F446060
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 261 | 427 | 294 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2842357229|2842363086 |
| Length | 289 |
| Sequence | ILAGGSGTRLYPITMAVSKQLMPVYDKPMIYYPLTTLMLAGIKEILIITTPHDNEAFKRLLGEGSQWGISIEYAVQPSPDGLAQAFIIGADFVGKNPSSLILGDNIYHGHGLPELLRSDEAMTGARVFAYHVTDPERYGVVEFDRTMKALSIEEKPVKPRSNWAVTGLYFYDEQVVDIAANLKPSPRGELEITDVNRIYLQRGQLSVELMGRGYAWLDTGTPDSLLEAADFVGTLEKRQGFKIACPEEVAYRMGHIDNAQLTKLAKDLGKSNYGRYLMKLAEAGDDSAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 3 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 4 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 5 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 6 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 7 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 8 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 9 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 10 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 11 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 12 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 13 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 14 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 15 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 16 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 17 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 18 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 19 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 124 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 126 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 137 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 139 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 140 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 141 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 147 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 165 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 166 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 227 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 228 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 229 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 230 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 233 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 234 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 236 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 237 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 238 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 239 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 240 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 241 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 242 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 243 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 244 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 245 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 247 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 248 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 249 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 251 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 252 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 255 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 256 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 258 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 261 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.18 |
| Metatranscriptomes | 1.34 |
| Isolates | 4.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.98 |
| Nodule | 0.89 |
| Rhizoplane | 2.91 |
| Rhizosphere | 71.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006770J48903_1065414 | 3300003305 | Bacteria | 1299 |
| 2 | Ga0007410J51695_1046964 | 3300003574 | Bacteria | 1835 |
| 3 | Ga0007409J51694_1040680 | 3300003575 | Bacteria | 4197 |
| 4 | Ga0055530_10010301 | 3300003791 | Bacteria | 3474 |
| 5 | Ga0065707_10199413 | 3300005295 | Bacteria | 1313 |
| 6 | Ga0070658_10003255 | 3300005327 | Bacteria | 13407 |
| 7 | Ga0070658_10018732 | 3300005327 | Bacteria | 5546 |
| 8 | Ga0070658_10022568 | 3300005327 | Bacteria | 5051 |
| 9 | Ga0070658_10099684 | 3300005327 | Bacteria | 2400 |
| 10 | Ga0070683_100103511 | 3300005329 | Bacteria | 2683 |
| 11 | Ga0070670_100000201 | 3300005331 | Bacteria | 55479 |
| 12 | Ga0070670_100000426 | 3300005331 | Bacteria | 34748 |
| 13 | Ga0070666_10038677 | 3300005335 | Bacteria | 3176 |
| 14 | Ga0070666_10057686 | 3300005335 | Bacteria | 2624 |
| 15 | Ga0070666_10124924 | 3300005335 | Bacteria | 1786 |
| 16 | Ga0070680_100019639 | 3300005336 | Bacteria | 5359 |
| 17 | Ga0070682_100007594 | 3300005337 | Bacteria | 6110 |
| 18 | Ga0070660_100074388 | 3300005339 | Bacteria | 2658 |
| 19 | Ga0070660_100215637 | 3300005339 | Bacteria | 1559 |
| 20 | Ga0070660_100281365 | 3300005339 | Bacteria | 1361 |
| 21 | Ga0070668_100000042 | 3300005347 | Bacteria | 78694 |
| 22 | Ga0070668_100001612 | 3300005347 | Bacteria | 16338 |
| 23 | Ga0070668_100010952 | 3300005347 | Bacteria | 6748 |
| 24 | Ga0070668_100032014 | 3300005347 | Bacteria | 4001 |
| 25 | Ga0070668_100038140 | 3300005347 | Bacteria | 3671 |
| 26 | Ga0070668_100062824 | 3300005347 | Bacteria | 2878 |
| 27 | Ga0070669_100000258 | 3300005353 | Bacteria | 43403 |
| 28 | Ga0070669_100003220 | 3300005353 | Bacteria | 11725 |
| 29 | Ga0070671_100000476 | 3300005355 | Bacteria | 27913 |
| 30 | Ga0070671_100043773 | 3300005355 | Bacteria | 3720 |
| 31 | Ga0070659_100043836 | 3300005366 | Bacteria | 3500 |
| 32 | Ga0070667_100000122 | 3300005367 | Bacteria | 99820 |
| 33 | Ga0070667_100000147 | 3300005367 | Bacteria | 88345 |
| 34 | Ga0070667_100000461 | 3300005367 | Bacteria | 41911 |
| 35 | Ga0070667_100000508 | 3300005367 | Bacteria | 39312 |
| 36 | Ga0070667_100001710 | 3300005367 | Bacteria | 19618 |
| 37 | Ga0070667_100016940 | 3300005367 | Bacteria | 6031 |
| 38 | Ga0070667_100021752 | 3300005367 | Bacteria | 5322 |
| 39 | Ga0070681_10021909 | 3300005458 | Bacteria | 6409 |
| 40 | Ga0070699_100090197 | 3300005518 | Bacteria | 2679 |
| 41 | Ga0070679_100005433 | 3300005530 | Bacteria | 11811 |
| 42 | Ga0070679_100303172 | 3300005530 | Bacteria | 1548 |
| 43 | Ga0070684_100032961 | 3300005535 | Bacteria | 4420 |
| 44 | Ga0068853_100002782 | 3300005539 | Bacteria | 13227 |
| 45 | Ga0068853_100003626 | 3300005539 | Bacteria | 11836 |
| 46 | Ga0070693_100121238 | 3300005547 | Bacteria | 1622 |
| 47 | Ga0070665_100000015 | 3300005548 | Bacteria | 462744 |
| 48 | Ga0070665_100001444 | 3300005548 | Bacteria | 27874 |
| 49 | Ga0070665_100002287 | 3300005548 | Bacteria | 21311 |
| 50 | Ga0070665_100065787 | 3300005548 | Bacteria | 3636 |
| 51 | Ga0068855_100031858 | 3300005563 | Bacteria | 6294 |
| 52 | Ga0068855_100195456 | 3300005563 | Bacteria | 2279 |
| 53 | Ga0068855_100230653 | 3300005563 | Bacteria | 2073 |
| 54 | Ga0068857_100000856 | 3300005577 | Bacteria | 22822 |
| 55 | Ga0068854_100014474 | 3300005578 | Bacteria | 5202 |
| 56 | Ga0068852_100026223 | 3300005616 | Bacteria | 4734 |
| 57 | Ga0068859_100000681 | 3300005617 | Bacteria | 34110 |
| 58 | Ga0068864_100000135 | 3300005618 | Bacteria | 71759 |
| 59 | Ga0068864_100000240 | 3300005618 | Bacteria | 49024 |
| 60 | Ga0068864_100011281 | 3300005618 | Bacteria | 7382 |
| 61 | Ga0068864_100085377 | 3300005618 | Bacteria | 2775 |
| 62 | Ga0068863_100000066 | 3300005841 | Bacteria | 117816 |
| 63 | Ga0068863_100000119 | 3300005841 | Bacteria | 82539 |
| 64 | Ga0068863_100000676 | 3300005841 | Bacteria | 34484 |
| 65 | Ga0068863_100002414 | 3300005841 | Bacteria | 18556 |
| 66 | Ga0068863_100010556 | 3300005841 | Bacteria | 8967 |
| 67 | Ga0068863_100070086 | 3300005841 | Bacteria | 3315 |
| 68 | Ga0068858_100001650 | 3300005842 | Bacteria | 22788 |
| 69 | Ga0068858_100006796 | 3300005842 | Bacteria | 11125 |
| 70 | Ga0068858_100064279 | 3300005842 | Bacteria | 3396 |
| 71 | Ga0068860_100000133 | 3300005843 | Bacteria | 120382 |
| 72 | Ga0068860_100000152 | 3300005843 | Bacteria | 112187 |
| 73 | Ga0068860_100009034 | 3300005843 | Bacteria | 9921 |
| 74 | Ga0068860_100034069 | 3300005843 | Bacteria | 4884 |
| 75 | Ga0068860_100113993 | 3300005843 | Bacteria | 2585 |
| 76 | Ga0068860_100171734 | 3300005843 | Bacteria | 2094 |
| 77 | Ga0068862_100000619 | 3300005844 | Bacteria | 36984 |
| 78 | Ga0068862_100008576 | 3300005844 | Bacteria | 8457 |
| 79 | Ga0068862_100043293 | 3300005844 | Bacteria | 3838 |
| 80 | Ga0075368_10002022 | 3300006042 | Bacteria | 6562 |
| 81 | Ga0075368_10003337 | 3300006042 | Bacteria | 5343 |
| 82 | Ga0075363_100059091 | 3300006048 | Bacteria | 2061 |
| 83 | Ga0075364_10000104 | 3300006051 | Bacteria | 34174 |
| 84 | Ga0075364_10015501 | 3300006051 | Bacteria | 4729 |
| 85 | Ga0075362_10020995 | 3300006177 | Bacteria | 2735 |
| 86 | Ga0075367_10000791 | 3300006178 | Bacteria | 12445 |
| 87 | Ga0075367_10002119 | 3300006178 | Bacteria | 8921 |
| 88 | Ga0075366_10001044 | 3300006195 | Bacteria | 13603 |
| 89 | Ga0075366_10050686 | 3300006195 | Bacteria | 2465 |
| 90 | Ga0075370_10015898 | 3300006353 | Bacteria | 4040 |
| 91 | Ga0075434_100342242 | 3300006871 | Bacteria | 1517 |
| 92 | Ga0097620_100000681 | 3300006931 | Bacteria | 34110 |
| 93 | Ga0105251_10000434 | 3300009011 | Bacteria | 40584 |
| 94 | Ga0105250_10005371 | 3300009092 | Bacteria | 5753 |
| 95 | Ga0105250_10084231 | 3300009092 | Bacteria | 1290 |
| 96 | Ga0105240_10127027 | 3300009093 | Bacteria | 3063 |
| 97 | Ga0105247_10013032 | 3300009101 | Bacteria | 4985 |
| 98 | Ga0105248_10002170 | 3300009177 | Bacteria | 21730 |
| 99 | Ga0105248_10052533 | 3300009177 | Bacteria | 4573 |
| 100 | Ga0105248_10364393 | 3300009177 | Bacteria | 1627 |
| 101 | Ga0105237_10001961 | 3300009545 | Bacteria | 26196 |
| 102 | Ga0105237_10081608 | 3300009545 | Bacteria | 3225 |
| 103 | Ga0105238_10115524 | 3300009551 | Bacteria | 2663 |
| 104 | Ga0105249_10001002 | 3300009553 | Bacteria | 25047 |
| 105 | Ga0105249_10004337 | 3300009553 | Bacteria | 12270 |
| 106 | Ga0157371_10060075 | 3300013102 | Bacteria | 2695 |
| 107 | Ga0157370_10076809 | 3300013104 | Bacteria | 3146 |
| 108 | Ga0157370_10106492 | 3300013104 | Bacteria | 2624 |
| 109 | Ga0157370_10375870 | 3300013104 | Bacteria | 1309 |
| 110 | Ga0157369_10003672 | 3300013105 | Bacteria | 18227 |
| 111 | Ga0171462_1013 | 3300013250 | Bacteria | 202864 |
| 112 | Ga0163162_10109578 | 3300013306 | Bacteria | 2858 |
| 113 | Ga0163162_10296478 | 3300013306 | Bacteria | 1749 |
| 114 | Ga0157372_10002428 | 3300013307 | Bacteria | 20176 |
| 115 | Ga0157372_10127500 | 3300013307 | Bacteria | 2926 |
| 116 | Ga0157372_10160902 | 3300013307 | Bacteria | 2595 |
| 117 | Ga0163163_10018515 | 3300014325 | Bacteria | 6522 |
| 118 | Ga0163163_10215477 | 3300014325 | Bacteria | 1969 |
| 119 | Ga0157379_10004599 | 3300014968 | Bacteria | 11839 |
| 120 | Ga0157379_10124436 | 3300014968 | Bacteria | 2320 |
| 121 | Ga0213876_10000341 | 3300021384 | Bacteria | 40559 |
| 122 | Ga0209758_1070306 | 3300025297 | Bacteria | 1105 |
| 123 | Ga0209050_1004466 | 3300025298 | Bacteria | 9428 |
| 124 | Ga0207696_1009712 | 3300025711 | Bacteria | 3573 |
| 125 | Ga0207696_1041632 | 3300025711 | Bacteria | 1341 |
| 126 | Ga0207713_1000396 | 3300025735 | Bacteria | 46595 |
| 127 | Ga0207713_1032975 | 3300025735 | Bacteria | 2268 |
| 128 | Ga0207710_10100431 | 3300025900 | Bacteria | 1364 |
| 129 | Ga0207680_10038801 | 3300025903 | Bacteria | 2759 |
| 130 | Ga0207680_10098770 | 3300025903 | Bacteria | 1872 |
| 131 | Ga0207705_10005999 | 3300025909 | Bacteria | 9043 |
| 132 | Ga0207705_10009115 | 3300025909 | Bacteria | 7233 |
| 133 | Ga0207705_10030133 | 3300025909 | Bacteria | 3870 |
| 134 | Ga0207707_10004567 | 3300025912 | Bacteria | 12168 |
| 135 | Ga0207695_10036393 | 3300025913 | Bacteria | 5322 |
| 136 | Ga0207695_10241504 | 3300025913 | Bacteria | 1707 |
| 137 | Ga0207695_10497894 | 3300025913 | Bacteria | 1101 |
| 138 | Ga0207671_10005144 | 3300025914 | Bacteria | 12182 |
| 139 | Ga0207663_10000017 | 3300025916 | Bacteria | 145654 |
| 140 | Ga0207660_10000900 | 3300025917 | Bacteria | 19531 |
| 141 | Ga0207657_10007405 | 3300025919 | Bacteria | 11253 |
| 142 | Ga0207657_10046893 | 3300025919 | Bacteria | 3783 |
| 143 | Ga0207652_10004699 | 3300025921 | Bacteria | 11076 |
| 144 | Ga0207681_10000469 | 3300025923 | Bacteria | 28325 |
| 145 | Ga0207681_10003585 | 3300025923 | Bacteria | 9664 |
| 146 | Ga0207681_10061645 | 3300025923 | Bacteria | 2579 |
| 147 | Ga0207694_10155955 | 3300025924 | Bacteria | 1841 |
| 148 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 149 | Ga0207644_10000272 | 3300025931 | Bacteria | 34285 |
| 150 | Ga0207644_10019639 | 3300025931 | Bacteria | 4588 |
| 151 | Ga0207690_10095135 | 3300025932 | Bacteria | 2116 |
| 152 | Ga0207711_10000707 | 3300025941 | Bacteria | 32848 |
| 153 | Ga0207711_10004476 | 3300025941 | Bacteria | 11912 |
| 154 | Ga0207711_10006678 | 3300025941 | Bacteria | 9711 |
| 155 | Ga0207711_10242386 | 3300025941 | Bacteria | 1653 |
| 156 | Ga0207661_10235052 | 3300025944 | Bacteria | 1624 |
| 157 | Ga0207679_10089668 | 3300025945 | Bacteria | 2374 |
| 158 | Ga0207667_10035472 | 3300025949 | Bacteria | 5350 |
| 159 | Ga0207712_10000767 | 3300025961 | Bacteria | 24118 |
| 160 | Ga0207712_10068805 | 3300025961 | Bacteria | 2538 |
| 161 | Ga0207668_10000088 | 3300025972 | Bacteria | 69295 |
| 162 | Ga0207668_10000622 | 3300025972 | Bacteria | 21998 |
| 163 | Ga0207668_10001163 | 3300025972 | Bacteria | 15629 |
| 164 | Ga0207668_10012023 | 3300025972 | Bacteria | 5283 |
| 165 | Ga0207668_10014551 | 3300025972 | Bacteria | 4870 |
| 166 | Ga0207668_10016698 | 3300025972 | Bacteria | 4586 |
| 167 | Ga0207668_10033229 | 3300025972 | Bacteria | 3415 |
| 168 | Ga0207668_10039725 | 3300025972 | Bacteria | 3170 |
| 169 | Ga0207640_10009680 | 3300025981 | Bacteria | 5405 |
| 170 | Ga0207658_10000092 | 3300025986 | Bacteria | 99965 |
| 171 | Ga0207658_10000117 | 3300025986 | Bacteria | 88361 |
| 172 | Ga0207658_10000295 | 3300025986 | Bacteria | 52135 |
| 173 | Ga0207658_10000397 | 3300025986 | Bacteria | 41950 |
| 174 | Ga0207658_10001312 | 3300025986 | Bacteria | 19589 |
| 175 | Ga0207658_10003417 | 3300025986 | Bacteria | 11241 |
| 176 | Ga0207658_10005469 | 3300025986 | Bacteria | 8708 |
| 177 | Ga0207658_10013524 | 3300025986 | Bacteria | 5578 |
| 178 | Ga0207677_10081860 | 3300026023 | Bacteria | 2318 |
| 179 | Ga0207703_10000049 | 3300026035 | Bacteria | 149817 |
| 180 | Ga0207703_10002065 | 3300026035 | Bacteria | 17677 |
| 181 | Ga0207703_10024961 | 3300026035 | Bacteria | 4702 |
| 182 | Ga0207703_10155720 | 3300026035 | Bacteria | 1996 |
| 183 | Ga0207639_10000621 | 3300026041 | Bacteria | 24436 |
| 184 | Ga0207639_10127639 | 3300026041 | Bacteria | 2100 |
| 185 | Ga0207641_10000011 | 3300026088 | Bacteria | 384362 |
| 186 | Ga0207641_10000085 | 3300026088 | Bacteria | 133497 |
| 187 | Ga0207641_10000612 | 3300026088 | Bacteria | 39133 |
| 188 | Ga0207641_10000742 | 3300026088 | Bacteria | 35060 |
| 189 | Ga0207641_10002295 | 3300026088 | Bacteria | 17793 |
| 190 | Ga0207641_10080758 | 3300026088 | Bacteria | 2822 |
| 191 | Ga0207676_10002034 | 3300026095 | Bacteria | 14697 |
| 192 | Ga0207674_10001997 | 3300026116 | Bacteria | 25875 |
| 193 | Ga0207675_100368013 | 3300026118 | Bacteria | 1411 |
| 194 | Ga0207698_10009264 | 3300026142 | Bacteria | 6266 |
| 195 | Ga0209371_1013385 | 3300027312 | Bacteria | 2308 |
| 196 | Ga0209981_1001618 | 3300027378 | Bacteria | 2849 |
| 197 | Ga0209999_1000174 | 3300027543 | Bacteria | 8655 |
| 198 | Ga0209813_10000017 | 3300027866 | Bacteria | 75687 |
| 199 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 200 | Ga0268266_10002166 | 3300028379 | Bacteria | 21556 |
| 201 | Ga0268266_10003072 | 3300028379 | Bacteria | 17061 |
| 202 | Ga0268266_10017096 | 3300028379 | Bacteria | 6193 |
| 203 | Ga0268265_10006324 | 3300028380 | Bacteria | 8026 |
| 204 | Ga0268265_10022865 | 3300028380 | Bacteria | 4400 |
| 205 | Ga0268265_10060927 | 3300028380 | Bacteria | 2894 |
| 206 | Ga0268265_10143009 | 3300028380 | Bacteria | 2005 |
| 207 | Ga0268264_10000111 | 3300028381 | Bacteria | 204718 |
| 208 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 209 | Ga0268264_10000709 | 3300028381 | Bacteria | 38415 |
| 210 | Ga0268264_10016329 | 3300028381 | Bacteria | 6080 |
| 211 | Ga0268264_10024689 | 3300028381 | Bacteria | 4909 |
| 212 | Ga0265323_10003167 | 3300028653 | Bacteria | 7329 |
| 213 | Ga0265323_10004115 | 3300028653 | Bacteria | 6305 |
| 214 | Ga0265322_10037761 | 3300028654 | Bacteria | 1376 |
| 215 | Ga0307517_10002892 | 3300028786 | Bacteria | 27201 |
| 216 | Ga0265338_10000014 | 3300028800 | Bacteria | 378751 |
| 217 | Ga0265338_10026766 | 3300028800 | Bacteria | 5804 |
| 218 | Ga0265338_10137194 | 3300028800 | Bacteria | 1921 |
| 219 | Ga0268256_1027989 | 3300030500 | Bacteria | 1397 |
| 220 | Ga0265330_10001818 | 3300031235 | Bacteria | 11956 |
| 221 | Ga0265330_10002236 | 3300031235 | Bacteria | 10664 |
| 222 | Ga0265328_10019983 | 3300031239 | Bacteria | 2567 |
| 223 | Ga0265325_10000008 | 3300031241 | Bacteria | 186174 |
| 224 | Ga0265329_10000020 | 3300031242 | Bacteria | 64345 |
| 225 | Ga0265339_10002066 | 3300031249 | Bacteria | 14742 |
| 226 | Ga0265331_10002272 | 3300031250 | Bacteria | 13131 |
| 227 | Ga0265327_10001380 | 3300031251 | Bacteria | 31060 |
| 228 | Ga0265316_10000054 | 3300031344 | Bacteria | 124687 |
| 229 | Ga0265316_10000080 | 3300031344 | Bacteria | 100625 |
| 230 | Ga0265316_10001617 | 3300031344 | Bacteria | 24031 |
| 231 | Ga0265316_10003871 | 3300031344 | Bacteria | 15011 |
| 232 | Ga0265316_10017073 | 3300031344 | Bacteria | 6281 |
| 233 | Ga0265316_10042787 | 3300031344 | Bacteria | 3617 |
| 234 | Ga0265316_10199586 | 3300031344 | Bacteria | 1483 |
| 235 | Ga0307513_10345844 | 3300031456 | Bacteria | 1236 |
| 236 | Ga0307408_100159607 | 3300031548 | Bacteria | 1789 |
| 237 | Ga0316579_10005052 | 3300031691 | Bacteria | 5290 |
| 238 | Ga0265342_10004856 | 3300031712 | Bacteria | 10417 |
| 239 | Ga0265342_10011323 | 3300031712 | Bacteria | 6114 |
| 240 | Ga0265342_10017914 | 3300031712 | Bacteria | 4598 |
| 241 | Ga0265342_10037508 | 3300031712 | Bacteria | 2955 |
| 242 | Ga0265342_10084492 | 3300031712 | Bacteria | 1828 |
| 243 | Ga0316576_10006930 | 3300031727 | Bacteria | 7086 |
| 244 | Ga0316578_10012834 | 3300031728 | Bacteria | 4424 |
| 245 | Ga0307516_10005920 | 3300031730 | Bacteria | 14466 |
| 246 | Ga0316577_10000193 | 3300031733 | Bacteria | 20297 |
| 247 | Ga0307413_10142893 | 3300031824 | Bacteria | 1656 |
| 248 | Ga0307412_10107267 | 3300031911 | Bacteria | 1987 |
| 249 | Ga0307414_10233051 | 3300032004 | Bacteria | 1519 |
| 250 | Ga0307411_10536386 | 3300032005 | Bacteria | 996 |
| 251 | Ga0316585_10025351 | 3300032137 | Bacteria | 1839 |
| 252 | Ga0316593_10034972 | 3300032168 | Bacteria | 1651 |
| 253 | Ga0316588_1013622 | 3300033528 | Bacteria | 1768 |
| 254 | Ga0316596_1000403 | 3300033541 | Bacteria | 7173 |
| 255 | Ga0373923_0028673 | 3300035111 | Bacteria | 2228 |
| 256 | Ga0373935_0110081 | 3300035692 | Bacteria | 1827 |
| 257 | Ga0373927_0309061 | 3300035695 | Bacteria | 1041 |
| 258 | Ga0373933_0022007 | 3300035724 | Bacteria | 3627 |
| 259 | Ga0373947_0023381 | 3300035725 | Bacteria | 3594 |
| 260 | Ga0373937_0003329 | 3300036401 | Bacteria | 13489 |
| 261 | Ga0316582_0004876 | 3300036647 | Bacteria | 6849 |
| 262 | Ga0373925_0120906 | 3300037068 | Bacteria | 2033 |
| 263 | Ga0395899_0000032 | 3300037312 | Bacteria | 312705 |
| 264 | Ga0395899_0215447 | 3300037312 | Bacteria | 1332 |
| 265 | Ga0395898_0194382 | 3300037466 | Bacteria | 1938 |
| 266 | Ga0395905_0055579 | 3300037471 | Bacteria | 3705 |
| 267 | Ga0436364_1462473 | 3300037853 | Bacteria | 1618 |
| 268 | Ga0395901_0255084 | 3300038443 | Bacteria | 1826 |
| 269 | Ga0436365_0541910 | 3300039437 | Bacteria | 1622 |
| 270 | Ga0436365_1702191 | 3300039437 | Bacteria | 116634 |
| 271 | Ga0436361_0055448 | 3300039447 | Bacteria | 9876 |
| 272 | Ga0436361_0555098 | 3300039447 | Bacteria | 28878 |
| 273 | Ga0436363_1271159 | 3300039450 | Bacteria | 2245 |
| 274 | Ga0436363_1440908 | 3300039450 | Bacteria | 1601 |
| 275 | Ga0466961_0016230 | 3300044693 | Bacteria | 4782 |
| 276 | Ga0466959_0164251 | 3300045049 | Bacteria | 1560 |
| 277 | Ga0451576_0000053 | 3300045051 | Bacteria | 308708 |
| 278 | Ga0495603_0022314 | 3300046455 | Bacteria | 3834 |
| 279 | Ga0495603_0206311 | 3300046455 | Bacteria | 1135 |
| 280 | Ga0495629_0018268 | 3300046459 | Bacteria | 5022 |
| 281 | Ga0495629_0059964 | 3300046459 | Bacteria | 2660 |
| 282 | Ga0495629_0168457 | 3300046459 | Bacteria | 1521 |
| 283 | Ga0495638_0000388 | 3300046460 | Bacteria | 54286 |
| 284 | Ga0495582_0041591 | 3300046473 | Bacteria | 2532 |
| 285 | Ga0495584_0003449 | 3300046491 | Bacteria | 8698 |
| 286 | Ga0495584_0027696 | 3300046491 | Bacteria | 2872 |
| 287 | Ga0495585_0053136 | 3300046492 | Bacteria | 2242 |
| 288 | Ga0495594_0039808 | 3300046499 | Bacteria | 2570 |
| 289 | Ga0495594_0100907 | 3300046499 | Bacteria | 1623 |
| 290 | Ga0495596_0001695 | 3300046500 | Bacteria | 12450 |
| 291 | Ga0495583_0000252 | 3300046506 | Bacteria | 88617 |
| 292 | Ga0495606_0087561 | 3300046507 | Bacteria | 1922 |
| 293 | Ga0495610_0000082 | 3300046512 | Bacteria | 113066 |
| 294 | Ga0495610_0000243 | 3300046512 | Bacteria | 57521 |
| 295 | Ga0495620_0002894 | 3300046515 | Bacteria | 9868 |
| 296 | Ga0495632_0001790 | 3300046519 | Bacteria | 17334 |
| 297 | Ga0495632_0140561 | 3300046519 | Bacteria | 1120 |
| 298 | Ga0495643_0000470 | 3300046522 | Bacteria | 51330 |
| 299 | Ga0495643_0013709 | 3300046522 | Bacteria | 4841 |
| 300 | Ga0495648_0000308 | 3300046524 | Bacteria | 54286 |
| 301 | Ga0495666_0012739 | 3300046526 | Bacteria | 4191 |
| 302 | Ga0495640_0108209 | 3300046533 | Bacteria | 1819 |
| 303 | Ga0495609_0009550 | 3300046538 | Bacteria | 4690 |
| 304 | Ga0495597_0000326 | 3300046542 | Bacteria | 43111 |
| 305 | Ga0495597_0003637 | 3300046542 | Bacteria | 8859 |
| 306 | Ga0495622_0000963 | 3300046557 | Bacteria | 15444 |
| 307 | Ga0495622_0030206 | 3300046557 | Bacteria | 2532 |
| 308 | Ga0495633_0033947 | 3300046558 | Bacteria | 2456 |
| 309 | Ga0495633_0069888 | 3300046558 | Bacteria | 1639 |
| 310 | Ga0495668_0009308 | 3300046616 | Bacteria | 6039 |
| 311 | Ga0495668_0044268 | 3300046616 | Bacteria | 2474 |
| 312 | Ga0495668_0127523 | 3300046616 | Bacteria | 1393 |
| 313 | Ga0495611_0013453 | 3300046648 | Bacteria | 3484 |
| 314 | Ga0495625_0000832 | 3300046660 | Bacteria | 42398 |
| 315 | Ga0495625_0005611 | 3300046660 | Bacteria | 11377 |
| 316 | Ga0495625_0049679 | 3300046660 | Bacteria | 3014 |
| 317 | Ga0495588_0039938 | 3300046674 | Bacteria | 2392 |
| 318 | Ga0495657_0299751 | 3300046675 | Bacteria | 959 |
| 319 | Ga0495670_0002789 | 3300046691 | Bacteria | 8637 |
| 320 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 321 | Ga0495672_0030225 | 3300047320 | Bacteria | 3402 |
| 322 | Ga0495676_0155496 | 3300047321 | Bacteria | 1623 |
| 323 | Ga0495687_009195 | 3300047443 | Bacteria | 5557 |
| 324 | Ga0495677_0019052 | 3300047445 | Bacteria | 2489 |
| 325 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 326 | Ga0495673_0020562 | 3300047469 | Bacteria | 3284 |
| 327 | Ga0495602_0170488 | 3300048088 | Bacteria | 1690 |
| 328 | Ga0495626_0001225 | 3300048091 | Bacteria | 21121 |
| 329 | Ga0496102_0000698 | 3300048905 | Bacteria | 33409 |
| 330 | Ga0496102_0089262 | 3300048905 | Bacteria | 2851 |
| 331 | Ga0496102_0383063 | 3300048905 | Bacteria | 1323 |
| 332 | Ga0496102_0549597 | 3300048905 | Bacteria | 1077 |
| 333 | Ga0496103_0000258 | 3300048906 | Bacteria | 50941 |
| 334 | Ga0496103_0000429 | 3300048906 | Bacteria | 36512 |
| 335 | Ga0496103_0009888 | 3300048906 | Bacteria | 5642 |
| 336 | Ga0496105_0024975 | 3300048908 | Bacteria | 4858 |
| 337 | Ga0496105_0056984 | 3300048908 | Bacteria | 3226 |
| 338 | Ga0496112_0378241 | 3300048915 | Bacteria | 1357 |
| 339 | Ga0496115_0007401 | 3300048918 | Bacteria | 8077 |
| 340 | Ga0496115_0081612 | 3300048918 | Bacteria | 2634 |
| 341 | Ga0496116_0002399 | 3300048919 | Bacteria | 19739 |
| 342 | Ga0496116_0004306 | 3300048919 | Bacteria | 13620 |
| 343 | Ga0496116_0038217 | 3300048919 | Bacteria | 3336 |
| 344 | Ga0496117_0006022 | 3300048920 | Bacteria | 12465 |
| 345 | Ga0496117_0008011 | 3300048920 | Bacteria | 10134 |
| 346 | Ga0496117_0010819 | 3300048920 | Bacteria | 8235 |
| 347 | Ga0496117_0021876 | 3300048920 | Bacteria | 5153 |
| 348 | Ga0496117_0214152 | 3300048920 | Bacteria | 1077 |
| 349 | Ga0496118_0003914 | 3300048921 | Bacteria | 18229 |
| 350 | Ga0496118_0009705 | 3300048921 | Bacteria | 9665 |
| 351 | Ga0496118_0024526 | 3300048921 | Bacteria | 5201 |
| 352 | Ga0496118_0036593 | 3300048921 | Bacteria | 3964 |
| 353 | Ga0496118_0039587 | 3300048921 | Bacteria | 3758 |
| 354 | Ga0496118_0228059 | 3300048921 | Bacteria | 1077 |
| 355 | Ga0496119_0007861 | 3300048922 | Bacteria | 9498 |
| 356 | Ga0496119_0035229 | 3300048922 | Bacteria | 3282 |
| 357 | Ga0496120_0048724 | 3300048923 | Bacteria | 2436 |
| 358 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 359 | Ga0496121_0001015 | 3300048924 | Bacteria | 50131 |
| 360 | Ga0496121_0004189 | 3300048924 | Bacteria | 19692 |
| 361 | Ga0496121_0006397 | 3300048924 | Bacteria | 14645 |
| 362 | Ga0496121_0087705 | 3300048924 | Bacteria | 2442 |
| 363 | Ga0496122_0253897 | 3300048925 | Bacteria | 981 |
| 364 | Ga0496123_0003707 | 3300048926 | Bacteria | 16803 |
| 365 | Ga0496123_0046486 | 3300048926 | Bacteria | 2944 |
| 366 | Ga0496123_0073998 | 3300048926 | Bacteria | 2111 |
| 367 | Ga0496124_0000943 | 3300048927 | Bacteria | 46595 |
| 368 | Ga0496124_0000946 | 3300048927 | Bacteria | 46483 |
| 369 | Ga0496124_0003633 | 3300048927 | Bacteria | 18722 |
| 370 | Ga0496124_0010844 | 3300048927 | Bacteria | 9175 |
| 371 | Ga0496124_0033254 | 3300048927 | Bacteria | 4537 |
| 372 | Ga0496124_0224302 | 3300048927 | Bacteria | 1411 |
| 373 | Ga0496124_0334825 | 3300048927 | Bacteria | 1077 |
| 374 | Ga0496126_0006072 | 3300048929 | Bacteria | 13556 |
| 375 | Ga0496126_0009107 | 3300048929 | Bacteria | 10601 |
| 376 | Ga0501034_0000627 | 3300049571 | Bacteria | 55016 |
| 377 | Ga0501043_0152621 | 3300049579 | Bacteria | 1807 |
| 378 | Ga0501047_0005449 | 3300049581 | Bacteria | 11975 |
| 379 | Ga0501081_0067400 | 3300049743 | Bacteria | 2491 |
| 380 | nmdc:mga03683_2694_c1 | 3300050489 | Bacteria | 5569 |
| 381 | nmdc:mga03683_4425_c1 | 3300050489 | Bacteria | 4660 |
| 382 | nmdc:mga03n38_21802_c1 | 3300050490 | Bacteria | 2583 |
| 383 | nmdc:mga00v17_2946_c1 | 3300050491 | Bacteria | 8733 |
| 384 | nmdc:mga00v17_324_c1 | 3300050491 | Bacteria | 27070 |
| 385 | nmdc:mga00v17_87297_c1 | 3300050491 | Bacteria | 1955 |
| 386 | nmdc:mga0k408_11007_c1 | 3300050493 | Bacteria | 4911 |
| 387 | nmdc:mga0k408_3848_c1 | 3300050493 | Bacteria | 7956 |
| 388 | nmdc:mga06z11_20_c1 | 3300050494 | Bacteria | 75712 |
| 389 | nmdc:mga06z11_4855_c1 | 3300050494 | Bacteria | 5325 |
| 390 | nmdc:mga04h51_11580_c1 | 3300050495 | Bacteria | 2452 |
| 391 | nmdc:mga04h51_406_c1 | 3300050495 | Bacteria | 10431 |
| 392 | nmdc:mga07m45_19324_c1 | 3300050496 | Bacteria | 3691 |
| 393 | nmdc:mga07m45_42031_c1 | 3300050496 | Bacteria | 2562 |
| 394 | nmdc:mga07m45_6399_c1 | 3300050496 | Bacteria | 5950 |
| 395 | nmdc:mga07m45_95330_c1 | 3300050496 | Bacteria | 1707 |
| 396 | nmdc:mga0n895_64608_c1 | 3300050512 | Bacteria | 3620 |
| 397 | nmdc:mga0rr50_401164_c1 | 3300050513 | Bacteria | 1158 |
| 398 | nmdc:mga0sz30_41611_c1 | 3300050516 | Bacteria | 1932 |
| 399 | Ga0500635_0000049 | 3300053080 | Bacteria | 80019 |
| 400 | Ga0495619_0046287 | 3300053085 | Bacteria | 2860 |
| 401 | Ga0500647_0047288 | 3300053091 | Bacteria | 2068 |
| 402 | Ga0500651_0102251 | 3300053093 | Bacteria | 1756 |
| 403 | Ga0500566_0051810 | 3300053094 | Bacteria | 2347 |
| 404 | Ga0500641_0167716 | 3300053096 | Bacteria | 945 |
| 405 | Ga0500562_003801 | 3300053108 | Bacteria | 3801 |
| 406 | Ga0500569_004988 | 3300053109 | Bacteria | 2826 |
| 407 | Ga0500595_001325 | 3300053119 | Bacteria | 13414 |
| 408 | Ga0500595_003342 | 3300053119 | Bacteria | 7534 |
| 409 | Ga0500607_000028 | 3300053121 | Bacteria | 91877 |
| 410 | Ga0500608_000299 | 3300053122 | Bacteria | 19175 |
| 411 | Ga0500614_015522 | 3300053123 | Bacteria | 1698 |
| 412 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 413 | Ga0500559_0003273 | 3300053136 | Bacteria | 8036 |
| 414 | Ga0500568_0001037 | 3300053139 | Bacteria | 18989 |
| 415 | Ga0500568_0001491 | 3300053139 | Bacteria | 14966 |
| 416 | Ga0500573_0001149 | 3300053140 | Bacteria | 12350 |
| 417 | Ga0500590_018155 | 3300053148 | Bacteria | 3639 |
| 418 | Ga0500616_0000070 | 3300053153 | Bacteria | 232610 |
| 419 | Ga0500620_001578 | 3300053155 | Bacteria | 4275 |
| 420 | Ga0500638_108515 | 3300053162 | Bacteria | 1285 |
| 421 | Ga0500636_0008796 | 3300053177 | Bacteria | 5858 |
| 422 | Ga0500637_0000032 | 3300053178 | Bacteria | 51354 |
| 423 | Ga0500625_015010 | 3300053729 | Bacteria | 3589 |
| 424 | Ga0500645_040328 | 3300053730 | Bacteria | 1381 |
| 425 | Ga0500596_001627 | 3300053735 | Bacteria | 4560 |
| 426 | Ga0501084_0052609 | 3300054114 | Bacteria | 3407 |
| 427 | Ga0501082_0181296 | 3300060353 | Bacteria | 1832 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10001961 | Ga0105237_1000196124 | 260 |
| 2 | 3300037312 | Ga0395899_0215447 | Ga0395899_0215447_15_812 | 260 |
| 3 | 3300050490 | nmdc:mga03n38_21802_c1 | nmdc:mga03n38_21802_c1_350_1147 | 260 |
| 4 | 3300031712 | Ga0265342_10037508 | Ga0265342_100375082 | 263 |
| 5 | 3300050513 | nmdc:mga0rr50_401164_c1 | nmdc:mga0rr50_401164_c1_348_1139 | 263 |
| 6 | 3300048905 | Ga0496102_0549597 | Ga0496102_0549597_61_855 | 264 |
| 7 | 3300048919 | Ga0496116_0004306 | Ga0496116_0004306_12766_13560 | 264 |
| 8 | 3300048920 | Ga0496117_0214152 | Ga0496117_0214152_61_855 | 264 |
| 9 | 3300048921 | Ga0496118_0228059 | Ga0496118_0228059_223_1017 | 264 |
| 10 | 3300048927 | Ga0496124_0334825 | Ga0496124_0334825_223_1017 | 264 |
| 11 | 3300005842 | Ga0068858_100064279 | Ga0068858_1000642794 | 266 |
| 12 | 3300025923 | Ga0207681_10000469 | Ga0207681_1000046920 | 266 |
| 13 | 3300026035 | Ga0207703_10155720 | Ga0207703_101557202 | 266 |
| 14 | 3300028380 | Ga0268265_10143009 | Ga0268265_101430092 | 266 |
| 15 | 3300035695 | Ga0373927_0309061 | Ga0373927_0309061_148_960 | 270 |
| 16 | 3300035725 | Ga0373947_0023381 | Ga0373947_0023381_1019_1843 | 274 |
| 17 | 3300046459 | Ga0495629_0018268 | Ga0495629_0018268_2449_3273 | 274 |
| 18 | 3300046533 | Ga0495640_0108209 | Ga0495640_0108209_150_974 | 274 |
| 19 | 3300047321 | Ga0495676_0155496 | Ga0495676_0155496_375_1199 | 274 |
| 20 | 3300048924 | Ga0496121_0004189 | Ga0496121_0004189_5453_6277 | 274 |
| 21 | 3300048927 | Ga0496124_0224302 | Ga0496124_0224302_555_1382 | 274 |
| 22 | 3300044693 | Ga0466961_0016230 | Ga0466961_0016230_1041_1868 | 275 |
| 23 | 3300009011 | Ga0105251_10000434 | Ga0105251_100004344 | 276 |
| 24 | 3300009177 | Ga0105248_10052533 | Ga0105248_100525334 | 276 |
| 25 | 3300048921 | Ga0496118_0039587 | Ga0496118_0039587_674_1504 | 276 |
| 26 | iso_pu_bacteria | 2643221545 | 2643750201 | 284 |
| 27 | iso_pu_bacteria | 2643221691 | 2644507090 | 284 |
| 28 | 3300021384 | Ga0213876_10000341 | Ga0213876_1000034133 | 285 |
| 29 | 3300037853 | Ga0436364_1462473 | Ga0436364_1462473_122_991 | 285 |
| 30 | 3300039437 | Ga0436365_1702191 | Ga0436365_1702191_59570_60439 | 285 |
| 31 | 3300039450 | Ga0436363_1271159 | Ga0436363_1271159_389_1258 | 285 |
| 32 | 3300046491 | Ga0495584_0027696 | Ga0495584_0027696_14_880 | 285 |
| 33 | iso_pu_bacteria | 2508501114 | 2509080252 | 285 |
| 34 | iso_pu_bacteria | 2775506901 | 2776261546 | 285 |
| 35 | 3300013306 | Ga0163162_10109578 | Ga0163162_101095782 | 286 |
| 36 | iso_pu_bacteria | 2667528173 | 2671108730 | 286 |
| 37 | iso_pu_bacteria | 2842357229 | 2842363086 | 286 |
| 38 | iso_pu_bacteria | 2884298095 | 2884301665 | 286 |
| 39 | iso_pu_bacteria | 2904474040 | 2904475575 | 286 |
| 40 | iso_pu_bacteria | 2919150387 | 2919151744 | 286 |
| 41 | iso_pu_bacteria | 2927143783 | 2927144413 | 286 |
| 42 | iso_pu_bacteria | 3001892409 | 3001895046 | 286 |
| 43 | 3300005327 | Ga0070658_10003255 | Ga0070658_100032553 | 287 |
| 44 | 3300005339 | Ga0070660_100215637 | Ga0070660_1002156371 | 287 |
| 45 | 3300025909 | Ga0207705_10005999 | Ga0207705_100059994 | 287 |
| 46 | 3300032004 | Ga0307414_10233051 | Ga0307414_102330511 | 287 |
| 47 | 3300045051 | Ga0451576_0000053 | Ga0451576_0000053_178964_179860 | 287 |
| 48 | 3300046522 | Ga0495643_0000470 | Ga0495643_0000470_13489_14358 | 287 |
| 49 | 3300048919 | Ga0496116_0002399 | Ga0496116_0002399_15453_16325 | 287 |
| 50 | 3300048927 | Ga0496124_0000943 | Ga0496124_0000943_30241_31113 | 287 |
| 51 | iso_pu_bacteria | 2565956521 | 2566037132 | 287 |
| 52 | iso_pu_bacteria | 2996887358 | 2996889538 | 287 |
| 53 | iso_pu_bacteria | 8005321885 | 8005324065 | 287 |
| 54 | 3300005337 | Ga0070682_100007594 | Ga0070682_1000075942 | 288 |
| 55 | 3300005563 | Ga0068855_100195456 | Ga0068855_1001954562 | 288 |
| 56 | 3300013104 | Ga0157370_10076809 | Ga0157370_100768092 | 288 |
| 57 | 3300031251 | Ga0265327_10001380 | Ga0265327_1000138018 | 288 |
| 58 | 3300039447 | Ga0436361_0555098 | Ga0436361_0555098_1130_2038 | 288 |
| 59 | 3300046455 | Ga0495603_0022314 | Ga0495603_0022314_2207_3097 | 288 |
| 60 | 3300046455 | Ga0495603_0206311 | Ga0495603_0206311_62_952 | 288 |
| 61 | 3300046459 | Ga0495629_0168457 | Ga0495629_0168457_133_1023 | 288 |
| 62 | 3300046473 | Ga0495582_0041591 | Ga0495582_0041591_581_1471 | 288 |
| 63 | 3300046491 | Ga0495584_0003449 | Ga0495584_0003449_1028_1918 | 288 |
| 64 | 3300046492 | Ga0495585_0053136 | Ga0495585_0053136_271_1161 | 288 |
| 65 | 3300046499 | Ga0495594_0039808 | Ga0495594_0039808_1176_2066 | 288 |
| 66 | 3300046499 | Ga0495594_0100907 | Ga0495594_0100907_55_945 | 288 |
| 67 | 3300046526 | Ga0495666_0012739 | Ga0495666_0012739_3112_4002 | 288 |
| 68 | 3300046557 | Ga0495622_0030206 | Ga0495622_0030206_528_1418 | 288 |
| 69 | 3300046558 | Ga0495633_0033947 | Ga0495633_0033947_676_1566 | 288 |
| 70 | 3300046648 | Ga0495611_0013453 | Ga0495611_0013453_1589_2479 | 288 |
| 71 | 3300046674 | Ga0495588_0039938 | Ga0495588_0039938_1061_1951 | 288 |
| 72 | 3300046691 | Ga0495670_0002789 | Ga0495670_0002789_3086_3976 | 288 |
| 73 | 3300047445 | Ga0495677_0019052 | Ga0495677_0019052_1376_2266 | 288 |
| 74 | 3300053108 | Ga0500562_003801 | Ga0500562_003801_1742_2632 | 288 |
| 75 | 3300003791 | Ga0055530_10010301 | Ga0055530_100103012 | 289 |
| 76 | 3300005355 | Ga0070671_100043773 | Ga0070671_1000437735 | 289 |
| 77 | 3300005367 | Ga0070667_100000122 | Ga0070667_10000012255 | 289 |
| 78 | 3300005539 | Ga0068853_100002782 | Ga0068853_1000027827 | 289 |
| 79 | 3300005577 | Ga0068857_100000856 | Ga0068857_10000085615 | 289 |
| 80 | 3300005841 | Ga0068863_100070086 | Ga0068863_1000700863 | 289 |
| 81 | 3300005843 | Ga0068860_100000152 | Ga0068860_10000015259 | 289 |
| 82 | 3300013104 | Ga0157370_10375870 | Ga0157370_103758702 | 289 |
| 83 | 3300025298 | Ga0209050_1004466 | Ga0209050_10044663 | 289 |
| 84 | 3300025931 | Ga0207644_10019639 | Ga0207644_100196394 | 289 |
| 85 | 3300025986 | Ga0207658_10000092 | Ga0207658_1000009248 | 289 |
| 86 | 3300026041 | Ga0207639_10000621 | Ga0207639_1000062115 | 289 |
| 87 | 3300026088 | Ga0207641_10000742 | Ga0207641_1000074236 | 289 |
| 88 | 3300026116 | Ga0207674_10001997 | Ga0207674_1000199715 | 289 |
| 89 | 3300028381 | Ga0268264_10000111 | Ga0268264_1000011144 | 289 |
| 90 | 3300031911 | Ga0307412_10107267 | Ga0307412_101072672 | 289 |
| 91 | 3300046507 | Ga0495606_0087561 | Ga0495606_0087561_526_1395 | 289 |
| 92 | 3300046512 | Ga0495610_0000082 | Ga0495610_0000082_11062_11931 | 289 |
| 93 | 3300046558 | Ga0495633_0069888 | Ga0495633_0069888_583_1452 | 289 |
| 94 | 3300046660 | Ga0495625_0000832 | Ga0495625_0000832_12410_13279 | 289 |
| 95 | 3300046660 | Ga0495625_0049679 | Ga0495625_0049679_588_1457 | 289 |
| 96 | 3300048091 | Ga0495626_0001225 | Ga0495626_0001225_4449_5318 | 289 |
| 97 | 3300048906 | Ga0496103_0000429 | Ga0496103_0000429_223_1098 | 289 |
| 98 | 3300048908 | Ga0496105_0024975 | Ga0496105_0024975_1689_2570 | 289 |
| 99 | 3300048922 | Ga0496119_0035229 | Ga0496119_0035229_1387_2262 | 289 |
| 100 | 3300048923 | Ga0496120_0048724 | Ga0496120_0048724_881_1762 | 289 |
| 101 | iso_pu_bacteria | 2751185897 | 2753767798 | 289 |
| 102 | 3300005347 | Ga0070668_100001612 | Ga0070668_1000016123 | 290 |
| 103 | 3300013250 | Ga0171462_1013 | Ga0171462_101351 | 290 |
| 104 | 3300025972 | Ga0207668_10033229 | Ga0207668_100332293 | 290 |
| 105 | 3300027312 | Ga0209371_1013385 | Ga0209371_10133853 | 290 |
| 106 | 3300027378 | Ga0209981_1001618 | Ga0209981_10016182 | 290 |
| 107 | 3300027543 | Ga0209999_1000174 | Ga0209999_10001745 | 290 |
| 108 | 3300030500 | Ga0268256_1027989 | Ga0268256_10279892 | 290 |
| 109 | 3300035111 | Ga0373923_0028673 | Ga0373923_0028673_261_1133 | 290 |
| 110 | 3300035724 | Ga0373933_0022007 | Ga0373933_0022007_1323_2195 | 290 |
| 111 | 3300036401 | Ga0373937_0003329 | Ga0373937_0003329_10425_11297 | 290 |
| 112 | 3300037471 | Ga0395905_0055579 | Ga0395905_0055579_2534_3469 | 290 |
| 113 | 3300039447 | Ga0436361_0055448 | Ga0436361_0055448_3905_4777 | 290 |
| 114 | 3300039450 | Ga0436363_1440908 | Ga0436363_1440908_481_1356 | 290 |
| 115 | 3300046500 | Ga0495596_0001695 | Ga0495596_0001695_181_1053 | 290 |
| 116 | 3300046512 | Ga0495610_0000243 | Ga0495610_0000243_49794_50666 | 290 |
| 117 | 3300046515 | Ga0495620_0002894 | Ga0495620_0002894_8303_9175 | 290 |
| 118 | 3300046519 | Ga0495632_0140561 | Ga0495632_0140561_28_900 | 290 |
| 119 | 3300046616 | Ga0495668_0009308 | Ga0495668_0009308_4566_5453 | 290 |
| 120 | 3300046616 | Ga0495668_0127523 | Ga0495668_0127523_405_1277 | 290 |
| 121 | 3300046660 | Ga0495625_0005611 | Ga0495625_0005611_4006_4878 | 290 |
| 122 | 3300046675 | Ga0495657_0299751 | Ga0495657_0299751_26_898 | 290 |
| 123 | 3300049571 | Ga0501034_0000627 | Ga0501034_0000627_40913_41815 | 290 |
| 124 | 3300049579 | Ga0501043_0152621 | Ga0501043_0152621_650_1522 | 290 |
| 125 | 3300053085 | Ga0495619_0046287 | Ga0495619_0046287_1772_2644 | 290 |
| 126 | 3300053096 | Ga0500641_0167716 | Ga0500641_0167716_20_910 | 290 |
| 127 | 3300053139 | Ga0500568_0001037 | Ga0500568_0001037_916_1791 | 290 |
| 128 | 3300053139 | Ga0500568_0001491 | Ga0500568_0001491_6592_7470 | 290 |
| 129 | iso_pu_bacteria | 2891088606 | 2891092647 | 290 |
| 130 | iso_pu_bacteria | 2919709256 | 2919711780 | 290 |
| 131 | 3300005327 | Ga0070658_10018732 | Ga0070658_100187322 | 291 |
| 132 | 3300005327 | Ga0070658_10099684 | Ga0070658_100996842 | 291 |
| 133 | 3300005329 | Ga0070683_100103511 | Ga0070683_1001035112 | 291 |
| 134 | 3300005331 | Ga0070670_100000201 | Ga0070670_10000020156 | 291 |
| 135 | 3300005335 | Ga0070666_10057686 | Ga0070666_100576863 | 291 |
| 136 | 3300005336 | Ga0070680_100019639 | Ga0070680_1000196396 | 291 |
| 137 | 3300005339 | Ga0070660_100074388 | Ga0070660_1000743883 | 291 |
| 138 | 3300005347 | Ga0070668_100010952 | Ga0070668_1000109525 | 291 |
| 139 | 3300005347 | Ga0070668_100038140 | Ga0070668_1000381404 | 291 |
| 140 | 3300005353 | Ga0070669_100000258 | Ga0070669_1000002588 | 291 |
| 141 | 3300005366 | Ga0070659_100043836 | Ga0070659_1000438362 | 291 |
| 142 | 3300005367 | Ga0070667_100021752 | Ga0070667_1000217525 | 291 |
| 143 | 3300005458 | Ga0070681_10021909 | Ga0070681_100219096 | 291 |
| 144 | 3300005530 | Ga0070679_100005433 | Ga0070679_1000054337 | 291 |
| 145 | 3300005535 | Ga0070684_100032961 | Ga0070684_1000329616 | 291 |
| 146 | 3300005539 | Ga0068853_100003626 | Ga0068853_1000036265 | 291 |
| 147 | 3300005548 | Ga0070665_100000015 | Ga0070665_100000015174 | 291 |
| 148 | 3300005563 | Ga0068855_100031858 | Ga0068855_1000318587 | 291 |
| 149 | 3300005563 | Ga0068855_100230653 | Ga0068855_1002306532 | 291 |
| 150 | 3300005618 | Ga0068864_100011281 | Ga0068864_1000112817 | 291 |
| 151 | 3300005618 | Ga0068864_100085377 | Ga0068864_1000853773 | 291 |
| 152 | 3300009092 | Ga0105250_10084231 | Ga0105250_100842312 | 291 |
| 153 | 3300009093 | Ga0105240_10127027 | Ga0105240_101270273 | 291 |
| 154 | 3300009101 | Ga0105247_10013032 | Ga0105247_100130324 | 291 |
| 155 | 3300009545 | Ga0105237_10081608 | Ga0105237_100816083 | 291 |
| 156 | 3300009551 | Ga0105238_10115524 | Ga0105238_101155243 | 291 |
| 157 | 3300009553 | Ga0105249_10004337 | Ga0105249_100043372 | 291 |
| 158 | 3300013104 | Ga0157370_10106492 | Ga0157370_101064922 | 291 |
| 159 | 3300013306 | Ga0163162_10296478 | Ga0163162_102964782 | 291 |
| 160 | 3300025297 | Ga0209758_1070306 | Ga0209758_10703062 | 291 |
| 161 | 3300025711 | Ga0207696_1009712 | Ga0207696_10097123 | 291 |
| 162 | 3300025735 | Ga0207713_1032975 | Ga0207713_10329752 | 291 |
| 163 | 3300025900 | Ga0207710_10100431 | Ga0207710_101004312 | 291 |
| 164 | 3300025909 | Ga0207705_10009115 | Ga0207705_100091157 | 291 |
| 165 | 3300025912 | Ga0207707_10004567 | Ga0207707_100045677 | 291 |
| 166 | 3300025913 | Ga0207695_10497894 | Ga0207695_104978941 | 291 |
| 167 | 3300025917 | Ga0207660_10000900 | Ga0207660_1000090010 | 291 |
| 168 | 3300025919 | Ga0207657_10007405 | Ga0207657_100074057 | 291 |
| 169 | 3300025921 | Ga0207652_10004699 | Ga0207652_100046996 | 291 |
| 170 | 3300025924 | Ga0207694_10155955 | Ga0207694_101559552 | 291 |
| 171 | 3300025932 | Ga0207690_10095135 | Ga0207690_100951351 | 291 |
| 172 | 3300025944 | Ga0207661_10235052 | Ga0207661_102350522 | 291 |
| 173 | 3300025945 | Ga0207679_10089668 | Ga0207679_100896683 | 291 |
| 174 | 3300025949 | Ga0207667_10035472 | Ga0207667_100354726 | 291 |
| 175 | 3300025961 | Ga0207712_10068805 | Ga0207712_100688052 | 291 |
| 176 | 3300025972 | Ga0207668_10000622 | Ga0207668_100006223 | 291 |
| 177 | 3300025972 | Ga0207668_10012023 | Ga0207668_100120232 | 291 |
| 178 | 3300025986 | Ga0207658_10005469 | Ga0207658_100054697 | 291 |
| 179 | 3300026023 | Ga0207677_10081860 | Ga0207677_100818603 | 291 |
| 180 | 3300026041 | Ga0207639_10127639 | Ga0207639_101276392 | 291 |
| 181 | 3300026088 | Ga0207641_10080758 | Ga0207641_100807582 | 291 |
| 182 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005944 | 291 |
| 183 | 3300028653 | Ga0265323_10003167 | Ga0265323_100031676 | 291 |
| 184 | 3300028653 | Ga0265323_10004115 | Ga0265323_100041155 | 291 |
| 185 | 3300028654 | Ga0265322_10037761 | Ga0265322_100377612 | 291 |
| 186 | 3300028786 | Ga0307517_10002892 | Ga0307517_100028923 | 291 |
| 187 | 3300028800 | Ga0265338_10026766 | Ga0265338_100267665 | 291 |
| 188 | 3300028800 | Ga0265338_10137194 | Ga0265338_101371942 | 291 |
| 189 | 3300031235 | Ga0265330_10001818 | Ga0265330_1000181811 | 291 |
| 190 | 3300031235 | Ga0265330_10002236 | Ga0265330_100022364 | 291 |
| 191 | 3300031239 | Ga0265328_10019983 | Ga0265328_100199833 | 291 |
| 192 | 3300031242 | Ga0265329_10000020 | Ga0265329_1000002053 | 291 |
| 193 | 3300031344 | Ga0265316_10000054 | Ga0265316_1000005430 | 291 |
| 194 | 3300031344 | Ga0265316_10000080 | Ga0265316_1000008055 | 291 |
| 195 | 3300031344 | Ga0265316_10001617 | Ga0265316_1000161711 | 291 |
| 196 | 3300031344 | Ga0265316_10017073 | Ga0265316_100170733 | 291 |
| 197 | 3300031344 | Ga0265316_10042787 | Ga0265316_100427873 | 291 |
| 198 | 3300031344 | Ga0265316_10199586 | Ga0265316_101995862 | 291 |
| 199 | 3300031456 | Ga0307513_10345844 | Ga0307513_103458442 | 291 |
| 200 | 3300031712 | Ga0265342_10004856 | Ga0265342_100048564 | 291 |
| 201 | 3300031712 | Ga0265342_10011323 | Ga0265342_100113235 | 291 |
| 202 | 3300031712 | Ga0265342_10084492 | Ga0265342_100844921 | 291 |
| 203 | 3300031727 | Ga0316576_10006930 | Ga0316576_100069306 | 291 |
| 204 | 3300031728 | Ga0316578_10012834 | Ga0316578_100128344 | 291 |
| 205 | 3300031733 | Ga0316577_10000193 | Ga0316577_100001934 | 291 |
| 206 | 3300032137 | Ga0316585_10025351 | Ga0316585_100253513 | 291 |
| 207 | 3300032168 | Ga0316593_10034972 | Ga0316593_100349722 | 291 |
| 208 | 3300033528 | Ga0316588_1013622 | Ga0316588_10136222 | 291 |
| 209 | 3300033541 | Ga0316596_1000403 | Ga0316596_10004034 | 291 |
| 210 | 3300035692 | Ga0373935_0110081 | Ga0373935_0110081_806_1705 | 291 |
| 211 | 3300047320 | Ga0495672_0030225 | Ga0495672_0030225_100_993 | 291 |
| 212 | 3300048905 | Ga0496102_0000698 | Ga0496102_0000698_3869_4747 | 291 |
| 213 | 3300048906 | Ga0496103_0000258 | Ga0496103_0000258_21401_22279 | 291 |
| 214 | 3300048908 | Ga0496105_0056984 | Ga0496105_0056984_1000_1878 | 291 |
| 215 | 3300048915 | Ga0496112_0378241 | Ga0496112_0378241_40_933 | 291 |
| 216 | 3300048918 | Ga0496115_0007401 | Ga0496115_0007401_3216_4106 | 291 |
| 217 | 3300048919 | Ga0496116_0038217 | Ga0496116_0038217_1500_2378 | 291 |
| 218 | 3300048920 | Ga0496117_0010819 | Ga0496117_0010819_5758_6636 | 291 |
| 219 | 3300048921 | Ga0496118_0036593 | Ga0496118_0036593_1600_2478 | 291 |
| 220 | 3300048924 | Ga0496121_0001015 | Ga0496121_0001015_3759_4643 | 291 |
| 221 | 3300048924 | Ga0496121_0006397 | Ga0496121_0006397_1083_1961 | 291 |
| 222 | 3300048927 | Ga0496124_0010844 | Ga0496124_0010844_2653_3531 | 291 |
| 223 | 3300053130 | Ga0500642_0000001 | Ga0500642_0000001_772838_773722 | 291 |
| 224 | 3300053140 | Ga0500573_0001149 | Ga0500573_0001149_8158_9042 | 291 |
| 225 | 3300053730 | Ga0500645_040328 | Ga0500645_040328_209_1084 | 291 |
| 226 | iso_pu_bacteria | 8054302542 | 8054306390 | 291 |
| 227 | 3300005295 | Ga0065707_10199413 | Ga0065707_101994131 | 292 |
| 228 | 3300005331 | Ga0070670_100000426 | Ga0070670_10000042611 | 292 |
| 229 | 3300005335 | Ga0070666_10038677 | Ga0070666_100386772 | 292 |
| 230 | 3300005335 | Ga0070666_10124924 | Ga0070666_101249241 | 292 |
| 231 | 3300005347 | Ga0070668_100000042 | Ga0070668_10000004227 | 292 |
| 232 | 3300005347 | Ga0070668_100032014 | Ga0070668_1000320144 | 292 |
| 233 | 3300005347 | Ga0070668_100062824 | Ga0070668_1000628244 | 292 |
| 234 | 3300005353 | Ga0070669_100003220 | Ga0070669_1000032205 | 292 |
| 235 | 3300005355 | Ga0070671_100000476 | Ga0070671_10000047617 | 292 |
| 236 | 3300005367 | Ga0070667_100000147 | Ga0070667_10000014788 | 292 |
| 237 | 3300005367 | Ga0070667_100000508 | Ga0070667_10000050830 | 292 |
| 238 | 3300005367 | Ga0070667_100001710 | Ga0070667_10000171020 | 292 |
| 239 | 3300005367 | Ga0070667_100016940 | Ga0070667_1000169404 | 292 |
| 240 | 3300005518 | Ga0070699_100090197 | Ga0070699_1000901973 | 292 |
| 241 | 3300005548 | Ga0070665_100002287 | Ga0070665_1000022872 | 292 |
| 242 | 3300005548 | Ga0070665_100065787 | Ga0070665_1000657873 | 292 |
| 243 | 3300005578 | Ga0068854_100014474 | Ga0068854_1000144745 | 292 |
| 244 | 3300005617 | Ga0068859_100000681 | Ga0068859_10000068115 | 292 |
| 245 | 3300005618 | Ga0068864_100000135 | Ga0068864_1000001351 | 292 |
| 246 | 3300005618 | Ga0068864_100000240 | Ga0068864_10000024049 | 292 |
| 247 | 3300005841 | Ga0068863_100000066 | Ga0068863_100000066126 | 292 |
| 248 | 3300005841 | Ga0068863_100000119 | Ga0068863_10000011915 | 292 |
| 249 | 3300005841 | Ga0068863_100000676 | Ga0068863_10000067633 | 292 |
| 250 | 3300005841 | Ga0068863_100010556 | Ga0068863_1000105562 | 292 |
| 251 | 3300005842 | Ga0068858_100001650 | Ga0068858_10000165014 | 292 |
| 252 | 3300005842 | Ga0068858_100006796 | Ga0068858_1000067965 | 292 |
| 253 | 3300005843 | Ga0068860_100000133 | Ga0068860_10000013392 | 292 |
| 254 | 3300005843 | Ga0068860_100113993 | Ga0068860_1001139933 | 292 |
| 255 | 3300005843 | Ga0068860_100171734 | Ga0068860_1001717342 | 292 |
| 256 | 3300005844 | Ga0068862_100000619 | Ga0068862_10000061925 | 292 |
| 257 | 3300005844 | Ga0068862_100043293 | Ga0068862_1000432934 | 292 |
| 258 | 3300006042 | Ga0075368_10002022 | Ga0075368_100020227 | 292 |
| 259 | 3300006051 | Ga0075364_10000104 | Ga0075364_1000010428 | 292 |
| 260 | 3300006178 | Ga0075367_10002119 | Ga0075367_100021192 | 292 |
| 261 | 3300006195 | Ga0075366_10050686 | Ga0075366_100506862 | 292 |
| 262 | 3300006871 | Ga0075434_100342242 | Ga0075434_1003422422 | 292 |
| 263 | 3300006931 | Ga0097620_100000681 | Ga0097620_10000068123 | 292 |
| 264 | 3300009092 | Ga0105250_10005371 | Ga0105250_100053714 | 292 |
| 265 | 3300009177 | Ga0105248_10002170 | Ga0105248_1000217020 | 292 |
| 266 | 3300009177 | Ga0105248_10364393 | Ga0105248_103643932 | 292 |
| 267 | 3300009553 | Ga0105249_10001002 | Ga0105249_100010026 | 292 |
| 268 | 3300014325 | Ga0163163_10018515 | Ga0163163_100185155 | 292 |
| 269 | 3300014325 | Ga0163163_10215477 | Ga0163163_102154772 | 292 |
| 270 | 3300014968 | Ga0157379_10004599 | Ga0157379_100045994 | 292 |
| 271 | 3300014968 | Ga0157379_10124436 | Ga0157379_101244362 | 292 |
| 272 | 3300025711 | Ga0207696_1041632 | Ga0207696_10416322 | 292 |
| 273 | 3300025903 | Ga0207680_10038801 | Ga0207680_100388012 | 292 |
| 274 | 3300025903 | Ga0207680_10098770 | Ga0207680_100987702 | 292 |
| 275 | 3300025913 | Ga0207695_10036393 | Ga0207695_100363934 | 292 |
| 276 | 3300025913 | Ga0207695_10241504 | Ga0207695_102415042 | 292 |
| 277 | 3300025914 | Ga0207671_10005144 | Ga0207671_100051442 | 292 |
| 278 | 3300025923 | Ga0207681_10003585 | Ga0207681_100035857 | 292 |
| 279 | 3300025923 | Ga0207681_10061645 | Ga0207681_100616452 | 292 |
| 280 | 3300025925 | Ga0207650_10000016 | Ga0207650_10000016159 | 292 |
| 281 | 3300025931 | Ga0207644_10000272 | Ga0207644_1000027218 | 292 |
| 282 | 3300025941 | Ga0207711_10004476 | Ga0207711_1000447612 | 292 |
| 283 | 3300025941 | Ga0207711_10006678 | Ga0207711_100066787 | 292 |
| 284 | 3300025941 | Ga0207711_10242386 | Ga0207711_102423862 | 292 |
| 285 | 3300025961 | Ga0207712_10000767 | Ga0207712_1000076726 | 292 |
| 286 | 3300025972 | Ga0207668_10000088 | Ga0207668_1000008810 | 292 |
| 287 | 3300025972 | Ga0207668_10001163 | Ga0207668_100011635 | 292 |
| 288 | 3300025972 | Ga0207668_10014551 | Ga0207668_100145511 | 292 |
| 289 | 3300025972 | Ga0207668_10016698 | Ga0207668_100166982 | 292 |
| 290 | 3300025972 | Ga0207668_10039725 | Ga0207668_100397254 | 292 |
| 291 | 3300025981 | Ga0207640_10009680 | Ga0207640_100096803 | 292 |
| 292 | 3300025986 | Ga0207658_10000117 | Ga0207658_1000011781 | 292 |
| 293 | 3300025986 | Ga0207658_10000295 | Ga0207658_1000029518 | 292 |
| 294 | 3300025986 | Ga0207658_10001312 | Ga0207658_1000131221 | 292 |
| 295 | 3300025986 | Ga0207658_10003417 | Ga0207658_100034175 | 292 |
| 296 | 3300025986 | Ga0207658_10013524 | Ga0207658_100135244 | 292 |
| 297 | 3300026035 | Ga0207703_10000049 | Ga0207703_10000049132 | 292 |
| 298 | 3300026035 | Ga0207703_10002065 | Ga0207703_1000206518 | 292 |
| 299 | 3300026035 | Ga0207703_10024961 | Ga0207703_100249611 | 292 |
| 300 | 3300026088 | Ga0207641_10000011 | Ga0207641_10000011264 | 292 |
| 301 | 3300026088 | Ga0207641_10000085 | Ga0207641_100000858 | 292 |
| 302 | 3300026088 | Ga0207641_10000612 | Ga0207641_1000061216 | 292 |
| 303 | 3300026095 | Ga0207676_10002034 | Ga0207676_1000203417 | 292 |
| 304 | 3300026118 | Ga0207675_100368013 | Ga0207675_1003680132 | 292 |
| 305 | 3300028379 | Ga0268266_10002166 | Ga0268266_1000216620 | 292 |
| 306 | 3300028379 | Ga0268266_10003072 | Ga0268266_100030722 | 292 |
| 307 | 3300028380 | Ga0268265_10006324 | Ga0268265_100063241 | 292 |
| 308 | 3300028380 | Ga0268265_10060927 | Ga0268265_100609272 | 292 |
| 309 | 3300028381 | Ga0268264_10000207 | Ga0268264_1000020779 | 292 |
| 310 | 3300028381 | Ga0268264_10016329 | Ga0268264_100163296 | 292 |
| 311 | 3300031691 | Ga0316579_10005052 | Ga0316579_100050523 | 292 |
| 312 | 3300031730 | Ga0307516_10005920 | Ga0307516_1000592012 | 292 |
| 313 | 3300036647 | Ga0316582_0004876 | Ga0316582_0004876_2462_3355 | 292 |
| 314 | 3300037068 | Ga0373925_0120906 | Ga0373925_0120906_906_1802 | 292 |
| 315 | 3300037466 | Ga0395898_0194382 | Ga0395898_0194382_235_1131 | 292 |
| 316 | 3300038443 | Ga0395901_0255084 | Ga0395901_0255084_169_1065 | 292 |
| 317 | 3300039437 | Ga0436365_0541910 | Ga0436365_0541910_393_1289 | 292 |
| 318 | 3300046459 | Ga0495629_0059964 | Ga0495629_0059964_1721_2617 | 292 |
| 319 | 3300046522 | Ga0495643_0013709 | Ga0495643_0013709_351_1247 | 292 |
| 320 | 3300046538 | Ga0495609_0009550 | Ga0495609_0009550_125_1021 | 292 |
| 321 | 3300046542 | Ga0495597_0003637 | Ga0495597_0003637_1662_2558 | 292 |
| 322 | 3300046557 | Ga0495622_0000963 | Ga0495622_0000963_4700_5596 | 292 |
| 323 | 3300046616 | Ga0495668_0044268 | Ga0495668_0044268_1021_1917 | 292 |
| 324 | 3300047443 | Ga0495687_009195 | Ga0495687_009195_3465_4361 | 292 |
| 325 | 3300047469 | Ga0495673_0020562 | Ga0495673_0020562_1101_1979 | 292 |
| 326 | 3300048088 | Ga0495602_0170488 | Ga0495602_0170488_344_1240 | 292 |
| 327 | 3300048905 | Ga0496102_0089262 | Ga0496102_0089262_1851_2747 | 292 |
| 328 | 3300048905 | Ga0496102_0383063 | Ga0496102_0383063_40_936 | 292 |
| 329 | 3300048918 | Ga0496115_0081612 | Ga0496115_0081612_131_1027 | 292 |
| 330 | 3300048920 | Ga0496117_0008011 | Ga0496117_0008011_2682_3578 | 292 |
| 331 | 3300048920 | Ga0496117_0021876 | Ga0496117_0021876_1889_2770 | 292 |
| 332 | 3300048921 | Ga0496118_0003914 | Ga0496118_0003914_15655_16536 | 292 |
| 333 | 3300048921 | Ga0496118_0024526 | Ga0496118_0024526_3013_3909 | 292 |
| 334 | 3300048922 | Ga0496119_0007861 | Ga0496119_0007861_7078_7974 | 292 |
| 335 | 3300048924 | Ga0496121_0000035 | Ga0496121_0000035_242641_243537 | 292 |
| 336 | 3300048924 | Ga0496121_0087705 | Ga0496121_0087705_1187_2068 | 292 |
| 337 | 3300048925 | Ga0496122_0253897 | Ga0496122_0253897_79_960 | 292 |
| 338 | 3300048926 | Ga0496123_0073998 | Ga0496123_0073998_1021_1902 | 292 |
| 339 | 3300048927 | Ga0496124_0033254 | Ga0496124_0033254_146_1030 | 292 |
| 340 | 3300048929 | Ga0496126_0009107 | Ga0496126_0009107_9520_10404 | 292 |
| 341 | 3300049581 | Ga0501047_0005449 | Ga0501047_0005449_6829_7725 | 292 |
| 342 | 3300050489 | nmdc:mga03683_4425_c1 | nmdc:mga03683_4425_c1_1023_1928 | 292 |
| 343 | 3300050491 | nmdc:mga00v17_324_c1 | nmdc:mga00v17_324_c1_9424_10320 | 292 |
| 344 | 3300050493 | nmdc:mga0k408_11007_c1 | nmdc:mga0k408_11007_c1_3030_3926 | 292 |
| 345 | 3300050495 | nmdc:mga04h51_11580_c1 | nmdc:mga04h51_11580_c1_879_1775 | 292 |
| 346 | 3300050496 | nmdc:mga07m45_19324_c1 | nmdc:mga07m45_19324_c1_2683_3579 | 292 |
| 347 | 3300050496 | nmdc:mga07m45_6399_c1 | nmdc:mga07m45_6399_c1_4027_4923 | 292 |
| 348 | 3300050512 | nmdc:mga0n895_64608_c1 | nmdc:mga0n895_64608_c1_2478_3356 | 292 |
| 349 | 3300050516 | nmdc:mga0sz30_41611_c1 | nmdc:mga0sz30_41611_c1_28_933 | 292 |
| 350 | 3300053080 | Ga0500635_0000049 | Ga0500635_0000049_7812_8708 | 292 |
| 351 | 3300053091 | Ga0500647_0047288 | Ga0500647_0047288_294_1190 | 292 |
| 352 | 3300053093 | Ga0500651_0102251 | Ga0500651_0102251_350_1246 | 292 |
| 353 | 3300053094 | Ga0500566_0051810 | Ga0500566_0051810_202_1098 | 292 |
| 354 | 3300053109 | Ga0500569_004988 | Ga0500569_004988_622_1518 | 292 |
| 355 | 3300053119 | Ga0500595_001325 | Ga0500595_001325_3810_4706 | 292 |
| 356 | 3300053122 | Ga0500608_000299 | Ga0500608_000299_15166_16062 | 292 |
| 357 | 3300053123 | Ga0500614_015522 | Ga0500614_015522_191_1087 | 292 |
| 358 | 3300053136 | Ga0500559_0003273 | Ga0500559_0003273_3612_4508 | 292 |
| 359 | 3300053148 | Ga0500590_018155 | Ga0500590_018155_2100_2996 | 292 |
| 360 | 3300053153 | Ga0500616_0000070 | Ga0500616_0000070_15622_16515 | 292 |
| 361 | 3300053155 | Ga0500620_001578 | Ga0500620_001578_1632_2528 | 292 |
| 362 | 3300053162 | Ga0500638_108515 | Ga0500638_108515_78_974 | 292 |
| 363 | 3300053177 | Ga0500636_0008796 | Ga0500636_0008796_1438_2334 | 292 |
| 364 | 3300053729 | Ga0500625_015010 | Ga0500625_015010_307_1203 | 292 |
| 365 | 3300053735 | Ga0500596_001627 | Ga0500596_001627_286_1182 | 292 |
| 366 | iso_pu_bacteria | 2896253425 | 2896254167 | 292 |
| 367 | iso_pu_bacteria | 2919138771 | 2919143043 | 292 |
| 368 | 3300005327 | Ga0070658_10022568 | Ga0070658_100225682 | 293 |
| 369 | 3300005339 | Ga0070660_100281365 | Ga0070660_1002813652 | 293 |
| 370 | 3300005530 | Ga0070679_100303172 | Ga0070679_1003031722 | 293 |
| 371 | 3300005547 | Ga0070693_100121238 | Ga0070693_1001212382 | 293 |
| 372 | 3300005616 | Ga0068852_100026223 | Ga0068852_1000262235 | 293 |
| 373 | 3300006042 | Ga0075368_10003337 | Ga0075368_100033373 | 293 |
| 374 | 3300006048 | Ga0075363_100059091 | Ga0075363_1000590911 | 293 |
| 375 | 3300006177 | Ga0075362_10020995 | Ga0075362_100209951 | 293 |
| 376 | 3300006178 | Ga0075367_10000791 | Ga0075367_1000079111 | 293 |
| 377 | 3300006353 | Ga0075370_10015898 | Ga0075370_100158982 | 293 |
| 378 | 3300013102 | Ga0157371_10060075 | Ga0157371_100600753 | 293 |
| 379 | 3300013105 | Ga0157369_10003672 | Ga0157369_100036723 | 293 |
| 380 | 3300013307 | Ga0157372_10002428 | Ga0157372_1000242813 | 293 |
| 381 | 3300013307 | Ga0157372_10127500 | Ga0157372_101275002 | 293 |
| 382 | 3300013307 | Ga0157372_10160902 | Ga0157372_101609022 | 293 |
| 383 | 3300025909 | Ga0207705_10030133 | Ga0207705_100301332 | 293 |
| 384 | 3300025919 | Ga0207657_10046893 | Ga0207657_100468932 | 293 |
| 385 | 3300026142 | Ga0207698_10009264 | Ga0207698_100092642 | 293 |
| 386 | 3300027866 | Ga0209813_10000017 | Ga0209813_1000001774 | 293 |
| 387 | 3300031548 | Ga0307408_100159607 | Ga0307408_1001596072 | 293 |
| 388 | 3300031824 | Ga0307413_10142893 | Ga0307413_101428932 | 293 |
| 389 | 3300037312 | Ga0395899_0000032 | Ga0395899_0000032_139607_140506 | 293 |
| 390 | 3300046460 | Ga0495638_0000388 | Ga0495638_0000388_33043_33927 | 293 |
| 391 | 3300046506 | Ga0495583_0000252 | Ga0495583_0000252_58409_59293 | 293 |
| 392 | 3300046519 | Ga0495632_0001790 | Ga0495632_0001790_10606_11490 | 293 |
| 393 | 3300046524 | Ga0495648_0000308 | Ga0495648_0000308_20360_21244 | 293 |
| 394 | 3300046692 | Ga0495671_0000011 | Ga0495671_0000011_29294_30178 | 293 |
| 395 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_297358_298242 | 293 |
| 396 | 3300050489 | nmdc:mga03683_2694_c1 | nmdc:mga03683_2694_c1_1604_2488 | 293 |
| 397 | 3300050491 | nmdc:mga00v17_2946_c1 | nmdc:mga00v17_2946_c1_7658_8542 | 293 |
| 398 | 3300050491 | nmdc:mga00v17_87297_c1 | nmdc:mga00v17_87297_c1_881_1771 | 293 |
| 399 | 3300050494 | nmdc:mga06z11_20_c1 | nmdc:mga06z11_20_c1_1396_2298 | 293 |
| 400 | 3300050495 | nmdc:mga04h51_406_c1 | nmdc:mga04h51_406_c1_8151_9053 | 293 |
| 401 | 3300050496 | nmdc:mga07m45_95330_c1 | nmdc:mga07m45_95330_c1_272_1174 | 293 |
| 402 | 3300053178 | Ga0500637_0000032 | Ga0500637_0000032_10239_11123 | 293 |
| 403 | 3300006051 | Ga0075364_10015501 | Ga0075364_100155014 | 294 |
| 404 | 3300046542 | Ga0495597_0000326 | Ga0495597_0000326_3594_4496 | 294 |
| 405 | 3300053119 | Ga0500595_003342 | Ga0500595_003342_2188_3075 | 294 |
| 406 | 3300028800 | Ga0265338_10000014 | Ga0265338_1000001460 | 295 |
| 407 | 3300031241 | Ga0265325_10000008 | Ga0265325_10000008172 | 295 |
| 408 | 3300031249 | Ga0265339_10002066 | Ga0265339_100020666 | 295 |
| 409 | 3300031250 | Ga0265331_10002272 | Ga0265331_1000227210 | 295 |
| 410 | 3300031344 | Ga0265316_10003871 | Ga0265316_100038717 | 295 |
| 411 | 3300031712 | Ga0265342_10017914 | Ga0265342_100179144 | 295 |
| 412 | 3300006195 | Ga0075366_10001044 | Ga0075366_100010449 | 296 |
| 413 | 3300049743 | Ga0501081_0067400 | Ga0501081_0067400_1340_2230 | 296 |
| 414 | 3300050493 | nmdc:mga0k408_3848_c1 | nmdc:mga0k408_3848_c1_5236_6162 | 296 |
| 415 | 3300050494 | nmdc:mga06z11_4855_c1 | nmdc:mga06z11_4855_c1_128_1054 | 296 |
| 416 | 3300050496 | nmdc:mga07m45_42031_c1 | nmdc:mga07m45_42031_c1_94_1020 | 296 |
| 417 | 3300054114 | Ga0501084_0052609 | Ga0501084_0052609_968_1858 | 296 |
| 418 | 3300060353 | Ga0501082_0181296 | Ga0501082_0181296_124_1014 | 296 |
| 419 | 3300005367 | Ga0070667_100000461 | Ga0070667_10000046140 | 299 |
| 420 | 3300025916 | Ga0207663_10000017 | Ga0207663_1000001715 | 299 |
| 421 | 3300025986 | Ga0207658_10000397 | Ga0207658_1000039732 | 299 |
| 422 | 3300048926 | Ga0496123_0003707 | Ga0496123_0003707_11128_12030 | 299 |
| 423 | 3300048929 | Ga0496126_0006072 | Ga0496126_0006072_12276_13178 | 299 |
| 424 | 3300053121 | Ga0500607_000028 | Ga0500607_000028_33022_33984 | 299 |
| 425 | 3300005548 | Ga0070665_100001444 | Ga0070665_1000014445 | 301 |
| 426 | 3300005841 | Ga0068863_100002414 | Ga0068863_1000024143 | 301 |
| 427 | 3300005843 | Ga0068860_100009034 | Ga0068860_10000903411 | 301 |
| 428 | 3300005843 | Ga0068860_100034069 | Ga0068860_1000340695 | 301 |
| 429 | 3300005844 | Ga0068862_100008576 | Ga0068862_1000085764 | 301 |
| 430 | 3300025735 | Ga0207713_1000396 | Ga0207713_100039618 | 301 |
| 431 | 3300025941 | Ga0207711_10000707 | Ga0207711_1000070722 | 301 |
| 432 | 3300026088 | Ga0207641_10002295 | Ga0207641_1000229515 | 301 |
| 433 | 3300028379 | Ga0268266_10017096 | Ga0268266_100170965 | 301 |
| 434 | 3300028380 | Ga0268265_10022865 | Ga0268265_100228654 | 301 |
| 435 | 3300028381 | Ga0268264_10000709 | Ga0268264_1000070916 | 301 |
| 436 | 3300028381 | Ga0268264_10024689 | Ga0268264_100246895 | 301 |
| 437 | 3300048906 | Ga0496103_0009888 | Ga0496103_0009888_3155_4063 | 301 |
| 438 | 3300048920 | Ga0496117_0006022 | Ga0496117_0006022_10007_10915 | 301 |
| 439 | 3300048921 | Ga0496118_0009705 | Ga0496118_0009705_7229_8137 | 301 |
| 440 | 3300048926 | Ga0496123_0046486 | Ga0496123_0046486_857_1765 | 301 |
| 441 | 3300048927 | Ga0496124_0003633 | Ga0496124_0003633_16213_17121 | 301 |
| 442 | 3300048927 | Ga0496124_0000946 | Ga0496124_0000946_40461_41414 | 306 |
| 443 | 3300045049 | Ga0466959_0164251 | Ga0466959_0164251_431_1369 | 308 |
| 444 | 3300003305 | Ga0006770J48903_1065414 | Ga0006770J48903_10654142 | 311 |
| 445 | 3300003574 | Ga0007410J51695_1046964 | Ga0007410J51695_10469642 | 311 |
| 446 | 3300003575 | Ga0007409J51694_1040680 | Ga0007409J51694_10406802 | 311 |
| 447 | 3300032005 | Ga0307411_10536386 | Ga0307411_105363861 | 311 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6t38-assembly1.cif.gz_A | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9924 | 2 | 288 |
| 1mp3-assembly1.cif.gz_A | l89t variant of s. enterica rmla | 0.9908 | 2 | 285 |
| 1iim-assembly1.cif.gz_A | thymidylyltransferase complexed with ttp | 0.9906 | 2 | 285 |
| 6tqg-assembly1.cif.gz_D | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9905 | 1 | 288 |
| 6tqg-assembly1.cif.gz_A | pseudomonas aeruginosa rmla in complex with allosteric inhibitor | 0.9901 | 2 | 288 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9898 | 2 | 288 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9587 | 1 | 236 | 3.90.550.10 |
| 4b2xA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9472 | 2 | 288 | 3.90.550.10 |
| 4ecmA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9056 | 1 | 236 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9012 | 1 | 223 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A846Q3P9-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 1.002 | 1 | 98 |
GO:0008879
GO:0045226 |
| AF-A0A3D6A514-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9996 | 2 | 102 |
GO:0008879
GO:0045226 |
| AF-A0A6I3TEG1-F1-model_v4 | deleted | 0.9996 | 14 | 126 |
|
| AF-A0A7V4F2T9-F1-model_v4 | glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) | 0.9984 | 1 | 216 |
GO:0008879
GO:0045226 |
| AF-W3YZ78-F1-model_v4 | deleted | 0.9981 | 34 | 243 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar