047_0452142
779 Ga0501069_0398680
780 Ga0501070_0058168
781 Ga0501070_0931282
782 Ga0501071_0213958
783 Ga0501079_0747510
784 Ga0501080_0007275
785 Ga0501083_0000019
786 Ga0501083_0006192
787 Ga0501035_0039807
788 Ga0501035_0262401
789 Ga0501035_0346578
790 Ga0501035_1319405
791 Ga0501044_0010598
792 Ga0501044_0134379
793 Ga0501044_0611390
794 nmdc:mga05p37_607455_c1
795 nmdc:mga09592_546453_c1
796 nmdc:mga08y16_5839_c1
797 nmdc:mga0a205_1001105_c1
798 Ga0500646_0207539
799 Ga0500651_0101749
800 Ga0500641_0222270
801 Ga0500556_0280974
802 Ga0500562_088728
803 Ga0500652_005553
804 Ga0500559_0001800
805 Ga0500559_0176397
806 Ga0500568_0000975
807 Ga0500573_0083533
808 Ga0500577_0002328
809 Ga0500588_0004793
810 Ga0500588_0132066
811 Ga0500630_063922
812 Ga0500633_0170845
813 Ga0500611_032783
814 Ga0587084_000857
815 Ga0587084_046804
816 Ga0587093_026054
817 Ga0587070_015867
818 Ga0587073_0016881
819 Ga0587073_0158503
820 Ga0587077_010746
821 Ga0587077_076600
822 Ga0587080_055418
823 Ga0587080_072577
824 Ga0587082_043882
825 Ga0587083_0005333
826 Ga0587085_003788
827 Ga0587085_018375
828 Ga0587086_002967
829 Ga0587086_011292
830 Ga0587086_032059
831 Ga0587088_006166
832 Ga0587088_026825
833 Ga0587088_062085
834 Ga0587089_005228
835 Ga0587090_000243
836 Ga0587090_045596
837 Ga0587090_071038
838 Ga0587090_088625
839 Ga0587091_013390
840 Ga0587092_003243
841 Ga0587092_012591
842 Ga0587094_002847
843 Ga0587098_003421
844 Ga0587106_002357
845 Ga0587125_004565
846 Ga0587125_008990
847 Ga0587129_003774
848 Ga0587099_006416
849 Ga0587101_001077
850 Ga0587101_017089
851 Ga0587101_033045
852 Ga0587101_142498
853 Ga0587109_026182
854 Ga0587109_043724
855 Ga0587109_047796
856 Ga0587115_012351
857 Ga0587115_041316
858 Ga0587115_070887
859 Ga0587117_005693
860 Ga0587117_022858
861 Ga0587127_005302
862 Ga0587128_001515
863 Ga0587128_005089
864 Ga0587130_034757
865 Ga0587062_001137
866 Ga0587062_045594
867 Ga0587068_003361
868 Ga0587072_012005
869 Ga0587075_004459
870 Ga0587076_028827
871 Ga0587079_049189
872 Ga0587100_001388
873 Ga0587105_014893
874 Ga0587107_002926
875 Ga0587107_029614
876 Ga0587108_003772
877 Ga0587114_012599
878 Ga0587116_04510
879 Ga0587116_06183
880 Ga0587119_006966
881 Ga0587124_001040
882 Ga0587124_004737
883 Ga0587071_003192
884 Ga0587071_126773
885 Ga0587111_0001508
886 Ga0587111_0002321
887 Ga0587111_0017713
888 Ga0501082_0542762
889 Ga0466962_0030748
890 2537899663
891 2644443893
892 2753269952
893 2810363072
894 2939660682
895 2946006926
896 8004027521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

91

136

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.848 2 128
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.8394 5 130
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8323 2 126
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8303 2 128
7bin-assembly1.cif.gz_W salmonella export gate and rod refined in focussed c1 map 0.8264 5 130
ID Description Score Start End Superfamily
2f1mB03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8957 92 122 1.10.287.470
2f1mA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8794 92 122 1.10.287.470
af_Q4CSC1_1_233_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8776 91 126 1.20.1250.20
4i9qB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.7859 92 130 1.10.287.690
af_Q9NUG6_13_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7182 2 127 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.978 4 129
AF-A0A6J4JWE2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9552 4 129 GO:0030694
GO:0071978
AF-A0LT52-F1-model_v4 Flagellar basal-body/hook protein C-terminal domain-containing protein 0.9535 3 130
AF-A0A495N5B1-F1-model_v4 deleted 0.9513 1 129
AF-A0A4P7GJZ2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9492 1 129 GO:0009288
GO:0071978

Map