F446060

General Info

Members Datasets Scaffolds Average Seq Length
447 261 427 294

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842357229|2842363086
Length 289
Sequence ILAGGSGTRLYPITMAVSKQLMPVYDKPMIYYPLTTLMLAGIKEILIITTPHDNEAFKRLLGEGSQWGISIEYAVQPSPDGLAQAFIIGADFVGKNPSSLILGDNIYHGHGLPELLRSDEAMTGARVFAYHVTDPERYGVVEFDRTMKALSIEEKPVKPRSNWAVTGLYFYDEQVVDIAANLKPSPRGELEITDVNRIYLQRGQLSVELMGRGYAWLDTGTPDSLLEAADFVGTLEKRQGFKIACPEEVAYRMGHIDNAQLTKLAKDLGKSNYGRYLMKLAEAGDDSAF

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
3 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
4 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
5 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
6 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
7 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
8 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
9 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
10 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
11 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
12 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
13 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
14 2919150387 Rahnella aceris 1817 Isolate Unclassified
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2927143783 Rahnella sp. 2050 Isolate Unclassified
17 2996887358 Rhizobium sp. R711 Isolate Nodule
18 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
19 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
249 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 8005321885 Rhizobium sp. R72 Isolate Nodule
261 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 1.34
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.98
Nodule 0.89
Rhizoplane 2.91
Rhizosphere 71.81
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006770J48903_1065414 3300003305 Bacteria 1299
2 Ga0007410J51695_1046964 3300003574 Bacteria 1835
3 Ga0007409J51694_1040680 3300003575 Bacteria 4197
4 Ga0055530_10010301 3300003791 Bacteria 3474
5 Ga0065707_10199413 3300005295 Bacteria 1313
6 Ga0070658_10003255 3300005327 Bacteria 13407
7 Ga0070658_10018732 3300005327 Bacteria 5546
8 Ga0070658_10022568 3300005327 Bacteria 5051
9 Ga0070658_10099684 3300005327 Bacteria 2400
10 Ga0070683_100103511 3300005329 Bacteria 2683
11 Ga0070670_100000201 3300005331 Bacteria 55479
12 Ga0070670_100000426 3300005331 Bacteria 34748
13 Ga0070666_10038677 3300005335 Bacteria 3176
14 Ga0070666_10057686 3300005335 Bacteria 2624
15 Ga0070666_10124924 3300005335 Bacteria 1786
16 Ga0070680_100019639 3300005336 Bacteria 5359
17 Ga0070682_100007594 3300005337 Bacteria 6110
18 Ga0070660_100074388 3300005339 Bacteria 2658
19 Ga0070660_100215637 3300005339 Bacteria 1559
20 Ga0070660_100281365 3300005339 Bacteria 1361
21 Ga0070668_100000042 3300005347 Bacteria 78694
22 Ga0070668_100001612 3300005347 Bacteria 16338
23 Ga0070668_100010952 3300005347 Bacteria 6748
24 Ga0070668_100032014 3300005347 Bacteria 4001
25 Ga0070668_100038140 3300005347 Bacteria 3671
26 Ga0070668_100062824 3300005347 Bacteria 2878
27 Ga0070669_100000258 3300005353 Bacteria 43403
28 Ga0070669_100003220 3300005353 Bacteria 11725
29 Ga0070671_100000476 3300005355 Bacteria 27913
30 Ga0070671_100043773 3300005355 Bacteria 3720
31 Ga0070659_100043836 3300005366 Bacteria 3500
32 Ga0070667_100000122 3300005367 Bacteria 99820
33 Ga0070667_100000147 3300005367 Bacteria 88345
34 Ga0070667_100000461 3300005367 Bacteria 41911
35 Ga0070667_100000508 3300005367 Bacteria 39312
36 Ga0070667_100001710 3300005367 Bacteria 19618
37 Ga0070667_100016940 3300005367 Bacteria 6031
38 Ga0070667_100021752 3300005367 Bacteria 5322
39 Ga0070681_10021909 3300005458 Bacteria 6409
40 Ga0070699_100090197 3300005518 Bacteria 2679
41 Ga0070679_100005433 3300005530 Bacteria 11811
42 Ga0070679_100303172 3300005530 Bacteria 1548
43 Ga0070684_100032961 3300005535 Bacteria 4420
44 Ga0068853_100002782 3300005539 Bacteria 13227
45 Ga0068853_100003626 3300005539 Bacteria 11836
46 Ga0070693_100121238 3300005547 Bacteria 1622
47 Ga0070665_100000015 3300005548 Bacteria 462744
48 Ga0070665_100001444 3300005548 Bacteria 27874
49 Ga0070665_100002287 3300005548 Bacteria 21311
50 Ga0070665_100065787 3300005548 Bacteria 3636
51 Ga0068855_100031858 3300005563 Bacteria 6294
52 Ga0068855_100195456 3300005563 Bacteria 2279
53 Ga0068855_100230653 3300005563 Bacteria 2073
54 Ga0068857_100000856 3300005577 Bacteria 22822
55 Ga0068854_100014474 3300005578 Bacteria 5202
56 Ga0068852_100026223 3300005616 Bacteria 4734
57 Ga0068859_100000681 3300005617 Bacteria 34110
58 Ga0068864_100000135 3300005618 Bacteria 71759
59 Ga0068864_100000240 3300005618 Bacteria 49024
60 Ga0068864_100011281 3300005618 Bacteria 7382
61 Ga0068864_100085377 3300005618 Bacteria 2775
62 Ga0068863_100000066 3300005841 Bacteria 117816
63 Ga0068863_100000119 3300005841 Bacteria 82539
64 Ga0068863_100000676 3300005841 Bacteria 34484
65 Ga0068863_100002414 3300005841 Bacteria 18556
66 Ga0068863_100010556 3300005841 Bacteria 8967
67 Ga0068863_100070086 3300005841 Bacteria 3315
68 Ga0068858_100001650 3300005842 Bacteria 22788
69 Ga0068858_100006796 3300005842 Bacteria 11125
70 Ga0068858_100064279 3300005842 Bacteria 3396
71 Ga0068860_100000133 3300005843 Bacteria 120382
72 Ga0068860_100000152 3300005843 Bacteria 112187
73 Ga0068860_100009034 3300005843 Bacteria 9921
74 Ga0068860_100034069 3300005843 Bacteria 4884
75 Ga0068860_100113993 3300005843 Bacteria 2585
76 Ga0068860_100171734 3300005843 Bacteria 2094
77 Ga0068862_100000619 3300005844 Bacteria 36984
78 Ga0068862_100008576 3300005844 Bacteria 8457
79 Ga0068862_100043293 3300005844 Bacteria 3838
80 Ga0075368_10002022 3300006042 Bacteria 6562
81 Ga0075368_10003337 3300006042 Bacteria 5343
82 Ga0075363_100059091 3300006048 Bacteria 2061
83 Ga0075364_10000104 3300006051 Bacteria 34174
84 Ga0075364_10015501 3300006051 Bacteria 4729
85 Ga0075362_10020995 3300006177 Bacteria 2735
86 Ga0075367_10000791 3300006178 Bacteria 12445
87 Ga0075367_10002119 3300006178 Bacteria 8921
88 Ga0075366_10001044 3300006195 Bacteria 13603
89 Ga0075366_10050686 3300006195 Bacteria 2465
90 Ga0075370_10015898 3300006353 Bacteria 4040
91 Ga0075434_100342242 3300006871 Bacteria 1517
92 Ga0097620_100000681 3300006931 Bacteria 34110
93 Ga0105251_10000434 3300009011 Bacteria 40584
94 Ga0105250_10005371 3300009092 Bacteria 5753
95 Ga0105250_10084231 3300009092 Bacteria 1290
96 Ga0105240_10127027 3300009093 Bacteria 3063
97 Ga0105247_10013032 3300009101 Bacteria 4985
98 Ga0105248_10002170 3300009177 Bacteria 21730
99 Ga0105248_10052533 3300009177 Bacteria 4573
100 Ga0105248_10364393 3300009177 Bacteria 1627
101 Ga0105237_10001961 3300009545 Bacteria 26196
102 Ga0105237_10081608 3300009545 Bacteria 3225
103 Ga0105238_10115524 3300009551 Bacteria 2663
104 Ga0105249_10001002 3300009553 Bacteria 25047
105 Ga0105249_10004337 3300009553 Bacteria 12270
106 Ga0157371_10060075 3300013102 Bacteria 2695
107 Ga0157370_10076809 3300013104 Bacteria 3146
108 Ga0157370_10106492 3300013104 Bacteria 2624
109 Ga0157370_10375870 3300013104 Bacteria 1309
110 Ga0157369_10003672 3300013105 Bacteria 18227
111 Ga0171462_1013 3300013250 Bacteria 202864
112 Ga0163162_10109578 3300013306 Bacteria 2858
113 Ga0163162_10296478 3300013306 Bacteria 1749
114 Ga0157372_10002428 3300013307 Bacteria 20176
115 Ga0157372_10127500 3300013307 Bacteria 2926
116 Ga0157372_10160902 3300013307 Bacteria 2595
117 Ga0163163_10018515 3300014325 Bacteria 6522
118 Ga0163163_10215477 3300014325 Bacteria 1969
119 Ga0157379_10004599 3300014968 Bacteria 11839
120 Ga0157379_10124436 3300014968 Bacteria 2320
121 Ga0213876_10000341 3300021384 Bacteria 40559
122 Ga0209758_1070306 3300025297 Bacteria 1105
123 Ga0209050_1004466 3300025298 Bacteria 9428
124 Ga0207696_1009712 3300025711 Bacteria 3573
125 Ga0207696_1041632 3300025711 Bacteria 1341
126 Ga0207713_1000396 3300025735 Bacteria 46595
127 Ga0207713_1032975 3300025735 Bacteria 2268
128 Ga0207710_10100431 3300025900 Bacteria 1364
129 Ga0207680_10038801 3300025903 Bacteria 2759
130 Ga0207680_10098770 3300025903 Bacteria 1872
131 Ga0207705_10005999 3300025909 Bacteria 9043
132 Ga0207705_10009115 3300025909 Bacteria 7233
133 Ga0207705_10030133 3300025909 Bacteria 3870
134 Ga0207707_10004567 3300025912 Bacteria 12168
135 Ga0207695_10036393 3300025913 Bacteria 5322
136 Ga0207695_10241504 3300025913 Bacteria 1707
137 Ga0207695_10497894 3300025913 Bacteria 1101
138 Ga0207671_10005144 3300025914 Bacteria 12182
139 Ga0207663_10000017 3300025916 Bacteria 145654
140 Ga0207660_10000900 3300025917 Bacteria 19531
141 Ga0207657_10007405 3300025919 Bacteria 11253
142 Ga0207657_10046893 3300025919 Bacteria 3783
143 Ga0207652_10004699 3300025921 Bacteria 11076
144 Ga0207681_10000469 3300025923 Bacteria 28325
145 Ga0207681_10003585 3300025923 Bacteria 9664
146 Ga0207681_10061645 3300025923 Bacteria 2579
147 Ga0207694_10155955 3300025924 Bacteria 1841
148 Ga0207650_10000016 3300025925 Bacteria 361958
149 Ga0207644_10000272 3300025931 Bacteria 34285
150 Ga0207644_10019639 3300025931 Bacteria 4588
151 Ga0207690_10095135 3300025932 Bacteria 2116
152 Ga0207711_10000707 3300025941 Bacteria 32848
153 Ga0207711_10004476 3300025941 Bacteria 11912
154 Ga0207711_10006678 3300025941 Bacteria 9711
155 Ga0207711_10242386 3300025941 Bacteria 1653
156 Ga0207661_10235052 3300025944 Bacteria 1624
157 Ga0207679_10089668 3300025945 Bacteria 2374
158 Ga0207667_10035472 3300025949 Bacteria 5350
159 Ga0207712_10000767 3300025961 Bacteria 24118
160 Ga0207712_10068805 3300025961 Bacteria 2538
161 Ga0207668_10000088 3300025972 Bacteria 69295
162 Ga0207668_10000622 3300025972 Bacteria 21998
163 Ga0207668_10001163 3300025972 Bacteria 15629
164 Ga0207668_10012023 3300025972 Bacteria 5283
165 Ga0207668_10014551 3300025972 Bacteria 4870
166 Ga0207668_10016698 3300025972 Bacteria 4586
167 Ga0207668_10033229 3300025972 Bacteria 3415
168 Ga0207668_10039725 3300025972 Bacteria 3170
169 Ga0207640_10009680 3300025981 Bacteria 5405
170 Ga0207658_10000092 3300025986 Bacteria 99965
171 Ga0207658_10000117 3300025986 Bacteria 88361
172 Ga0207658_10000295 3300025986 Bacteria 52135
173 Ga0207658_10000397 3300025986 Bacteria 41950
174 Ga0207658_10001312 3300025986 Bacteria 19589
175 Ga0207658_10003417 3300025986 Bacteria 11241
176 Ga0207658_10005469 3300025986 Bacteria 8708
177 Ga0207658_10013524 3300025986 Bacteria 5578
178 Ga0207677_10081860 3300026023 Bacteria 2318
179 Ga0207703_10000049 3300026035 Bacteria 149817
180 Ga0207703_10002065 3300026035 Bacteria 17677
181 Ga0207703_10024961 3300026035 Bacteria 4702
182 Ga0207703_10155720 3300026035 Bacteria 1996
183 Ga0207639_10000621 3300026041 Bacteria 24436
184 Ga0207639_10127639 3300026041 Bacteria 2100
185 Ga0207641_10000011 3300026088 Bacteria 384362
186 Ga0207641_10000085 3300026088 Bacteria 133497
187 Ga0207641_10000612 3300026088 Bacteria 39133
188 Ga0207641_10000742 3300026088 Bacteria 35060
189 Ga0207641_10002295 3300026088 Bacteria 17793
190 Ga0207641_10080758 3300026088 Bacteria 2822
191 Ga0207676_10002034 3300026095 Bacteria 14697
192 Ga0207674_10001997 3300026116 Bacteria 25875
193 Ga0207675_100368013 3300026118 Bacteria 1411
194 Ga0207698_10009264 3300026142 Bacteria 6266
195 Ga0209371_1013385 3300027312 Bacteria 2308
196 Ga0209981_1001618 3300027378 Bacteria 2849
197 Ga0209999_1000174 3300027543 Bacteria 8655
198 Ga0209813_10000017 3300027866 Bacteria 75687
199 Ga0268266_10000005 3300028379 Bacteria 1448194
200 Ga0268266_10002166 3300028379 Bacteria 21556
201 Ga0268266_10003072 3300028379 Bacteria 17061
202 Ga0268266_10017096 3300028379 Bacteria 6193
203 Ga0268265_10006324 3300028380 Bacteria 8026
204 Ga0268265_10022865 3300028380 Bacteria 4400
205 Ga0268265_10060927 3300028380 Bacteria 2894
206 Ga0268265_10143009 3300028380 Bacteria 2005
207 Ga0268264_10000111 3300028381 Bacteria 204718
208 Ga0268264_10000207 3300028381 Bacteria 120086
209 Ga0268264_10000709 3300028381 Bacteria 38415
210 Ga0268264_10016329 3300028381 Bacteria 6080
211 Ga0268264_10024689 3300028381 Bacteria 4909
212 Ga0265323_10003167 3300028653 Bacteria 7329
213 Ga0265323_10004115 3300028653 Bacteria 6305
214 Ga0265322_10037761 3300028654 Bacteria 1376
215 Ga0307517_10002892 3300028786 Bacteria 27201
216 Ga0265338_10000014 3300028800 Bacteria 378751
217 Ga0265338_10026766 3300028800 Bacteria 5804
218 Ga0265338_10137194 3300028800 Bacteria 1921
219 Ga0268256_1027989 3300030500 Bacteria 1397
220 Ga0265330_10001818 3300031235 Bacteria 11956
221 Ga0265330_10002236 3300031235 Bacteria 10664
222 Ga0265328_10019983 3300031239 Bacteria 2567
223 Ga0265325_10000008 3300031241 Bacteria 186174
224 Ga0265329_10000020 3300031242 Bacteria 64345
225 Ga0265339_10002066 3300031249 Bacteria 14742
226 Ga0265331_10002272 3300031250 Bacteria 13131
227 Ga0265327_10001380 3300031251 Bacteria 31060
228 Ga0265316_10000054 3300031344 Bacteria 124687
229 Ga0265316_10000080 3300031344 Bacteria 100625
230 Ga0265316_10001617 3300031344 Bacteria 24031
231 Ga0265316_10003871 3300031344 Bacteria 15011
232 Ga0265316_10017073 3300031344 Bacteria 6281
233 Ga0265316_10042787 3300031344 Bacteria 3617
234 Ga0265316_10199586 3300031344 Bacteria 1483
235 Ga0307513_10345844 3300031456 Bacteria 1236
236 Ga0307408_100159607 3300031548 Bacteria 1789
237 Ga0316579_10005052 3300031691 Bacteria 5290
238 Ga0265342_10004856 3300031712 Bacteria 10417
239 Ga0265342_10011323 3300031712 Bacteria 6114
240 Ga0265342_10017914 3300031712 Bacteria 4598
241 Ga0265342_10037508 3300031712 Bacteria 2955
242 Ga0265342_10084492 3300031712 Bacteria 1828
243 Ga0316576_10006930 3300031727 Bacteria 7086
244 Ga0316578_10012834 3300031728 Bacteria 4424
245 Ga0307516_10005920 3300031730 Bacteria 14466
246 Ga0316577_10000193 3300031733 Bacteria 20297
247 Ga0307413_10142893 3300031824 Bacteria 1656
248 Ga0307412_10107267 3300031911 Bacteria 1987
249 Ga0307414_10233051 3300032004 Bacteria 1519
250 Ga0307411_10536386 3300032005 Bacteria 996
251 Ga0316585_10025351 3300032137 Bacteria 1839
252 Ga0316593_10034972 3300032168 Bacteria 1651
253 Ga0316588_1013622 3300033528 Bacteria 1768
254 Ga0316596_1000403 3300033541 Bacteria 7173
255 Ga0373923_0028673 3300035111 Bacteria 2228
256 Ga0373935_0110081 3300035692 Bacteria 1827
257 Ga0373927_0309061 3300035695 Bacteria 1041
258 Ga0373933_0022007 3300035724 Bacteria 3627
259 Ga0373947_0023381 3300035725 Bacteria 3594
260 Ga0373937_0003329 3300036401 Bacteria 13489
261 Ga0316582_0004876 3300036647 Bacteria 6849
262 Ga0373925_0120906 3300037068 Bacteria 2033
263 Ga0395899_0000032 3300037312 Bacteria 312705
264 Ga0395899_0215447 3300037312 Bacteria 1332
265 Ga0395898_0194382 3300037466 Bacteria 1938
266 Ga0395905_0055579 3300037471 Bacteria 3705
267 Ga0436364_1462473 3300037853 Bacteria 1618
268 Ga0395901_0255084 3300038443 Bacteria 1826
269 Ga0436365_0541910 3300039437 Bacteria 1622
270 Ga0436365_1702191 3300039437 Bacteria 116634
271 Ga0436361_0055448 3300039447 Bacteria 9876
272 Ga0436361_0555098 3300039447 Bacteria 28878
273 Ga0436363_1271159 3300039450 Bacteria 2245
274 Ga0436363_1440908 3300039450 Bacteria 1601
275 Ga0466961_0016230 3300044693 Bacteria 4782
276 Ga0466959_0164251 3300045049 Bacteria 1560
277 Ga0451576_0000053 3300045051 Bacteria 308708
278 Ga0495603_0022314 3300046455 Bacteria 3834
279 Ga0495603_0206311 3300046455 Bacteria 1135
280 Ga0495629_0018268 3300046459 Bacteria 5022
281 Ga0495629_0059964 3300046459 Bacteria 2660
282 Ga0495629_0168457 3300046459 Bacteria 1521
283 Ga0495638_0000388 3300046460 Bacteria 54286
284 Ga0495582_0041591 3300046473 Bacteria 2532
285 Ga0495584_0003449 3300046491 Bacteria 8698
286 Ga0495584_0027696 3300046491 Bacteria 2872
287 Ga0495585_0053136 3300046492 Bacteria 2242
288 Ga0495594_0039808 3300046499 Bacteria 2570
289 Ga0495594_0100907 3300046499 Bacteria 1623
290 Ga0495596_0001695 3300046500 Bacteria 12450
291 Ga0495583_0000252 3300046506 Bacteria 88617
292 Ga0495606_0087561 3300046507 Bacteria 1922
293 Ga0495610_0000082 3300046512 Bacteria 113066
294 Ga0495610_0000243 3300046512 Bacteria 57521
295 Ga0495620_0002894 3300046515 Bacteria 9868
296 Ga0495632_0001790 3300046519 Bacteria 17334
297 Ga0495632_0140561 3300046519 Bacteria 1120
298 Ga0495643_0000470 3300046522 Bacteria 51330
299 Ga0495643_0013709 3300046522 Bacteria 4841
300 Ga0495648_0000308 3300046524 Bacteria 54286
301 Ga0495666_0012739 3300046526 Bacteria 4191
302 Ga0495640_0108209 3300046533 Bacteria 1819
303 Ga0495609_0009550 3300046538 Bacteria 4690
304 Ga0495597_0000326 3300046542 Bacteria 43111
305 Ga0495597_0003637 3300046542 Bacteria 8859
306 Ga0495622_0000963 3300046557 Bacteria 15444
307 Ga0495622_0030206 3300046557 Bacteria 2532
308 Ga0495633_0033947 3300046558 Bacteria 2456
309 Ga0495633_0069888 3300046558 Bacteria 1639
310 Ga0495668_0009308 3300046616 Bacteria 6039
311 Ga0495668_0044268 3300046616 Bacteria 2474
312 Ga0495668_0127523 3300046616 Bacteria 1393
313 Ga0495611_0013453 3300046648 Bacteria 3484
314 Ga0495625_0000832 3300046660 Bacteria 42398
315 Ga0495625_0005611 3300046660 Bacteria 11377
316 Ga0495625_0049679 3300046660 Bacteria 3014
317 Ga0495588_0039938 3300046674 Bacteria 2392
318 Ga0495657_0299751 3300046675 Bacteria 959
319 Ga0495670_0002789 3300046691 Bacteria 8637
320 Ga0495671_0000011 3300046692 Bacteria 365582
321 Ga0495672_0030225 3300047320 Bacteria 3402
322 Ga0495676_0155496 3300047321 Bacteria 1623
323 Ga0495687_009195 3300047443 Bacteria 5557
324 Ga0495677_0019052 3300047445 Bacteria 2489
325 Ga0495673_0000013 3300047469 Bacteria 612902
326 Ga0495673_0020562 3300047469 Bacteria 3284
327 Ga0495602_0170488 3300048088 Bacteria 1690
328 Ga0495626_0001225 3300048091 Bacteria 21121
329 Ga0496102_0000698 3300048905 Bacteria 33409
330 Ga0496102_0089262 3300048905 Bacteria 2851
331 Ga0496102_0383063 3300048905 Bacteria 1323
332 Ga0496102_0549597 3300048905 Bacteria 1077
333 Ga0496103_0000258 3300048906 Bacteria 50941
334 Ga0496103_0000429 3300048906 Bacteria 36512
335 Ga0496103_0009888 3300048906 Bacteria 5642
336 Ga0496105_0024975 3300048908 Bacteria 4858
337 Ga0496105_0056984 3300048908 Bacteria 3226
338 Ga0496112_0378241 3300048915 Bacteria 1357
339 Ga0496115_0007401 3300048918 Bacteria 8077
340 Ga0496115_0081612 3300048918 Bacteria 2634
341 Ga0496116_0002399 3300048919 Bacteria 19739
342 Ga0496116_0004306 3300048919 Bacteria 13620
343 Ga0496116_0038217 3300048919 Bacteria 3336
344 Ga0496117_0006022 3300048920 Bacteria 12465
345 Ga0496117_0008011 3300048920 Bacteria 10134
346 Ga0496117_0010819 3300048920 Bacteria 8235
347 Ga0496117_0021876 3300048920 Bacteria 5153
348 Ga0496117_0214152 3300048920 Bacteria 1077
349 Ga0496118_0003914 3300048921 Bacteria 18229
350 Ga0496118_0009705 3300048921 Bacteria 9665
351 Ga0496118_0024526 3300048921 Bacteria 5201
352 Ga0496118_0036593 3300048921 Bacteria 3964
353 Ga0496118_0039587 3300048921 Bacteria 3758
354 Ga0496118_0228059 3300048921 Bacteria 1077
355 Ga0496119_0007861 3300048922 Bacteria 9498
356 Ga0496119_0035229 3300048922 Bacteria 3282
357 Ga0496120_0048724 3300048923 Bacteria 2436
358 Ga0496121_0000035 3300048924 Bacteria 374316
359 Ga0496121_0001015 3300048924 Bacteria 50131
360 Ga0496121_0004189 3300048924 Bacteria 19692
361 Ga0496121_0006397 3300048924 Bacteria 14645
362 Ga0496121_0087705 3300048924 Bacteria 2442
363 Ga0496122_0253897 3300048925 Bacteria 981
364 Ga0496123_0003707 3300048926 Bacteria 16803
365 Ga0496123_0046486 3300048926 Bacteria 2944
366 Ga0496123_0073998 3300048926 Bacteria 2111
367 Ga0496124_0000943 3300048927 Bacteria 46595
368 Ga0496124_0000946 3300048927 Bacteria 46483
369 Ga0496124_0003633 3300048927 Bacteria 18722
370 Ga0496124_0010844 3300048927 Bacteria 9175
371 Ga0496124_0033254 3300048927 Bacteria 4537
372 Ga0496124_0224302 3300048927 Bacteria 1411
373 Ga0496124_0334825 3300048927 Bacteria 1077
374 Ga0496126_0006072 3300048929 Bacteria 13556
375 Ga0496126_0009107 3300048929 Bacteria 10601
376 Ga0501034_0000627 3300049571 Bacteria 55016
377 Ga0501043_0152621 3300049579 Bacteria 1807
378 Ga0501047_0005449 3300049581 Bacteria 11975
379 Ga0501081_0067400 3300049743 Bacteria 2491
380 nmdc:mga03683_2694_c1 3300050489 Bacteria 5569
381 nmdc:mga03683_4425_c1 3300050489 Bacteria 4660
382 nmdc:mga03n38_21802_c1 3300050490 Bacteria 2583
383 nmdc:mga00v17_2946_c1 3300050491 Bacteria 8733
384 nmdc:mga00v17_324_c1 3300050491 Bacteria 27070
385 nmdc:mga00v17_87297_c1 3300050491 Bacteria 1955
386 nmdc:mga0k408_11007_c1 3300050493 Bacteria 4911
387 nmdc:mga0k408_3848_c1 3300050493 Bacteria 7956
388 nmdc:mga06z11_20_c1 3300050494 Bacteria 75712
389 nmdc:mga06z11_4855_c1 3300050494 Bacteria 5325
390 nmdc:mga04h51_11580_c1 3300050495 Bacteria 2452
391 nmdc:mga04h51_406_c1 3300050495 Bacteria 10431
392 nmdc:mga07m45_19324_c1 3300050496 Bacteria 3691
393 nmdc:mga07m45_42031_c1 3300050496 Bacteria 2562
394 nmdc:mga07m45_6399_c1 3300050496 Bacteria 5950
395 nmdc:mga07m45_95330_c1 3300050496 Bacteria 1707
396 nmdc:mga0n895_64608_c1 3300050512 Bacteria 3620
397 nmdc:mga0rr50_401164_c1 3300050513 Bacteria 1158
398 nmdc:mga0sz30_41611_c1 3300050516 Bacteria 1932
399 Ga0500635_0000049 3300053080 Bacteria 80019
400 Ga0495619_0046287 3300053085 Bacteria 2860
401 Ga0500647_0047288 3300053091 Bacteria 2068
402 Ga0500651_0102251 3300053093 Bacteria 1756
403 Ga0500566_0051810 3300053094 Bacteria 2347
404 Ga0500641_0167716 3300053096 Bacteria 945
405 Ga0500562_003801 3300053108 Bacteria 3801
406 Ga0500569_004988 3300053109 Bacteria 2826
407 Ga0500595_001325 3300053119 Bacteria 13414
408 Ga0500595_003342 3300053119 Bacteria 7534
409 Ga0500607_000028 3300053121 Bacteria 91877
410 Ga0500608_000299 3300053122 Bacteria 19175
411 Ga0500614_015522 3300053123 Bacteria 1698
412 Ga0500642_0000001 3300053130 Bacteria 1468402
413 Ga0500559_0003273 3300053136 Bacteria 8036
414 Ga0500568_0001037 3300053139 Bacteria 18989
415 Ga0500568_0001491 3300053139 Bacteria 14966
416 Ga0500573_0001149 3300053140 Bacteria 12350
417 Ga0500590_018155 3300053148 Bacteria 3639
418 Ga0500616_0000070 3300053153 Bacteria 232610
419 Ga0500620_001578 3300053155 Bacteria 4275
420 Ga0500638_108515 3300053162 Bacteria 1285
421 Ga0500636_0008796 3300053177 Bacteria 5858
422 Ga0500637_0000032 3300053178 Bacteria 51354
423 Ga0500625_015010 3300053729 Bacteria 3589
424 Ga0500645_040328 3300053730 Bacteria 1381
425 Ga0500596_001627 3300053735 Bacteria 4560
426 Ga0501084_0052609 3300054114 Bacteria 3407
427 Ga0501082_0181296 3300060353 Bacteria 1832

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10001961 Ga0105237_1000196124 260
2 3300037312 Ga0395899_0215447 Ga0395899_0215447_15_812 260
3 3300050490 nmdc:mga03n38_21802_c1 nmdc:mga03n38_21802_c1_350_1147 260
4 3300031712 Ga0265342_10037508 Ga0265342_100375082 263
5 3300050513 nmdc:mga0rr50_401164_c1 nmdc:mga0rr50_401164_c1_348_1139 263
6 3300048905 Ga0496102_0549597 Ga0496102_0549597_61_855 264
7 3300048919 Ga0496116_0004306 Ga0496116_0004306_12766_13560 264
8 3300048920 Ga0496117_0214152 Ga0496117_0214152_61_855 264
9 3300048921 Ga0496118_0228059 Ga0496118_0228059_223_1017 264
10 3300048927 Ga0496124_0334825 Ga0496124_0334825_223_1017 264
11 3300005842 Ga0068858_100064279 Ga0068858_1000642794 266
12 3300025923 Ga0207681_10000469 Ga0207681_1000046920 266
13 3300026035 Ga0207703_10155720 Ga0207703_101557202 266
14 3300028380 Ga0268265_10143009 Ga0268265_101430092 266
15 3300035695 Ga0373927_0309061 Ga0373927_0309061_148_960 270
16 3300035725 Ga0373947_0023381 Ga0373947_0023381_1019_1843 274
17 3300046459 Ga0495629_0018268 Ga0495629_0018268_2449_3273 274
18 3300046533 Ga0495640_0108209 Ga0495640_0108209_150_974 274
19 3300047321 Ga0495676_0155496 Ga0495676_0155496_375_1199 274
20 3300048924 Ga0496121_0004189 Ga0496121_0004189_5453_6277 274
21 3300048927 Ga0496124_0224302 Ga0496124_0224302_555_1382 274
22 3300044693 Ga0466961_0016230 Ga0466961_0016230_1041_1868 275
23 3300009011 Ga0105251_10000434 Ga0105251_100004344 276
24 3300009177 Ga0105248_10052533 Ga0105248_100525334 276
25 3300048921 Ga0496118_0039587 Ga0496118_0039587_674_1504 276
26 iso_pu_bacteria 2643221545 2643750201 284
27 iso_pu_bacteria 2643221691 2644507090 284
28 3300021384 Ga0213876_10000341 Ga0213876_1000034133 285
29 3300037853 Ga0436364_1462473 Ga0436364_1462473_122_991 285
30 3300039437 Ga0436365_1702191 Ga0436365_1702191_59570_60439 285
31 3300039450 Ga0436363_1271159 Ga0436363_1271159_389_1258 285
32 3300046491 Ga0495584_0027696 Ga0495584_0027696_14_880 285
33 iso_pu_bacteria 2508501114 2509080252 285
34 iso_pu_bacteria 2775506901 2776261546 285
35 3300013306 Ga0163162_10109578 Ga0163162_101095782 286
36 iso_pu_bacteria 2667528173 2671108730 286
37 iso_pu_bacteria 2842357229 2842363086 286
38 iso_pu_bacteria 2884298095 2884301665 286
39 iso_pu_bacteria 2904474040 2904475575 286
40 iso_pu_bacteria 2919150387 2919151744 286
41 iso_pu_bacteria 2927143783 2927144413 286
42 iso_pu_bacteria 3001892409 3001895046 286
43 3300005327 Ga0070658_10003255 Ga0070658_100032553 287
44 3300005339 Ga0070660_100215637 Ga0070660_1002156371 287
45 3300025909 Ga0207705_10005999 Ga0207705_100059994 287
46 3300032004 Ga0307414_10233051 Ga0307414_102330511 287
47 3300045051 Ga0451576_0000053 Ga0451576_0000053_178964_179860 287
48 3300046522 Ga0495643_0000470 Ga0495643_0000470_13489_14358 287
49 3300048919 Ga0496116_0002399 Ga0496116_0002399_15453_16325 287
50 3300048927 Ga0496124_0000943 Ga0496124_0000943_30241_31113 287
51 iso_pu_bacteria 2565956521 2566037132 287
52 iso_pu_bacteria 2996887358 2996889538 287
53 iso_pu_bacteria 8005321885 8005324065 287
54 3300005337 Ga0070682_100007594 Ga0070682_1000075942 288
55 3300005563 Ga0068855_100195456 Ga0068855_1001954562 288
56 3300013104 Ga0157370_10076809 Ga0157370_100768092 288
57 3300031251 Ga0265327_10001380 Ga0265327_1000138018 288
58 3300039447 Ga0436361_0555098 Ga0436361_0555098_1130_2038 288
59 3300046455 Ga0495603_0022314 Ga0495603_0022314_2207_3097 288
60 3300046455 Ga0495603_0206311 Ga0495603_0206311_62_952 288
61 3300046459 Ga0495629_0168457 Ga0495629_0168457_133_1023 288
62 3300046473 Ga0495582_0041591 Ga0495582_0041591_581_1471 288
63 3300046491 Ga0495584_0003449 Ga0495584_0003449_1028_1918 288
64 3300046492 Ga0495585_0053136 Ga0495585_0053136_271_1161 288
65 3300046499 Ga0495594_0039808 Ga0495594_0039808_1176_2066 288
66 3300046499 Ga0495594_0100907 Ga0495594_0100907_55_945 288
67 3300046526 Ga0495666_0012739 Ga0495666_0012739_3112_4002 288
68 3300046557 Ga0495622_0030206 Ga0495622_0030206_528_1418 288
69 3300046558 Ga0495633_0033947 Ga0495633_0033947_676_1566 288
70 3300046648 Ga0495611_0013453 Ga0495611_0013453_1589_2479 288
71 3300046674 Ga0495588_0039938 Ga0495588_0039938_1061_1951 288
72 3300046691 Ga0495670_0002789 Ga0495670_0002789_3086_3976 288
73 3300047445 Ga0495677_0019052 Ga0495677_0019052_1376_2266 288
74 3300053108 Ga0500562_003801 Ga0500562_003801_1742_2632 288
75 3300003791 Ga0055530_10010301 Ga0055530_100103012 289
76 3300005355 Ga0070671_100043773 Ga0070671_1000437735 289
77 3300005367 Ga0070667_100000122 Ga0070667_10000012255 289
78 3300005539 Ga0068853_100002782 Ga0068853_1000027827 289
79 3300005577 Ga0068857_100000856 Ga0068857_10000085615 289
80 3300005841 Ga0068863_100070086 Ga0068863_1000700863 289
81 3300005843 Ga0068860_100000152 Ga0068860_10000015259 289
82 3300013104 Ga0157370_10375870 Ga0157370_103758702 289
83 3300025298 Ga0209050_1004466 Ga0209050_10044663 289
84 3300025931 Ga0207644_10019639 Ga0207644_100196394 289
85 3300025986 Ga0207658_10000092 Ga0207658_1000009248 289
86 3300026041 Ga0207639_10000621 Ga0207639_1000062115 289
87 3300026088 Ga0207641_10000742 Ga0207641_1000074236 289
88 3300026116 Ga0207674_10001997 Ga0207674_1000199715 289
89 3300028381 Ga0268264_10000111 Ga0268264_1000011144 289
90 3300031911 Ga0307412_10107267 Ga0307412_101072672 289
91 3300046507 Ga0495606_0087561 Ga0495606_0087561_526_1395 289
92 3300046512 Ga0495610_0000082 Ga0495610_0000082_11062_11931 289
93 3300046558 Ga0495633_0069888 Ga0495633_0069888_583_1452 289
94 3300046660 Ga0495625_0000832 Ga0495625_0000832_12410_13279 289
95 3300046660 Ga0495625_0049679 Ga0495625_0049679_588_1457 289
96 3300048091 Ga0495626_0001225 Ga0495626_0001225_4449_5318 289
97 3300048906 Ga0496103_0000429 Ga0496103_0000429_223_1098 289
98 3300048908 Ga0496105_0024975 Ga0496105_0024975_1689_2570 289
99 3300048922 Ga0496119_0035229 Ga0496119_0035229_1387_2262 289
100 3300048923 Ga0496120_0048724 Ga0496120_0048724_881_1762 289
101 iso_pu_bacteria 2751185897 2753767798 289
102 3300005347 Ga0070668_100001612 Ga0070668_1000016123 290
103 3300013250 Ga0171462_1013 Ga0171462_101351 290
104 3300025972 Ga0207668_10033229 Ga0207668_100332293 290
105 3300027312 Ga0209371_1013385 Ga0209371_10133853 290
106 3300027378 Ga0209981_1001618 Ga0209981_10016182 290
107 3300027543 Ga0209999_1000174 Ga0209999_10001745 290
108 3300030500 Ga0268256_1027989 Ga0268256_10279892 290
109 3300035111 Ga0373923_0028673 Ga0373923_0028673_261_1133 290
110 3300035724 Ga0373933_0022007 Ga0373933_0022007_1323_2195 290
111 3300036401 Ga0373937_0003329 Ga0373937_0003329_10425_11297 290
112 3300037471 Ga0395905_0055579 Ga0395905_0055579_2534_3469 290
113 3300039447 Ga0436361_0055448 Ga0436361_0055448_3905_4777 290
114 3300039450 Ga0436363_1440908 Ga0436363_1440908_481_1356 290
115 3300046500 Ga0495596_0001695 Ga0495596_0001695_181_1053 290
116 3300046512 Ga0495610_0000243 Ga0495610_0000243_49794_50666 290
117 3300046515 Ga0495620_0002894 Ga0495620_0002894_8303_9175 290
118 3300046519 Ga0495632_0140561 Ga0495632_0140561_28_900 290
119 3300046616 Ga0495668_0009308 Ga0495668_0009308_4566_5453 290
120 3300046616 Ga0495668_0127523 Ga0495668_0127523_405_1277 290
121 3300046660 Ga0495625_0005611 Ga0495625_0005611_4006_4878 290
122 3300046675 Ga0495657_0299751 Ga0495657_0299751_26_898 290
123 3300049571 Ga0501034_0000627 Ga0501034_0000627_40913_41815 290
124 3300049579 Ga0501043_0152621 Ga0501043_0152621_650_1522 290
125 3300053085 Ga0495619_0046287 Ga0495619_0046287_1772_2644 290
126 3300053096 Ga0500641_0167716 Ga0500641_0167716_20_910 290
127 3300053139 Ga0500568_0001037 Ga0500568_0001037_916_1791 290
128 3300053139 Ga0500568_0001491 Ga0500568_0001491_6592_7470 290
129 iso_pu_bacteria 2891088606 2891092647 290
130 iso_pu_bacteria 2919709256 2919711780 290
131 3300005327 Ga0070658_10018732 Ga0070658_100187322 291
132 3300005327 Ga0070658_10099684 Ga0070658_100996842 291
133 3300005329 Ga0070683_100103511 Ga0070683_1001035112 291
134 3300005331 Ga0070670_100000201 Ga0070670_10000020156 291
135 3300005335 Ga0070666_10057686 Ga0070666_100576863 291
136 3300005336 Ga0070680_100019639 Ga0070680_1000196396 291
137 3300005339 Ga0070660_100074388 Ga0070660_1000743883 291
138 3300005347 Ga0070668_100010952 Ga0070668_1000109525 291
139 3300005347 Ga0070668_100038140 Ga0070668_1000381404 291
140 3300005353 Ga0070669_100000258 Ga0070669_1000002588 291
141 3300005366 Ga0070659_100043836 Ga0070659_1000438362 291
142 3300005367 Ga0070667_100021752 Ga0070667_1000217525 291
143 3300005458 Ga0070681_10021909 Ga0070681_100219096 291
144 3300005530 Ga0070679_100005433 Ga0070679_1000054337 291
145 3300005535 Ga0070684_100032961 Ga0070684_1000329616 291
146 3300005539 Ga0068853_100003626 Ga0068853_1000036265 291
147 3300005548 Ga0070665_100000015 Ga0070665_100000015174 291
148 3300005563 Ga0068855_100031858 Ga0068855_1000318587 291
149 3300005563 Ga0068855_100230653 Ga0068855_1002306532 291
150 3300005618 Ga0068864_100011281 Ga0068864_1000112817 291
151 3300005618 Ga0068864_100085377 Ga0068864_1000853773 291
152 3300009092 Ga0105250_10084231 Ga0105250_100842312 291
153 3300009093 Ga0105240_10127027 Ga0105240_101270273 291
154 3300009101 Ga0105247_10013032 Ga0105247_100130324 291
155 3300009545 Ga0105237_10081608 Ga0105237_100816083 291
156 3300009551 Ga0105238_10115524 Ga0105238_101155243 291
157 3300009553 Ga0105249_10004337 Ga0105249_100043372 291
158 3300013104 Ga0157370_10106492 Ga0157370_101064922 291
159 3300013306 Ga0163162_10296478 Ga0163162_102964782 291
160 3300025297 Ga0209758_1070306 Ga0209758_10703062 291
161 3300025711 Ga0207696_1009712 Ga0207696_10097123 291
162 3300025735 Ga0207713_1032975 Ga0207713_10329752 291
163 3300025900 Ga0207710_10100431 Ga0207710_101004312 291
164 3300025909 Ga0207705_10009115 Ga0207705_100091157 291
165 3300025912 Ga0207707_10004567 Ga0207707_100045677 291
166 3300025913 Ga0207695_10497894 Ga0207695_104978941 291
167 3300025917 Ga0207660_10000900 Ga0207660_1000090010 291
168 3300025919 Ga0207657_10007405 Ga0207657_100074057 291
169 3300025921 Ga0207652_10004699 Ga0207652_100046996 291
170 3300025924 Ga0207694_10155955 Ga0207694_101559552 291
171 3300025932 Ga0207690_10095135 Ga0207690_100951351 291
172 3300025944 Ga0207661_10235052 Ga0207661_102350522 291
173 3300025945 Ga0207679_10089668 Ga0207679_100896683 291
174 3300025949 Ga0207667_10035472 Ga0207667_100354726 291
175 3300025961 Ga0207712_10068805 Ga0207712_100688052 291
176 3300025972 Ga0207668_10000622 Ga0207668_100006223 291
177 3300025972 Ga0207668_10012023 Ga0207668_100120232 291
178 3300025986 Ga0207658_10005469 Ga0207658_100054697 291
179 3300026023 Ga0207677_10081860 Ga0207677_100818603 291
180 3300026041 Ga0207639_10127639 Ga0207639_101276392 291
181 3300026088 Ga0207641_10080758 Ga0207641_100807582 291
182 3300028379 Ga0268266_10000005 Ga0268266_10000005944 291
183 3300028653 Ga0265323_10003167 Ga0265323_100031676 291
184 3300028653 Ga0265323_10004115 Ga0265323_100041155 291
185 3300028654 Ga0265322_10037761 Ga0265322_100377612 291
186 3300028786 Ga0307517_10002892 Ga0307517_100028923 291
187 3300028800 Ga0265338_10026766 Ga0265338_100267665 291
188 3300028800 Ga0265338_10137194 Ga0265338_101371942 291
189 3300031235 Ga0265330_10001818 Ga0265330_1000181811 291
190 3300031235 Ga0265330_10002236 Ga0265330_100022364 291
191 3300031239 Ga0265328_10019983 Ga0265328_100199833 291
192 3300031242 Ga0265329_10000020 Ga0265329_1000002053 291
193 3300031344 Ga0265316_10000054 Ga0265316_1000005430 291
194 3300031344 Ga0265316_10000080 Ga0265316_1000008055 291
195 3300031344 Ga0265316_10001617 Ga0265316_1000161711 291
196 3300031344 Ga0265316_10017073 Ga0265316_100170733 291
197 3300031344 Ga0265316_10042787 Ga0265316_100427873 291
198 3300031344 Ga0265316_10199586 Ga0265316_101995862 291
199 3300031456 Ga0307513_10345844 Ga0307513_103458442 291
200 3300031712 Ga0265342_10004856 Ga0265342_100048564 291
201 3300031712 Ga0265342_10011323 Ga0265342_100113235 291
202 3300031712 Ga0265342_10084492 Ga0265342_100844921 291
203 3300031727 Ga0316576_10006930 Ga0316576_100069306 291
204 3300031728 Ga0316578_10012834 Ga0316578_100128344 291
205 3300031733 Ga0316577_10000193 Ga0316577_100001934 291
206 3300032137 Ga0316585_10025351 Ga0316585_100253513 291
207 3300032168 Ga0316593_10034972 Ga0316593_100349722 291
208 3300033528 Ga0316588_1013622 Ga0316588_10136222 291
209 3300033541 Ga0316596_1000403 Ga0316596_10004034 291
210 3300035692 Ga0373935_0110081 Ga0373935_0110081_806_1705 291
211 3300047320 Ga0495672_0030225 Ga0495672_0030225_100_993 291
212 3300048905 Ga0496102_0000698 Ga0496102_0000698_3869_4747 291
213 3300048906 Ga0496103_0000258 Ga0496103_0000258_21401_22279 291
214 3300048908 Ga0496105_0056984 Ga0496105_0056984_1000_1878 291
215 3300048915 Ga0496112_0378241 Ga0496112_0378241_40_933 291
216 3300048918 Ga0496115_0007401 Ga0496115_0007401_3216_4106 291
217 3300048919 Ga0496116_0038217 Ga0496116_0038217_1500_2378 291
218 3300048920 Ga0496117_0010819 Ga0496117_0010819_5758_6636 291
219 3300048921 Ga0496118_0036593 Ga0496118_0036593_1600_2478 291
220 3300048924 Ga0496121_0001015 Ga0496121_0001015_3759_4643 291
221 3300048924 Ga0496121_0006397 Ga0496121_0006397_1083_1961 291
222 3300048927 Ga0496124_0010844 Ga0496124_0010844_2653_3531 291
223 3300053130 Ga0500642_0000001 Ga0500642_0000001_772838_773722 291
224 3300053140 Ga0500573_0001149 Ga0500573_0001149_8158_9042 291
225 3300053730 Ga0500645_040328 Ga0500645_040328_209_1084 291
226 iso_pu_bacteria 8054302542 8054306390 291
227 3300005295 Ga0065707_10199413 Ga0065707_101994131 292
228 3300005331 Ga0070670_100000426 Ga0070670_10000042611 292
229 3300005335 Ga0070666_10038677 Ga0070666_100386772 292
230 3300005335 Ga0070666_10124924 Ga0070666_101249241 292
231 3300005347 Ga0070668_100000042 Ga0070668_10000004227 292
232 3300005347 Ga0070668_100032014 Ga0070668_1000320144 292
233 3300005347 Ga0070668_100062824 Ga0070668_1000628244 292
234 3300005353 Ga0070669_100003220 Ga0070669_1000032205 292
235 3300005355 Ga0070671_100000476 Ga0070671_10000047617 292
236 3300005367 Ga0070667_100000147 Ga0070667_10000014788 292
237 3300005367 Ga0070667_100000508 Ga0070667_10000050830 292
238 3300005367 Ga0070667_100001710 Ga0070667_10000171020 292
239 3300005367 Ga0070667_100016940 Ga0070667_1000169404 292
240 3300005518 Ga0070699_100090197 Ga0070699_1000901973 292
241 3300005548 Ga0070665_100002287 Ga0070665_1000022872 292
242 3300005548 Ga0070665_100065787 Ga0070665_1000657873 292
243 3300005578 Ga0068854_100014474 Ga0068854_1000144745 292
244 3300005617 Ga0068859_100000681 Ga0068859_10000068115 292
245 3300005618 Ga0068864_100000135 Ga0068864_1000001351 292
246 3300005618 Ga0068864_100000240 Ga0068864_10000024049 292
247 3300005841 Ga0068863_100000066 Ga0068863_100000066126 292
248 3300005841 Ga0068863_100000119 Ga0068863_10000011915 292
249 3300005841 Ga0068863_100000676 Ga0068863_10000067633 292
250 3300005841 Ga0068863_100010556 Ga0068863_1000105562 292
251 3300005842 Ga0068858_100001650 Ga0068858_10000165014 292
252 3300005842 Ga0068858_100006796 Ga0068858_1000067965 292
253 3300005843 Ga0068860_100000133 Ga0068860_10000013392 292
254 3300005843 Ga0068860_100113993 Ga0068860_1001139933 292
255 3300005843 Ga0068860_100171734 Ga0068860_1001717342 292
256 3300005844 Ga0068862_100000619 Ga0068862_10000061925 292
257 3300005844 Ga0068862_100043293 Ga0068862_1000432934 292
258 3300006042 Ga0075368_10002022 Ga0075368_100020227 292
259 3300006051 Ga0075364_10000104 Ga0075364_1000010428 292
260 3300006178 Ga0075367_10002119 Ga0075367_100021192 292
261 3300006195 Ga0075366_10050686 Ga0075366_100506862 292
262 3300006871 Ga0075434_100342242 Ga0075434_1003422422 292
263 3300006931 Ga0097620_100000681 Ga0097620_10000068123 292
264 3300009092 Ga0105250_10005371 Ga0105250_100053714 292
265 3300009177 Ga0105248_10002170 Ga0105248_1000217020 292
266 3300009177 Ga0105248_10364393 Ga0105248_103643932 292
267 3300009553 Ga0105249_10001002 Ga0105249_100010026 292
268 3300014325 Ga0163163_10018515 Ga0163163_100185155 292
269 3300014325 Ga0163163_10215477 Ga0163163_102154772 292
270 3300014968 Ga0157379_10004599 Ga0157379_100045994 292
271 3300014968 Ga0157379_10124436 Ga0157379_101244362 292
272 3300025711 Ga0207696_1041632 Ga0207696_10416322 292
273 3300025903 Ga0207680_10038801 Ga0207680_100388012 292
274 3300025903 Ga0207680_10098770 Ga0207680_100987702 292
275 3300025913 Ga0207695_10036393 Ga0207695_100363934 292
276 3300025913 Ga0207695_10241504 Ga0207695_102415042 292
277 3300025914 Ga0207671_10005144 Ga0207671_100051442 292
278 3300025923 Ga0207681_10003585 Ga0207681_100035857 292
279 3300025923 Ga0207681_10061645 Ga0207681_100616452 292
280 3300025925 Ga0207650_10000016 Ga0207650_10000016159 292
281 3300025931 Ga0207644_10000272 Ga0207644_1000027218 292
282 3300025941 Ga0207711_10004476 Ga0207711_1000447612 292
283 3300025941 Ga0207711_10006678 Ga0207711_100066787 292
284 3300025941 Ga0207711_10242386 Ga0207711_102423862 292
285 3300025961 Ga0207712_10000767 Ga0207712_1000076726 292
286 3300025972 Ga0207668_10000088 Ga0207668_1000008810 292
287 3300025972 Ga0207668_10001163 Ga0207668_100011635 292
288 3300025972 Ga0207668_10014551 Ga0207668_100145511 292
289 3300025972 Ga0207668_10016698 Ga0207668_100166982 292
290 3300025972 Ga0207668_10039725 Ga0207668_100397254 292
291 3300025981 Ga0207640_10009680 Ga0207640_100096803 292
292 3300025986 Ga0207658_10000117 Ga0207658_1000011781 292
293 3300025986 Ga0207658_10000295 Ga0207658_1000029518 292
294 3300025986 Ga0207658_10001312 Ga0207658_1000131221 292
295 3300025986 Ga0207658_10003417 Ga0207658_100034175 292
296 3300025986 Ga0207658_10013524 Ga0207658_100135244 292
297 3300026035 Ga0207703_10000049 Ga0207703_10000049132 292
298 3300026035 Ga0207703_10002065 Ga0207703_1000206518 292
299 3300026035 Ga0207703_10024961 Ga0207703_100249611 292
300 3300026088 Ga0207641_10000011 Ga0207641_10000011264 292
301 3300026088 Ga0207641_10000085 Ga0207641_100000858 292
302 3300026088 Ga0207641_10000612 Ga0207641_1000061216 292
303 3300026095 Ga0207676_10002034 Ga0207676_1000203417 292
304 3300026118 Ga0207675_100368013 Ga0207675_1003680132 292
305 3300028379 Ga0268266_10002166 Ga0268266_1000216620 292
306 3300028379 Ga0268266_10003072 Ga0268266_100030722 292
307 3300028380 Ga0268265_10006324 Ga0268265_100063241 292
308 3300028380 Ga0268265_10060927 Ga0268265_100609272 292
309 3300028381 Ga0268264_10000207 Ga0268264_1000020779 292
310 3300028381 Ga0268264_10016329 Ga0268264_100163296 292
311 3300031691 Ga0316579_10005052 Ga0316579_100050523 292
312 3300031730 Ga0307516_10005920 Ga0307516_1000592012 292
313 3300036647 Ga0316582_0004876 Ga0316582_0004876_2462_3355 292
314 3300037068 Ga0373925_0120906 Ga0373925_0120906_906_1802 292
315 3300037466 Ga0395898_0194382 Ga0395898_0194382_235_1131 292
316 3300038443 Ga0395901_0255084 Ga0395901_0255084_169_1065 292
317 3300039437 Ga0436365_0541910 Ga0436365_0541910_393_1289 292
318 3300046459 Ga0495629_0059964 Ga0495629_0059964_1721_2617 292
319 3300046522 Ga0495643_0013709 Ga0495643_0013709_351_1247 292
320 3300046538 Ga0495609_0009550 Ga0495609_0009550_125_1021 292
321 3300046542 Ga0495597_0003637 Ga0495597_0003637_1662_2558 292
322 3300046557 Ga0495622_0000963 Ga0495622_0000963_4700_5596 292
323 3300046616 Ga0495668_0044268 Ga0495668_0044268_1021_1917 292
324 3300047443 Ga0495687_009195 Ga0495687_009195_3465_4361 292
325 3300047469 Ga0495673_0020562 Ga0495673_0020562_1101_1979 292
326 3300048088 Ga0495602_0170488 Ga0495602_0170488_344_1240 292
327 3300048905 Ga0496102_0089262 Ga0496102_0089262_1851_2747 292
328 3300048905 Ga0496102_0383063 Ga0496102_0383063_40_936 292
329 3300048918 Ga0496115_0081612 Ga0496115_0081612_131_1027 292
330 3300048920 Ga0496117_0008011 Ga0496117_0008011_2682_3578 292
331 3300048920 Ga0496117_0021876 Ga0496117_0021876_1889_2770 292
332 3300048921 Ga0496118_0003914 Ga0496118_0003914_15655_16536 292
333 3300048921 Ga0496118_0024526 Ga0496118_0024526_3013_3909 292
334 3300048922 Ga0496119_0007861 Ga0496119_0007861_7078_7974 292
335 3300048924 Ga0496121_0000035 Ga0496121_0000035_242641_243537 292
336 3300048924 Ga0496121_0087705 Ga0496121_0087705_1187_2068 292
337 3300048925 Ga0496122_0253897 Ga0496122_0253897_79_960 292
338 3300048926 Ga0496123_0073998 Ga0496123_0073998_1021_1902 292
339 3300048927 Ga0496124_0033254 Ga0496124_0033254_146_1030 292
340 3300048929 Ga0496126_0009107 Ga0496126_0009107_9520_10404 292
341 3300049581 Ga0501047_0005449 Ga0501047_0005449_6829_7725 292
342 3300050489 nmdc:mga03683_4425_c1 nmdc:mga03683_4425_c1_1023_1928 292
343 3300050491 nmdc:mga00v17_324_c1 nmdc:mga00v17_324_c1_9424_10320 292
344 3300050493 nmdc:mga0k408_11007_c1 nmdc:mga0k408_11007_c1_3030_3926 292
345 3300050495 nmdc:mga04h51_11580_c1 nmdc:mga04h51_11580_c1_879_1775 292
346 3300050496 nmdc:mga07m45_19324_c1 nmdc:mga07m45_19324_c1_2683_3579 292
347 3300050496 nmdc:mga07m45_6399_c1 nmdc:mga07m45_6399_c1_4027_4923 292
348 3300050512 nmdc:mga0n895_64608_c1 nmdc:mga0n895_64608_c1_2478_3356 292
349 3300050516 nmdc:mga0sz30_41611_c1 nmdc:mga0sz30_41611_c1_28_933 292
350 3300053080 Ga0500635_0000049 Ga0500635_0000049_7812_8708 292
351 3300053091 Ga0500647_0047288 Ga0500647_0047288_294_1190 292
352 3300053093 Ga0500651_0102251 Ga0500651_0102251_350_1246 292
353 3300053094 Ga0500566_0051810 Ga0500566_0051810_202_1098 292
354 3300053109 Ga0500569_004988 Ga0500569_004988_622_1518 292
355 3300053119 Ga0500595_001325 Ga0500595_001325_3810_4706 292
356 3300053122 Ga0500608_000299 Ga0500608_000299_15166_16062 292
357 3300053123 Ga0500614_015522 Ga0500614_015522_191_1087 292
358 3300053136 Ga0500559_0003273 Ga0500559_0003273_3612_4508 292
359 3300053148 Ga0500590_018155 Ga0500590_018155_2100_2996 292
360 3300053153 Ga0500616_0000070 Ga0500616_0000070_15622_16515 292
361 3300053155 Ga0500620_001578 Ga0500620_001578_1632_2528 292
362 3300053162 Ga0500638_108515 Ga0500638_108515_78_974 292
363 3300053177 Ga0500636_0008796 Ga0500636_0008796_1438_2334 292
364 3300053729 Ga0500625_015010 Ga0500625_015010_307_1203 292
365 3300053735 Ga0500596_001627 Ga0500596_001627_286_1182 292
366 iso_pu_bacteria 2896253425 2896254167 292
367 iso_pu_bacteria 2919138771 2919143043 292
368 3300005327 Ga0070658_10022568 Ga0070658_100225682 293
369 3300005339 Ga0070660_100281365 Ga0070660_1002813652 293
370 3300005530 Ga0070679_100303172 Ga0070679_1003031722 293
371 3300005547 Ga0070693_100121238 Ga0070693_1001212382 293
372 3300005616 Ga0068852_100026223 Ga0068852_1000262235 293
373 3300006042 Ga0075368_10003337 Ga0075368_100033373 293
374 3300006048 Ga0075363_100059091 Ga0075363_1000590911 293
375 3300006177 Ga0075362_10020995 Ga0075362_100209951 293
376 3300006178 Ga0075367_10000791 Ga0075367_1000079111 293
377 3300006353 Ga0075370_10015898 Ga0075370_100158982 293
378 3300013102 Ga0157371_10060075 Ga0157371_100600753 293
379 3300013105 Ga0157369_10003672 Ga0157369_100036723 293
380 3300013307 Ga0157372_10002428 Ga0157372_1000242813 293
381 3300013307 Ga0157372_10127500 Ga0157372_101275002 293
382 3300013307 Ga0157372_10160902 Ga0157372_101609022 293
383 3300025909 Ga0207705_10030133 Ga0207705_100301332 293
384 3300025919 Ga0207657_10046893 Ga0207657_100468932 293
385 3300026142 Ga0207698_10009264 Ga0207698_100092642 293
386 3300027866 Ga0209813_10000017 Ga0209813_1000001774 293
387 3300031548 Ga0307408_100159607 Ga0307408_1001596072 293
388 3300031824 Ga0307413_10142893 Ga0307413_101428932 293
389 3300037312 Ga0395899_0000032 Ga0395899_0000032_139607_140506 293
390 3300046460 Ga0495638_0000388 Ga0495638_0000388_33043_33927 293
391 3300046506 Ga0495583_0000252 Ga0495583_0000252_58409_59293 293
392 3300046519 Ga0495632_0001790 Ga0495632_0001790_10606_11490 293
393 3300046524 Ga0495648_0000308 Ga0495648_0000308_20360_21244 293
394 3300046692 Ga0495671_0000011 Ga0495671_0000011_29294_30178 293
395 3300047469 Ga0495673_0000013 Ga0495673_0000013_297358_298242 293
396 3300050489 nmdc:mga03683_2694_c1 nmdc:mga03683_2694_c1_1604_2488 293
397 3300050491 nmdc:mga00v17_2946_c1 nmdc:mga00v17_2946_c1_7658_8542 293
398 3300050491 nmdc:mga00v17_87297_c1 nmdc:mga00v17_87297_c1_881_1771 293
399 3300050494 nmdc:mga06z11_20_c1 nmdc:mga06z11_20_c1_1396_2298 293
400 3300050495 nmdc:mga04h51_406_c1 nmdc:mga04h51_406_c1_8151_9053 293
401 3300050496 nmdc:mga07m45_95330_c1 nmdc:mga07m45_95330_c1_272_1174 293
402 3300053178 Ga0500637_0000032 Ga0500637_0000032_10239_11123 293
403 3300006051 Ga0075364_10015501 Ga0075364_100155014 294
404 3300046542 Ga0495597_0000326 Ga0495597_0000326_3594_4496 294
405 3300053119 Ga0500595_003342 Ga0500595_003342_2188_3075 294
406 3300028800 Ga0265338_10000014 Ga0265338_1000001460 295
407 3300031241 Ga0265325_10000008 Ga0265325_10000008172 295
408 3300031249 Ga0265339_10002066 Ga0265339_100020666 295
409 3300031250 Ga0265331_10002272 Ga0265331_1000227210 295
410 3300031344 Ga0265316_10003871 Ga0265316_100038717 295
411 3300031712 Ga0265342_10017914 Ga0265342_100179144 295
412 3300006195 Ga0075366_10001044 Ga0075366_100010449 296
413 3300049743 Ga0501081_0067400 Ga0501081_0067400_1340_2230 296
414 3300050493 nmdc:mga0k408_3848_c1 nmdc:mga0k408_3848_c1_5236_6162 296
415 3300050494 nmdc:mga06z11_4855_c1 nmdc:mga06z11_4855_c1_128_1054 296
416 3300050496 nmdc:mga07m45_42031_c1 nmdc:mga07m45_42031_c1_94_1020 296
417 3300054114 Ga0501084_0052609 Ga0501084_0052609_968_1858 296
418 3300060353 Ga0501082_0181296 Ga0501082_0181296_124_1014 296
419 3300005367 Ga0070667_100000461 Ga0070667_10000046140 299
420 3300025916 Ga0207663_10000017 Ga0207663_1000001715 299
421 3300025986 Ga0207658_10000397 Ga0207658_1000039732 299
422 3300048926 Ga0496123_0003707 Ga0496123_0003707_11128_12030 299
423 3300048929 Ga0496126_0006072 Ga0496126_0006072_12276_13178 299
424 3300053121 Ga0500607_000028 Ga0500607_000028_33022_33984 299
425 3300005548 Ga0070665_100001444 Ga0070665_1000014445 301
426 3300005841 Ga0068863_100002414 Ga0068863_1000024143 301
427 3300005843 Ga0068860_100009034 Ga0068860_10000903411 301
428 3300005843 Ga0068860_100034069 Ga0068860_1000340695 301
429 3300005844 Ga0068862_100008576 Ga0068862_1000085764 301
430 3300025735 Ga0207713_1000396 Ga0207713_100039618 301
431 3300025941 Ga0207711_10000707 Ga0207711_1000070722 301
432 3300026088 Ga0207641_10002295 Ga0207641_1000229515 301
433 3300028379 Ga0268266_10017096 Ga0268266_100170965 301
434 3300028380 Ga0268265_10022865 Ga0268265_100228654 301
435 3300028381 Ga0268264_10000709 Ga0268264_1000070916 301
436 3300028381 Ga0268264_10024689 Ga0268264_100246895 301
437 3300048906 Ga0496103_0009888 Ga0496103_0009888_3155_4063 301
438 3300048920 Ga0496117_0006022 Ga0496117_0006022_10007_10915 301
439 3300048921 Ga0496118_0009705 Ga0496118_0009705_7229_8137 301
440 3300048926 Ga0496123_0046486 Ga0496123_0046486_857_1765 301
441 3300048927 Ga0496124_0003633 Ga0496124_0003633_16213_17121 301
442 3300048927 Ga0496124_0000946 Ga0496124_0000946_40461_41414 306
443 3300045049 Ga0466959_0164251 Ga0466959_0164251_431_1369 308
444 3300003305 Ga0006770J48903_1065414 Ga0006770J48903_10654142 311
445 3300003574 Ga0007410J51695_1046964 Ga0007410J51695_10469642 311
446 3300003575 Ga0007409J51694_1040680 Ga0007409J51694_10406802 311
447 3300032005 Ga0307411_10536386 Ga0307411_105363861 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

1

234

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t38-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9924 2 288
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.9908 2 285
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9906 2 285
6tqg-assembly1.cif.gz_D pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9905 1 288
6tqg-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9901 2 288
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9898 2 288 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9587 1 236 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9472 2 288 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9056 1 236 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9012 1 223 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A846Q3P9-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 1.002 1 98 GO:0008879
GO:0045226
AF-A0A3D6A514-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9996 2 102 GO:0008879
GO:0045226
AF-A0A6I3TEG1-F1-model_v4 deleted 0.9996 14 126
AF-A0A7V4F2T9-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9984 1 216 GO:0008879
GO:0045226
AF-W3YZ78-F1-model_v4 deleted 0.9981 34 243

Feature Viewer

pLDDT pTM Quality
90.3 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map