F445778

General Info

Members Datasets Scaffolds Average Seq Length
446 302 420 212

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0055626|Ga0466963_0055626_519_1175
Length 218
Sequence MGLIHIELFATLDLVGQAPGGPEEDPEAFPFGGWQAPPLDEVSGAQVGAAYEGTDALLLGRRTYDIFASYWPHQDGGGEDGDIAELFNRVPKYVASRGTPDLSWAGSTQLGQDLPAAVREIRDRHEHVKVVGSLDLVQTLLREKLFDRLDLWVHPVVLGVGKKVFEGGAVPTNLTLLEPPAAGPKGTVYLRYGLAEGIPGTGDMSAPDRGLGDGAGRS

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2643221714 Streptomyces sp. Root264 Isolate Unclassified
6 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
7 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
8 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
9 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
10 2808606394 Promicromonospora sp. C35 Isolate Unclassified
11 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
12 2855683550 Micromonospora sp. RP3T Isolate Unclassified
13 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
14 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
15 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
16 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
17 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
18 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
19 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
20 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
21 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
22 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
23 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
24 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
25 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
152 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
153 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
238 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
296 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.17
Metatranscriptomes 0
Isolates 5.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 9.64
Nodule 0.9
Rhizoplane 3.81
Rhizosphere 76.01
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004000 3300001979 Bacteria 6392
2 Ga0070682_100737895 3300005337 Bacteria 794
3 Ga0068868_101188911 3300005338 Bacteria 705
4 Ga0070659_100296755 3300005366 Bacteria 1347
5 Ga0070667_100001355 3300005367 Bacteria 21979
6 Ga0070709_10080951 3300005434 Bacteria 2118
7 Ga0070714_100096645 3300005435 Bacteria 2595
8 Ga0070714_100155261 3300005435 Bacteria 2065
9 Ga0070713_100050612 3300005436 Bacteria 3432
10 Ga0070713_100130648 3300005436 Bacteria 2214
11 Ga0070710_10247060 3300005437 Bacteria 1145
12 Ga0070678_100080378 3300005456 Bacteria 2469
13 Ga0070662_100295380 3300005457 Bacteria 1315
14 Ga0068853_100102091 3300005539 Bacteria 2538
15 Ga0070665_100183733 3300005548 Bacteria 2091
16 Ga0070665_100297771 3300005548 Bacteria 1616
17 Ga0068855_100612859 3300005563 Bacteria 1173
18 Ga0068857_101215305 3300005577 Bacteria 730
19 Ga0068854_100109463 3300005578 Bacteria 2082
20 Ga0068856_100138975 3300005614 Bacteria 2436
21 Ga0068852_100149626 3300005616 Bacteria 2170
22 Ga0068859_100001276 3300005617 Bacteria 25774
23 Ga0068864_100806163 3300005618 Bacteria 923
24 Ga0068863_100005690 3300005841 Bacteria 12239
25 Ga0068858_100000054 3300005842 Bacteria 119686
26 Ga0068860_100000099 3300005843 Bacteria 145436
27 Ga0068862_100000417 3300005844 Bacteria 46116
28 Ga0081455_10200292 3300005937 Bacteria 1496
29 Ga0081538_10139789 3300005981 Bacteria 1119
30 Ga0081540_1001442 3300005983 Bacteria 20541
31 Ga0070717_10533223 3300006028 Bacteria 1062
32 Ga0075365_10013585 3300006038 Bacteria 4878
33 Ga0075363_100009534 3300006048 Bacteria 4566
34 Ga0075364_10004508 3300006051 Bacteria 8022
35 Ga0075364_10016535 3300006051 Bacteria 4591
36 Ga0075364_10047208 3300006051 Bacteria 2804
37 Ga0075432_10013301 3300006058 Bacteria 2796
38 Ga0070715_10023475 3300006163 Bacteria 2417
39 Ga0070716_100208316 3300006173 Bacteria 1305
40 Ga0070712_100002636 3300006175 Bacteria 11075
41 Ga0075362_10029791 3300006177 Bacteria 2354
42 Ga0075369_10006081 3300006186 Bacteria 4550
43 Ga0075369_10006881 3300006186 Bacteria 4317
44 Ga0075369_10011538 3300006186 Bacteria 3478
45 Ga0075369_10019781 3300006186 Bacteria 2752
46 Ga0075369_10031403 3300006186 Bacteria 2242
47 Ga0075370_10014588 3300006353 Bacteria 4194
48 Ga0075370_10015890 3300006353 Bacteria 4041
49 Ga0075370_10209739 3300006353 Bacteria 1150
50 Ga0068871_100425687 3300006358 Bacteria 1186
51 Ga0075428_100003888 3300006844 Bacteria 16412
52 Ga0075430_100229959 3300006846 Bacteria 1538
53 Ga0075431_100006616 3300006847 Bacteria 11517
54 Ga0075431_100152716 3300006847 Bacteria 2377
55 Ga0075433_10010501 3300006852 Bacteria 7435
56 Ga0075434_100011436 3300006871 Bacteria 8374
57 Ga0075434_100080230 3300006871 Bacteria 3259
58 Ga0075429_100370143 3300006880 Bacteria 1254
59 Ga0075436_100028134 3300006914 Bacteria 3868
60 Ga0097620_100001276 3300006931 Bacteria 25774
61 Ga0075435_100086979 3300007076 Bacteria 2574
62 Ga0075435_100648504 3300007076 Bacteria 916
63 Ga0099795_10298846 3300007788 Bacteria 707
64 Ga0105251_10162944 3300009011 Bacteria 1005
65 Ga0105240_10751209 3300009093 Bacteria 1060
66 Ga0111539_10027936 3300009094 Bacteria 6890
67 Ga0111539_10041945 3300009094 Bacteria 5498
68 Ga0111539_10290413 3300009094 Bacteria 1903
69 Ga0105245_10042677 3300009098 Bacteria 4046
70 Ga0105247_10000051 3300009101 Bacteria 145981
71 Ga0105247_10068765 3300009101 Bacteria 2209
72 Ga0105243_10065158 3300009148 Bacteria 2926
73 Ga0105241_10370856 3300009174 Bacteria 1248
74 Ga0105242_10361879 3300009176 Bacteria 1343
75 Ga0105248_10000339 3300009177 Bacteria 55050
76 Ga0105248_10789400 3300009177 Bacteria 1072
77 Ga0105249_10000020 3300009553 Bacteria 260634
78 Ga0105249_10065983 3300009553 Bacteria 3331
79 Ga0105239_10375914 3300010375 Bacteria 1606
80 Ga0157371_10079526 3300013102 Bacteria 2322
81 Ga0157371_10526081 3300013102 Bacteria 875
82 Ga0157370_10511273 3300013104 Bacteria 1103
83 Ga0157369_10130481 3300013105 Bacteria 2664
84 Ga0157369_10698983 3300013105 Bacteria 1044
85 Ga0157374_10589796 3300013296 Bacteria 1121
86 Ga0157372_10044004 3300013307 Bacteria 4946
87 Ga0157372_10215135 3300013307 Bacteria 2227
88 Ga0157372_10523694 3300013307 Bacteria 1382
89 Ga0157375_10735859 3300013308 Bacteria 1138
90 Ga0163163_10133542 3300014325 Bacteria 2522
91 Ga0163163_10902752 3300014325 Bacteria 947
92 Ga0157377_10090251 3300014745 Bacteria 1808
93 Ga0157379_10002091 3300014968 Bacteria 16571
94 Ga0163161_10306329 3300017792 Bacteria 1252
95 Ga0207692_10169907 3300025898 Bacteria 1263
96 Ga0207710_10000010 3300025900 Bacteria 482087
97 Ga0207710_10000072 3300025900 Bacteria 150638
98 Ga0207680_10733709 3300025903 Bacteria 708
99 Ga0207699_10086423 3300025906 Bacteria 1958
100 Ga0207663_10094481 3300025916 Bacteria 1992
101 Ga0207687_10149747 3300025927 Bacteria 1779
102 Ga0207687_10187817 3300025927 Bacteria 1606
103 Ga0207700_10010060 3300025928 Bacteria 5945
104 Ga0207664_10089118 3300025929 Bacteria 2526
105 Ga0207686_10327715 3300025934 Bacteria 1146
106 Ga0207669_10079993 3300025937 Bacteria 2089
107 Ga0207704_10410372 3300025938 Bacteria 1071
108 Ga0207665_10209831 3300025939 Bacteria 1422
109 Ga0207711_10000053 3300025941 Bacteria 138067
110 Ga0207711_10000301 3300025941 Bacteria 52993
111 Ga0207689_10508479 3300025942 Bacteria 1010
112 Ga0207712_10000010 3300025961 Bacteria 455972
113 Ga0207658_10000138 3300025986 Bacteria 77096
114 Ga0207658_10865419 3300025986 Bacteria 822
115 Ga0207703_10000002 3300026035 Bacteria 600711
116 Ga0207703_10137800 3300026035 Bacteria 2114
117 Ga0207641_10001140 3300026088 Bacteria 26677
118 Ga0207641_10558900 3300026088 Bacteria 1117
119 Ga0207676_10300844 3300026095 Bacteria 1465
120 Ga0207674_10760709 3300026116 Bacteria 935
121 Ga0207683_10369554 3300026121 Bacteria 1317
122 Ga0207428_10012710 3300027907 Bacteria 7383
123 Ga0207428_10669585 3300027907 Bacteria 744
124 Ga0268266_10143524 3300028379 Bacteria 2144
125 Ga0268266_10400545 3300028379 Bacteria 1298
126 Ga0268265_10000014 3300028380 Bacteria 330186
127 Ga0268264_10000137 3300028381 Bacteria 176081
128 Ga0307517_10005281 3300028786 Bacteria 19521
129 Ga0307511_10258864 3300030521 Bacteria 827
130 Ga0307408_100143928 3300031548 Bacteria 1874
131 Ga0307408_100260597 3300031548 Bacteria 1435
132 Ga0307508_10034840 3300031616 Bacteria 4536
133 Ga0307405_10303958 3300031731 Bacteria 1211
134 Ga0307410_10010406 3300031852 Bacteria 5266
135 Ga0307410_10064923 3300031852 Bacteria 2510
136 Ga0307410_10137564 3300031852 Bacteria 1802
137 Ga0307406_10167739 3300031901 Bacteria 1585
138 Ga0307407_10432069 3300031903 Bacteria 951
139 Ga0307412_10421276 3300031911 Bacteria 1092
140 Ga0307409_100097925 3300031995 Bacteria 2424
141 Ga0307409_100202949 3300031995 Bacteria 1775
142 Ga0307409_100623823 3300031995 Bacteria 1068
143 Ga0307409_100670290 3300031995 Bacteria 1033
144 Ga0307416_100037082 3300032002 Bacteria 3747
145 Ga0307416_100375639 3300032002 Bacteria 1449
146 Ga0307416_101181319 3300032002 Bacteria 870
147 Ga0307414_10556176 3300032004 Bacteria 1023
148 Ga0307411_10448418 3300032005 Bacteria 1079
149 Ga0307411_10925221 3300032005 Bacteria 776
150 Ga0307415_100021405 3300032126 Bacteria 3974
151 Ga0307415_100221130 3300032126 Bacteria 1518
152 Ga0307415_100430715 3300032126 Bacteria 1135
153 Ga0307510_10323365 3300033180 Bacteria 999
154 Ga0373943_0106509 3300035170 Bacteria 1473
155 Ga0373935_0024553 3300035692 Bacteria 3711
156 Ga0373947_0347046 3300035725 Bacteria 995
157 Ga0373925_0023140 3300037068 Bacteria 4533
158 Ga0395900_0175495 3300037418 Bacteria 2180
159 Ga0395898_0181905 3300037466 Bacteria 2009
160 Ga0395901_0004729 3300038443 Bacteria 13745
161 Ga0395901_0550515 3300038443 Bacteria 1169
162 Ga0436365_0291139 3300039437 Bacteria 6743
163 Ga0451797_0628083 3300041453 Bacteria 1137
164 Ga0451837_0785251 3300041494 Bacteria 1110
165 Ga0451839_1304203 3300041496 Bacteria 1103
166 Ga0451841_0072857 3300041498 Bacteria 2517
167 Ga0451843_0463456 3300041509 Bacteria 1551
168 Ga0451843_1291134 3300041509 Bacteria 1176
169 Ga0451853_0034694 3300041512 Bacteria 5908
170 Ga0451853_0432561 3300041512 Bacteria 5397
171 Ga0451853_0738730 3300041512 Bacteria 1282
172 Ga0451853_1162457 3300041512 Bacteria 1073
173 Ga0439431_0005857 3300041997 Bacteria 2715
174 Ga0439433_0100707 3300041999 Bacteria 717
175 Ga0450894_005199 3300042131 Bacteria 1683
176 Ga0450898_001855 3300042134 Bacteria 2857
177 Ga0450906_002651 3300042145 Bacteria 3900
178 Ga0466965_0057298 3300044683 Bacteria 1942
179 Ga0466965_0242468 3300044683 Bacteria 965
180 Ga0466966_0123863 3300044684 Bacteria 1586
181 Ga0466966_0207117 3300044684 Bacteria 1186
182 Ga0466966_0225474 3300044684 Bacteria 1131
183 Ga0466961_0091291 3300044693 Bacteria 1923
184 Ga0466961_0220252 3300044693 Bacteria 1170
185 Ga0466963_0055626 3300044694 Bacteria 2632
186 Ga0466963_0062602 3300044694 Bacteria 2488
187 Ga0466963_0152463 3300044694 Bacteria 1605
188 Ga0466963_0337586 3300044694 Bacteria 1061
189 Ga0466971_0102154 3300044719 Bacteria 1318
190 Ga0466971_0106952 3300044719 Bacteria 1289
191 Ga0466970_0000022 3300044765 Bacteria 59505
192 Ga0466970_0022671 3300044765 Bacteria 3277
193 Ga0466970_0045502 3300044765 Bacteria 2337
194 Ga0466970_0086676 3300044765 Bacteria 1697
195 Ga0466957_0023517 3300044842 Bacteria 3643
196 Ga0466957_0275287 3300044842 Bacteria 1125
197 Ga0466957_0459304 3300044842 Bacteria 878
198 Ga0466957_0517745 3300044842 Bacteria 828
199 Ga0466960_0058789 3300044901 Bacteria 1879
200 Ga0466960_0101038 3300044901 Bacteria 1485
201 Ga0466960_0478282 3300044901 Bacteria 727
202 Ga0466959_0034604 3300045049 Bacteria 3737
203 Ga0466959_0110122 3300045049 Bacteria 1966
204 Ga0466958_0065003 3300045836 Bacteria 2226
205 Ga0466958_0199709 3300045836 Bacteria 1272
206 Ga0466967_0489263 3300045976 Bacteria 1206
207 Ga0495627_021716 3300046453 Bacteria 2123
208 Ga0495592_0049430 3300046454 Bacteria 3126
209 Ga0495603_0001007 3300046455 Bacteria 16266
210 Ga0495603_0002543 3300046455 Bacteria 10740
211 Ga0495603_0003273 3300046455 Bacteria 9644
212 Ga0495603_0153529 3300046455 Bacteria 1337
213 Ga0495629_0139157 3300046459 Bacteria 1689
214 Ga0495629_0139663 3300046459 Bacteria 1686
215 Ga0495629_0189566 3300046459 Bacteria 1423
216 Ga0495629_0236096 3300046459 Bacteria 1259
217 Ga0495629_0332063 3300046459 Bacteria 1039
218 Ga0495641_0025872 3300046461 Bacteria 2874
219 Ga0495651_0184774 3300046462 Bacteria 1472
220 Ga0495653_0015255 3300046463 Bacteria 6261
221 Ga0495605_0103349 3300046474 Bacteria 1307
222 Ga0495639_0048100 3300046475 Bacteria 1934
223 Ga0495639_0132699 3300046475 Bacteria 1193
224 Ga0495662_0050078 3300046476 Bacteria 2016
225 Ga0495662_0141400 3300046476 Bacteria 1185
226 Ga0495594_0009721 3300046499 Bacteria 4976
227 Ga0495596_0057489 3300046500 Bacteria 1518
228 Ga0495583_0012562 3300046506 Bacteria 4783
229 Ga0495618_0280099 3300046514 Bacteria 1040
230 Ga0495628_0156635 3300046516 Bacteria 1732
231 Ga0495632_0063867 3300046519 Bacteria 1782
232 Ga0495643_0002998 3300046522 Bacteria 12733
233 Ga0495648_0212999 3300046524 Bacteria 958
234 Ga0495663_0091871 3300046525 Bacteria 990
235 Ga0495652_0309280 3300046529 Bacteria 1145
236 Ga0495665_0205485 3300046531 Bacteria 1020
237 Ga0495640_0020572 3300046533 Bacteria 4855
238 Ga0495622_0292731 3300046557 Bacteria 710
239 Ga0495633_0026908 3300046558 Bacteria 2816
240 Ga0495667_0316831 3300046559 Bacteria 987
241 Ga0495634_0032611 3300046642 Bacteria 3582
242 Ga0495611_0027150 3300046648 Bacteria 2501
243 Ga0495635_0442631 3300046663 Bacteria 860
244 Ga0495659_0151137 3300046664 Bacteria 932
245 Ga0495588_0107199 3300046674 Bacteria 1471
246 Ga0495623_0281696 3300046679 Bacteria 924
247 Ga0495646_0185715 3300046680 Bacteria 1139
248 Ga0495647_0115483 3300046681 Bacteria 1124
249 Ga0495658_0143715 3300046683 Bacteria 1461
250 Ga0495613_0015494 3300046689 Bacteria 5668
251 Ga0495613_0025771 3300046689 Bacteria 4382
252 Ga0495624_0142772 3300046690 Bacteria 1466
253 Ga0495670_0196925 3300046691 Bacteria 1066
254 Ga0495589_0008790 3300046794 Bacteria 5256
255 Ga0495600_0058163 3300046809 Bacteria 2525
256 Ga0495660_0033805 3300046810 Bacteria 2864
257 Ga0495581_0061331 3300047315 Bacteria 2173
258 Ga0495604_0009711 3300047317 Bacteria 7611
259 Ga0495604_0010735 3300047317 Bacteria 7271
260 Ga0495672_0017884 3300047320 Bacteria 4729
261 Ga0495676_0000434 3300047321 Bacteria 33982
262 Ga0495676_0009907 3300047321 Bacteria 8655
263 Ga0495676_0023481 3300047321 Bacteria 5354
264 Ga0495676_0035881 3300047321 Bacteria 4145
265 Ga0495676_0125304 3300047321 Bacteria 1862
266 Ga0495676_0354383 3300047321 Bacteria 980
267 Ga0495687_005938 3300047443 Bacteria 7628
268 Ga0495687_080126 3300047443 Bacteria 1281
269 Ga0495687_123873 3300047443 Bacteria 927
270 Ga0495679_062191 3300047446 Bacteria 1092
271 Ga0495685_001082 3300047447 Bacteria 8290
272 Ga0495681_0003743 3300047470 Bacteria 10538
273 Ga0495686_0084174 3300047472 Bacteria 1939
274 Ga0495593_0016817 3300047673 Bacteria 4119
275 Ga0495614_0034406 3300048089 Bacteria 2178
276 Ga0495626_0218319 3300048091 Bacteria 776
277 Ga0496100_0027406 3300048903 Bacteria 3504
278 Ga0496101_0061063 3300048904 Bacteria 2736
279 Ga0496101_0130140 3300048904 Bacteria 1911
280 Ga0496102_0000905 3300048905 Bacteria 28126
281 Ga0496102_0164092 3300048905 Bacteria 2090
282 Ga0496103_0000129 3300048906 Bacteria 81081
283 Ga0496103_0261383 3300048906 Bacteria 1114
284 Ga0496104_0029522 3300048907 Bacteria 5087
285 Ga0496105_0067425 3300048908 Bacteria 2954
286 Ga0496106_0444993 3300048909 Bacteria 1041
287 Ga0496107_0060855 3300048910 Bacteria 2733
288 Ga0496109_0084774 3300048912 Bacteria 2924
289 Ga0496111_0572113 3300048914 Bacteria 828
290 Ga0496112_0070949 3300048915 Bacteria 3443
291 Ga0496114_0037757 3300048917 Bacteria 3996
292 Ga0496114_0531786 3300048917 Bacteria 1039
293 Ga0496116_0017341 3300048919 Bacteria 5591
294 Ga0496117_0000304 3300048920 Bacteria 85823
295 Ga0496117_0193323 3300048920 Bacteria 1156
296 Ga0496118_0002217 3300048921 Bacteria 26923
297 Ga0496118_0040898 3300048921 Bacteria 3678
298 Ga0496119_0015976 3300048922 Bacteria 5742
299 Ga0496119_0024099 3300048922 Bacteria 4292
300 Ga0496120_0084985 3300048923 Bacteria 1704
301 Ga0496120_0128077 3300048923 Bacteria 1304
302 Ga0496121_0001732 3300048924 Bacteria 35619
303 Ga0496121_0006289 3300048924 Bacteria 14847
304 Ga0496124_0225957 3300048927 Bacteria 1403
305 Ga0496125_0055774 3300048928 Bacteria 3215
306 Ga0496126_0066157 3300048929 Bacteria 3232
307 Ga0496126_0105840 3300048929 Bacteria 2455
308 Ga0496126_0219921 3300048929 Bacteria 1596
309 Ga0501031_0003523 3300049568 Bacteria 10042
310 Ga0501032_0017270 3300049569 Bacteria 5065
311 Ga0501033_0093857 3300049570 Bacteria 2194
312 Ga0501034_0005888 3300049571 Bacteria 13313
313 Ga0501034_0006462 3300049571 Bacteria 12623
314 Ga0501034_0035857 3300049571 Bacteria 5029
315 Ga0501036_0004814 3300049572 Bacteria 10914
316 Ga0501036_0014776 3300049572 Bacteria 6511
317 Ga0501036_1051817 3300049572 Bacteria 665
318 Ga0501037_0004849 3300049573 Bacteria 9785
319 Ga0501038_0014445 3300049574 Bacteria 7197
320 Ga0501038_0023987 3300049574 Bacteria 5446
321 Ga0501038_0058631 3300049574 Bacteria 3300
322 Ga0501038_0067958 3300049574 Bacteria 3031
323 Ga0501038_0398104 3300049574 Bacteria 1066
324 Ga0501039_0083585 3300049575 Bacteria 2486
325 Ga0501040_0097772 3300049576 Bacteria 2045
326 Ga0501041_0017934 3300049577 Bacteria 4213
327 Ga0501041_0044264 3300049577 Bacteria 2706
328 Ga0501042_0080716 3300049578 Bacteria 2330
329 Ga0501042_0260386 3300049578 Bacteria 1252
330 Ga0501043_0009029 3300049579 Bacteria 7843
331 Ga0501043_0019761 3300049579 Bacteria 5289
332 Ga0501046_0138966 3300049580 Bacteria 1839
333 Ga0501047_0134749 3300049581 Bacteria 2350
334 Ga0501047_0360451 3300049581 Bacteria 1290
335 Ga0501047_0703576 3300049581 Bacteria 828
336 Ga0501048_0117504 3300049582 Bacteria 1878
337 Ga0501067_0001371 3300049583 Bacteria 13191
338 Ga0501068_0003524 3300049584 Bacteria 8457
339 Ga0501070_0033455 3300049586 Bacteria 4301
340 Ga0501070_0042513 3300049586 Bacteria 3785
341 Ga0501071_0053521 3300049587 Bacteria 2911
342 Ga0501072_0058607 3300049588 Bacteria 3035
343 Ga0501072_0060379 3300049588 Bacteria 2989
344 Ga0501075_0123777 3300049591 Bacteria 1968
345 Ga0501076_0006569 3300049592 Bacteria 8436
346 Ga0501076_0341770 3300049592 Bacteria 1228
347 Ga0501077_0021687 3300049593 Bacteria 4066
348 Ga0501077_0025605 3300049593 Bacteria 3746
349 Ga0501077_0171919 3300049593 Bacteria 1376
350 Ga0501247_035987 3300049677 Bacteria 693
351 Ga0501079_0095136 3300049741 Bacteria 2308
352 Ga0501080_0117790 3300049742 Bacteria 2462
353 Ga0501081_0006629 3300049743 Bacteria 7526
354 Ga0501081_0576234 3300049743 Bacteria 842
355 Ga0501083_0462621 3300049744 Bacteria 825
356 Ga0501232_022936 3300049757 Bacteria 818
357 Ga0501035_0083746 3300049822 Bacteria 2813
358 Ga0501035_0107599 3300049822 Bacteria 2445
359 Ga0501035_0145515 3300049822 Bacteria 2058
360 Ga0501035_0185134 3300049822 Bacteria 1792
361 Ga0501044_0021982 3300049823 Bacteria 6801
362 Ga0501044_0041470 3300049823 Bacteria 4792
363 Ga0501044_0100938 3300049823 Bacteria 2903
364 Ga0501044_0994969 3300049823 Bacteria 710
365 nmdc:mga03683_40749_c1 3300050489 Bacteria 1906
366 nmdc:mga03n38_226559_c1 3300050490 Bacteria 978
367 nmdc:mga03n38_23294_c1 3300050490 Bacteria 2517
368 nmdc:mga03n38_4879_c1 3300050490 Bacteria 4496
369 nmdc:mga00v17_14535_c1 3300050491 Bacteria 4397
370 nmdc:mga00v17_16952_c1 3300050491 Bacteria 4114
371 nmdc:mga00v17_41816_c1 3300050491 Bacteria 2754
372 nmdc:mga0yw44_3189_c1 3300050492 Bacteria 7214
373 nmdc:mga0yw44_4991_c1 3300050492 Bacteria 6194
374 nmdc:mga06z11_158726_c1 3300050494 Bacteria 1291
375 nmdc:mga06z11_165917_c1 3300050494 Bacteria 1265
376 nmdc:mga07m45_11600_c1 3300050496 Bacteria 4634
377 nmdc:mga07m45_188859_c2 3300050496 Bacteria 666
378 nmdc:mga09592_13410_c1 3300050508 Bacteria 6690
379 nmdc:mga0qj67_104882_c1 3300050509 Bacteria 2281
380 nmdc:mga0qj67_271072_c1 3300050509 Bacteria 1376
381 nmdc:mga0qj67_7369_c1 3300050509 Bacteria 8133
382 nmdc:mga06r32_12089_c1 3300050510 Bacteria 7784
383 nmdc:mga06r32_4504_c1 3300050510 Bacteria 12479
384 nmdc:mga06r32_51468_c1 3300050510 Bacteria 3942
385 nmdc:mga06r32_52189_c1 3300050510 Bacteria 3916
386 nmdc:mga08y16_10020_c1 3300050511 Bacteria 9947
387 nmdc:mga08y16_108482_c1 3300050511 Bacteria 2890
388 nmdc:mga08y16_250426_c1 3300050511 Bacteria 1830
389 nmdc:mga0n895_7252_c1 3300050512 Bacteria 9499
390 nmdc:mga0rr50_129191_c1 3300050513 Bacteria 2021
391 nmdc:mga0rr50_80676_c1 3300050513 Bacteria 2509
392 nmdc:mga08x19_91914_c1 3300050514 Bacteria 2004
393 nmdc:mga0a205_23160_c1 3300050515 Bacteria 5890
394 nmdc:mga0sz30_18478_c1 3300050516 Bacteria 2790
395 nmdc:mga0sz30_1970_c1 3300050516 Bacteria 7338
396 nmdc:mga0sz30_7825_c1 3300050516 Bacteria 2936
397 Ga0495655_0096555 3300053083 Bacteria 869
398 Ga0495619_0095139 3300053085 Bacteria 2021
399 Ga0500578_0015547 3300053086 Bacteria 4889
400 Ga0500651_0189564 3300053093 Bacteria 1218
401 Ga0500556_0000569 3300053104 Bacteria 24500
402 Ga0500569_003296 3300053109 Bacteria 3282
403 Ga0500658_0003774 3300053134 Bacteria 5707
404 Ga0500600_0007024 3300053149 Bacteria 6753
405 Ga0500604_0157676 3300053151 Bacteria 773
406 Ga0500616_0001925 3300053153 Bacteria 18521
407 Ga0500616_0004785 3300053153 Bacteria 9489
408 Ga0500616_0005773 3300053153 Bacteria 8308
409 Ga0500616_0024070 3300053153 Bacteria 3388
410 Ga0500633_0008546 3300053160 Bacteria 2646
411 Ga0500587_000325 3300053739 Bacteria 5369
412 Ga0501084_0065178 3300054114 Bacteria 3047
413 Ga0501084_0351892 3300054114 Bacteria 1244
414 Ga0590074_043762 3300059423 Bacteria 810
415 Ga0501082_1090368 3300060353 Bacteria 698
416 Ga0466962_0041029 3300061719 Bacteria 2215
417 Ga0466962_0125066 3300061719 Bacteria 1241
418 Ga0530510_0101837 3300061734 Bacteria 2100
419 Ga0530510_0206765 3300061734 Bacteria 1459
420 Ga0530510_0211685 3300061734 Bacteria 1440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_101188911 Ga0068868_1011889111 165
2 3300006175 Ga0070712_100002636 Ga0070712_1000026361 173
3 3300041512 Ga0451853_0738730 Ga0451853_0738730_46_699 186
4 3300042134 Ga0450898_001855 Ga0450898_001855_1102_1725 195
5 3300048917 Ga0496114_0531786 Ga0496114_0531786_422_1024 195
6 3300049572 Ga0501036_1051817 Ga0501036_1051817_17_640 195
7 3300006051 Ga0075364_10016535 Ga0075364_100165354 198
8 3300044694 Ga0466963_0337586 Ga0466963_0337586_308_928 198
9 3300044901 Ga0466960_0478282 Ga0466960_0478282_38_658 198
10 3300050491 nmdc:mga00v17_16952_c1 nmdc:mga00v17_16952_c1_336_944 198
11 iso_pu_bacteria 2579778521 2579852494 198
12 iso_pu_bacteria 2619618881 2619855803 198
13 iso_pu_bacteria 2619619003 2620348034 198
14 iso_pu_bacteria 2626541554 2626635202 198
15 iso_pu_bacteria 2643221714 2644632692 198
16 iso_pu_bacteria 2687453743 2689994972 198
17 iso_pu_bacteria 2751185725 2753036715 198
18 iso_pu_bacteria 2751185792 2753324585 198
19 iso_pu_bacteria 2808606359 2808845625 198
20 iso_pu_bacteria 2808606394 2809027065 198
21 iso_pu_bacteria 2855683550 2855687358 198
22 iso_pu_bacteria 2863404153 2863411094 198
23 iso_pu_bacteria 2867302475 2867302580 198
24 iso_pu_bacteria 2867312974 2867314657 198
25 iso_pu_bacteria 2867319477 2867322329 198
26 iso_pu_bacteria 2919468124 2919472931 198
27 iso_pu_bacteria 2939582691 2939586575 198
28 iso_pu_bacteria 2946072368 2946077692 198
29 iso_pu_bacteria 2954002825 2954007431 198
30 iso_pu_bacteria 2984523437 2984523518 198
31 iso_pu_bacteria 8055412473 8055413370 198
32 3300041512 Ga0451853_1162457 Ga0451853_1162457_214_825 199
33 3300053151 Ga0500604_0157676 Ga0500604_0157676_133_756 199
34 3300053153 Ga0500616_0005773 Ga0500616_0005773_6941_7564 199
35 iso_pu_bacteria 2932431166 2932434718 199
36 3300006847 Ga0075431_100152716 Ga0075431_1001527162 201
37 3300009094 Ga0111539_10290413 Ga0111539_102904132 201
38 3300049578 Ga0501042_0260386 Ga0501042_0260386_589_1230 201
39 3300050510 nmdc:mga06r32_12089_c1 nmdc:mga06r32_12089_c1_2921_3559 201
40 3300050510 nmdc:mga06r32_4504_c1 nmdc:mga06r32_4504_c1_10256_10894 201
41 3300050511 nmdc:mga08y16_250426_c1 nmdc:mga08y16_250426_c1_463_1098 201
42 3300060353 Ga0501082_1090368 Ga0501082_1090368_32_673 201
43 3300061734 Ga0530510_0206765 Ga0530510_0206765_778_1419 201
44 iso_pu_bacteria 2852646457 2852647992 201
45 iso_pu_bacteria 2945968032 2945969241 201
46 iso_pu_bacteria 2946033335 2946035890 201
47 iso_pu_bacteria 2946041624 2946041706 201
48 3300005366 Ga0070659_100296755 Ga0070659_1002967552 202
49 3300005367 Ga0070667_100001355 Ga0070667_10000135516 202
50 3300005434 Ga0070709_10080951 Ga0070709_100809513 202
51 3300005435 Ga0070714_100096645 Ga0070714_1000966453 202
52 3300005435 Ga0070714_100155261 Ga0070714_1001552613 202
53 3300005436 Ga0070713_100050612 Ga0070713_1000506122 202
54 3300005436 Ga0070713_100130648 Ga0070713_1001306483 202
55 3300005437 Ga0070710_10247060 Ga0070710_102470602 202
56 3300005456 Ga0070678_100080378 Ga0070678_1000803782 202
57 3300005457 Ga0070662_100295380 Ga0070662_1002953802 202
58 3300005539 Ga0068853_100102091 Ga0068853_1001020912 202
59 3300005548 Ga0070665_100183733 Ga0070665_1001837333 202
60 3300005548 Ga0070665_100297771 Ga0070665_1002977712 202
61 3300005563 Ga0068855_100612859 Ga0068855_1006128591 202
62 3300005578 Ga0068854_100109463 Ga0068854_1001094633 202
63 3300005614 Ga0068856_100138975 Ga0068856_1001389753 202
64 3300005616 Ga0068852_100149626 Ga0068852_1001496263 202
65 3300005617 Ga0068859_100001276 Ga0068859_1000012766 202
66 3300005841 Ga0068863_100005690 Ga0068863_10000569010 202
67 3300005842 Ga0068858_100000054 Ga0068858_10000005489 202
68 3300005843 Ga0068860_100000099 Ga0068860_100000099122 202
69 3300005844 Ga0068862_100000417 Ga0068862_10000041714 202
70 3300005937 Ga0081455_10200292 Ga0081455_102002921 202
71 3300005981 Ga0081538_10139789 Ga0081538_101397892 202
72 3300006028 Ga0070717_10533223 Ga0070717_105332231 202
73 3300006038 Ga0075365_10013585 Ga0075365_100135855 202
74 3300006048 Ga0075363_100009534 Ga0075363_1000095344 202
75 3300006051 Ga0075364_10004508 Ga0075364_100045085 202
76 3300006051 Ga0075364_10047208 Ga0075364_100472082 202
77 3300006058 Ga0075432_10013301 Ga0075432_100133012 202
78 3300006163 Ga0070715_10023475 Ga0070715_100234752 202
79 3300006173 Ga0070716_100208316 Ga0070716_1002083162 202
80 3300006177 Ga0075362_10029791 Ga0075362_100297912 202
81 3300006186 Ga0075369_10006081 Ga0075369_100060812 202
82 3300006186 Ga0075369_10006881 Ga0075369_100068814 202
83 3300006186 Ga0075369_10011538 Ga0075369_100115382 202
84 3300006186 Ga0075369_10019781 Ga0075369_100197812 202
85 3300006186 Ga0075369_10031403 Ga0075369_100314034 202
86 3300006353 Ga0075370_10014588 Ga0075370_100145884 202
87 3300006353 Ga0075370_10015890 Ga0075370_100158904 202
88 3300006353 Ga0075370_10209739 Ga0075370_102097391 202
89 3300006358 Ga0068871_100425687 Ga0068871_1004256872 202
90 3300006844 Ga0075428_100003888 Ga0075428_1000038883 202
91 3300006846 Ga0075430_100229959 Ga0075430_1002299593 202
92 3300006847 Ga0075431_100006616 Ga0075431_10000661612 202
93 3300006852 Ga0075433_10010501 Ga0075433_100105014 202
94 3300006871 Ga0075434_100011436 Ga0075434_1000114365 202
95 3300006871 Ga0075434_100080230 Ga0075434_1000802302 202
96 3300006880 Ga0075429_100370143 Ga0075429_1003701432 202
97 3300006914 Ga0075436_100028134 Ga0075436_1000281344 202
98 3300006931 Ga0097620_100001276 Ga0097620_1000012766 202
99 3300007076 Ga0075435_100086979 Ga0075435_1000869792 202
100 3300007076 Ga0075435_100648504 Ga0075435_1006485041 202
101 3300007788 Ga0099795_10298846 Ga0099795_102988461 202
102 3300009011 Ga0105251_10162944 Ga0105251_101629441 202
103 3300009093 Ga0105240_10751209 Ga0105240_107512091 202
104 3300009094 Ga0111539_10027936 Ga0111539_100279365 202
105 3300009094 Ga0111539_10041945 Ga0111539_100419452 202
106 3300009098 Ga0105245_10042677 Ga0105245_100426774 202
107 3300009101 Ga0105247_10000051 Ga0105247_10000051117 202
108 3300009101 Ga0105247_10068765 Ga0105247_100687653 202
109 3300009148 Ga0105243_10065158 Ga0105243_100651582 202
110 3300009174 Ga0105241_10370856 Ga0105241_103708561 202
111 3300009176 Ga0105242_10361879 Ga0105242_103618792 202
112 3300009177 Ga0105248_10000339 Ga0105248_1000033930 202
113 3300009177 Ga0105248_10789400 Ga0105248_107894001 202
114 3300009553 Ga0105249_10000020 Ga0105249_1000002019 202
115 3300009553 Ga0105249_10065983 Ga0105249_100659834 202
116 3300010375 Ga0105239_10375914 Ga0105239_103759142 202
117 3300013102 Ga0157371_10526081 Ga0157371_105260812 202
118 3300013104 Ga0157370_10511273 Ga0157370_105112732 202
119 3300013105 Ga0157369_10130481 Ga0157369_101304813 202
120 3300013296 Ga0157374_10589796 Ga0157374_105897961 202
121 3300013307 Ga0157372_10044004 Ga0157372_100440042 202
122 3300013307 Ga0157372_10523694 Ga0157372_105236942 202
123 3300013308 Ga0157375_10735859 Ga0157375_107358591 202
124 3300014325 Ga0163163_10133542 Ga0163163_101335421 202
125 3300014325 Ga0163163_10902752 Ga0163163_109027521 202
126 3300014745 Ga0157377_10090251 Ga0157377_100902512 202
127 3300014968 Ga0157379_10002091 Ga0157379_1000209113 202
128 3300017792 Ga0163161_10306329 Ga0163161_103063292 202
129 3300025898 Ga0207692_10169907 Ga0207692_101699072 202
130 3300025900 Ga0207710_10000010 Ga0207710_10000010150 202
131 3300025900 Ga0207710_10000072 Ga0207710_1000007282 202
132 3300025903 Ga0207680_10733709 Ga0207680_107337091 202
133 3300025906 Ga0207699_10086423 Ga0207699_100864233 202
134 3300025916 Ga0207663_10094481 Ga0207663_100944812 202
135 3300025927 Ga0207687_10149747 Ga0207687_101497472 202
136 3300025927 Ga0207687_10187817 Ga0207687_101878172 202
137 3300025928 Ga0207700_10010060 Ga0207700_100100606 202
138 3300025929 Ga0207664_10089118 Ga0207664_100891181 202
139 3300025934 Ga0207686_10327715 Ga0207686_103277151 202
140 3300025937 Ga0207669_10079993 Ga0207669_100799932 202
141 3300025938 Ga0207704_10410372 Ga0207704_104103721 202
142 3300025939 Ga0207665_10209831 Ga0207665_102098311 202
143 3300025941 Ga0207711_10000053 Ga0207711_1000005398 202
144 3300025941 Ga0207711_10000301 Ga0207711_1000030130 202
145 3300025961 Ga0207712_10000010 Ga0207712_10000010245 202
146 3300025986 Ga0207658_10000138 Ga0207658_1000013815 202
147 3300026035 Ga0207703_10000002 Ga0207703_10000002490 202
148 3300026035 Ga0207703_10137800 Ga0207703_101378002 202
149 3300026088 Ga0207641_10001140 Ga0207641_1000114016 202
150 3300026088 Ga0207641_10558900 Ga0207641_105589001 202
151 3300026121 Ga0207683_10369554 Ga0207683_103695542 202
152 3300027907 Ga0207428_10012710 Ga0207428_100127104 202
153 3300027907 Ga0207428_10669585 Ga0207428_106695851 202
154 3300028379 Ga0268266_10143524 Ga0268266_101435242 202
155 3300028379 Ga0268266_10400545 Ga0268266_104005452 202
156 3300028380 Ga0268265_10000014 Ga0268265_10000014199 202
157 3300028381 Ga0268264_10000137 Ga0268264_1000013746 202
158 3300028786 Ga0307517_10005281 Ga0307517_100052819 202
159 3300030521 Ga0307511_10258864 Ga0307511_102588641 202
160 3300031548 Ga0307408_100143928 Ga0307408_1001439282 202
161 3300031616 Ga0307508_10034840 Ga0307508_100348404 202
162 3300031731 Ga0307405_10303958 Ga0307405_103039581 202
163 3300031852 Ga0307410_10010406 Ga0307410_100104063 202
164 3300031852 Ga0307410_10064923 Ga0307410_100649233 202
165 3300031852 Ga0307410_10137564 Ga0307410_101375642 202
166 3300031901 Ga0307406_10167739 Ga0307406_101677392 202
167 3300031903 Ga0307407_10432069 Ga0307407_104320691 202
168 3300031911 Ga0307412_10421276 Ga0307412_104212761 202
169 3300031995 Ga0307409_100097925 Ga0307409_1000979251 202
170 3300031995 Ga0307409_100202949 Ga0307409_1002029491 202
171 3300031995 Ga0307409_100623823 Ga0307409_1006238231 202
172 3300031995 Ga0307409_100670290 Ga0307409_1006702901 202
173 3300032002 Ga0307416_100037082 Ga0307416_1000370823 202
174 3300032002 Ga0307416_100375639 Ga0307416_1003756392 202
175 3300032002 Ga0307416_101181319 Ga0307416_1011813191 202
176 3300032005 Ga0307411_10448418 Ga0307411_104484182 202
177 3300032005 Ga0307411_10925221 Ga0307411_109252211 202
178 3300032126 Ga0307415_100021405 Ga0307415_1000214053 202
179 3300032126 Ga0307415_100221130 Ga0307415_1002211301 202
180 3300033180 Ga0307510_10323365 Ga0307510_103233651 202
181 3300035170 Ga0373943_0106509 Ga0373943_0106509_368_1012 202
182 3300035692 Ga0373935_0024553 Ga0373935_0024553_2086_2730 202
183 3300035725 Ga0373947_0347046 Ga0373947_0347046_300_944 202
184 3300037068 Ga0373925_0023140 Ga0373925_0023140_187_831 202
185 3300037466 Ga0395898_0181905 Ga0395898_0181905_353_997 202
186 3300038443 Ga0395901_0004729 Ga0395901_0004729_1649_2293 202
187 3300038443 Ga0395901_0550515 Ga0395901_0550515_107_751 202
188 3300039437 Ga0436365_0291139 Ga0436365_0291139_3370_4014 202
189 3300041494 Ga0451837_0785251 Ga0451837_0785251_49_693 202
190 3300041496 Ga0451839_1304203 Ga0451839_1304203_382_1017 202
191 3300041498 Ga0451841_0072857 Ga0451841_0072857_1017_1661 202
192 3300041509 Ga0451843_0463456 Ga0451843_0463456_105_746 202
193 3300041509 Ga0451843_1291134 Ga0451843_1291134_337_981 202
194 3300041512 Ga0451853_0034694 Ga0451853_0034694_2312_2956 202
195 3300041512 Ga0451853_0432561 Ga0451853_0432561_3173_3817 202
196 3300041997 Ga0439431_0005857 Ga0439431_0005857_793_1425 202
197 3300041999 Ga0439433_0100707 Ga0439433_0100707_62_706 202
198 3300042131 Ga0450894_005199 Ga0450894_005199_638_1282 202
199 3300042145 Ga0450906_002651 Ga0450906_002651_2006_2650 202
200 3300044683 Ga0466965_0057298 Ga0466965_0057298_1271_1915 202
201 3300044683 Ga0466965_0242468 Ga0466965_0242468_288_935 202
202 3300044684 Ga0466966_0123863 Ga0466966_0123863_739_1386 202
203 3300044684 Ga0466966_0207117 Ga0466966_0207117_333_965 202
204 3300044684 Ga0466966_0225474 Ga0466966_0225474_472_1104 202
205 3300044693 Ga0466961_0091291 Ga0466961_0091291_58_705 202
206 3300044693 Ga0466961_0220252 Ga0466961_0220252_391_1047 202
207 3300044694 Ga0466963_0055626 Ga0466963_0055626_519_1175 202
208 3300044694 Ga0466963_0152463 Ga0466963_0152463_148_777 202
209 3300044719 Ga0466971_0106952 Ga0466971_0106952_601_1248 202
210 3300044765 Ga0466970_0086676 Ga0466970_0086676_589_1245 202
211 3300044842 Ga0466957_0023517 Ga0466957_0023517_2913_3557 202
212 3300044842 Ga0466957_0275287 Ga0466957_0275287_407_1051 202
213 3300044842 Ga0466957_0459304 Ga0466957_0459304_183_839 202
214 3300044901 Ga0466960_0058789 Ga0466960_0058789_840_1487 202
215 3300045049 Ga0466959_0034604 Ga0466959_0034604_2931_3563 202
216 3300045049 Ga0466959_0110122 Ga0466959_0110122_340_996 202
217 3300045836 Ga0466958_0199709 Ga0466958_0199709_560_1216 202
218 3300045976 Ga0466967_0489263 Ga0466967_0489263_384_1028 202
219 3300046453 Ga0495627_021716 Ga0495627_021716_1461_2093 202
220 3300046454 Ga0495592_0049430 Ga0495592_0049430_410_1054 202
221 3300046455 Ga0495603_0001007 Ga0495603_0001007_493_1137 202
222 3300046455 Ga0495603_0002543 Ga0495603_0002543_331_975 202
223 3300046455 Ga0495603_0003273 Ga0495603_0003273_5576_6220 202
224 3300046455 Ga0495603_0153529 Ga0495603_0153529_568_1212 202
225 3300046459 Ga0495629_0139157 Ga0495629_0139157_697_1341 202
226 3300046459 Ga0495629_0139663 Ga0495629_0139663_1012_1656 202
227 3300046459 Ga0495629_0189566 Ga0495629_0189566_313_957 202
228 3300046459 Ga0495629_0236096 Ga0495629_0236096_532_1176 202
229 3300046459 Ga0495629_0332063 Ga0495629_0332063_150_794 202
230 3300046461 Ga0495641_0025872 Ga0495641_0025872_839_1483 202
231 3300046462 Ga0495651_0184774 Ga0495651_0184774_232_876 202
232 3300046463 Ga0495653_0015255 Ga0495653_0015255_5203_5904 202
233 3300046474 Ga0495605_0103349 Ga0495605_0103349_86_730 202
234 3300046475 Ga0495639_0048100 Ga0495639_0048100_1213_1857 202
235 3300046475 Ga0495639_0132699 Ga0495639_0132699_533_1177 202
236 3300046476 Ga0495662_0050078 Ga0495662_0050078_664_1308 202
237 3300046476 Ga0495662_0141400 Ga0495662_0141400_123_767 202
238 3300046499 Ga0495594_0009721 Ga0495594_0009721_1574_2206 202
239 3300046500 Ga0495596_0057489 Ga0495596_0057489_488_1132 202
240 3300046506 Ga0495583_0012562 Ga0495583_0012562_3145_3792 202
241 3300046514 Ga0495618_0280099 Ga0495618_0280099_43_687 202
242 3300046516 Ga0495628_0156635 Ga0495628_0156635_298_942 202
243 3300046519 Ga0495632_0063867 Ga0495632_0063867_53_685 202
244 3300046522 Ga0495643_0002998 Ga0495643_0002998_3860_4492 202
245 3300046524 Ga0495648_0212999 Ga0495648_0212999_97_741 202
246 3300046525 Ga0495663_0091871 Ga0495663_0091871_250_894 202
247 3300046529 Ga0495652_0309280 Ga0495652_0309280_47_691 202
248 3300046531 Ga0495665_0205485 Ga0495665_0205485_180_824 202
249 3300046533 Ga0495640_0020572 Ga0495640_0020572_1399_2043 202
250 3300046557 Ga0495622_0292731 Ga0495622_0292731_28_672 202
251 3300046558 Ga0495633_0026908 Ga0495633_0026908_155_787 202
252 3300046559 Ga0495667_0316831 Ga0495667_0316831_236_880 202
253 3300046642 Ga0495634_0032611 Ga0495634_0032611_849_1493 202
254 3300046648 Ga0495611_0027150 Ga0495611_0027150_1225_1869 202
255 3300046663 Ga0495635_0442631 Ga0495635_0442631_162_806 202
256 3300046664 Ga0495659_0151137 Ga0495659_0151137_120_764 202
257 3300046674 Ga0495588_0107199 Ga0495588_0107199_609_1253 202
258 3300046679 Ga0495623_0281696 Ga0495623_0281696_84_728 202
259 3300046680 Ga0495646_0185715 Ga0495646_0185715_53_697 202
260 3300046681 Ga0495647_0115483 Ga0495647_0115483_283_927 202
261 3300046683 Ga0495658_0143715 Ga0495658_0143715_694_1338 202
262 3300046689 Ga0495613_0015494 Ga0495613_0015494_1171_1815 202
263 3300046689 Ga0495613_0025771 Ga0495613_0025771_276_920 202
264 3300046690 Ga0495624_0142772 Ga0495624_0142772_773_1417 202
265 3300046691 Ga0495670_0196925 Ga0495670_0196925_178_822 202
266 3300046794 Ga0495589_0008790 Ga0495589_0008790_4269_4901 202
267 3300046809 Ga0495600_0058163 Ga0495600_0058163_1838_2482 202
268 3300046810 Ga0495660_0033805 Ga0495660_0033805_522_1154 202
269 3300047315 Ga0495581_0061331 Ga0495581_0061331_1048_1692 202
270 3300047317 Ga0495604_0009711 Ga0495604_0009711_4070_4714 202
271 3300047317 Ga0495604_0010735 Ga0495604_0010735_4810_5454 202
272 3300047320 Ga0495672_0017884 Ga0495672_0017884_1581_2225 202
273 3300047321 Ga0495676_0000434 Ga0495676_0000434_10777_11421 202
274 3300047321 Ga0495676_0009907 Ga0495676_0009907_7746_8390 202
275 3300047321 Ga0495676_0023481 Ga0495676_0023481_1306_1950 202
276 3300047321 Ga0495676_0035881 Ga0495676_0035881_3421_4065 202
277 3300047321 Ga0495676_0125304 Ga0495676_0125304_474_1118 202
278 3300047321 Ga0495676_0354383 Ga0495676_0354383_167_811 202
279 3300047443 Ga0495687_005938 Ga0495687_005938_3409_4056 202
280 3300047443 Ga0495687_080126 Ga0495687_080126_619_1251 202
281 3300047443 Ga0495687_123873 Ga0495687_123873_276_908 202
282 3300047446 Ga0495679_062191 Ga0495679_062191_378_1010 202
283 3300047447 Ga0495685_001082 Ga0495685_001082_667_1311 202
284 3300047470 Ga0495681_0003743 Ga0495681_0003743_3408_4040 202
285 3300047673 Ga0495593_0016817 Ga0495593_0016817_1509_2153 202
286 3300048089 Ga0495614_0034406 Ga0495614_0034406_388_1032 202
287 3300048091 Ga0495626_0218319 Ga0495626_0218319_107_742 202
288 3300048903 Ga0496100_0027406 Ga0496100_0027406_232_855 202
289 3300048904 Ga0496101_0061063 Ga0496101_0061063_158_781 202
290 3300048904 Ga0496101_0130140 Ga0496101_0130140_263_898 202
291 3300048905 Ga0496102_0000905 Ga0496102_0000905_9854_10477 202
292 3300048905 Ga0496102_0164092 Ga0496102_0164092_704_1339 202
293 3300048906 Ga0496103_0000129 Ga0496103_0000129_9991_10614 202
294 3300048906 Ga0496103_0261383 Ga0496103_0261383_69_713 202
295 3300048907 Ga0496104_0029522 Ga0496104_0029522_2628_3272 202
296 3300048908 Ga0496105_0067425 Ga0496105_0067425_250_894 202
297 3300048909 Ga0496106_0444993 Ga0496106_0444993_59_682 202
298 3300048910 Ga0496107_0060855 Ga0496107_0060855_516_1139 202
299 3300048912 Ga0496109_0084774 Ga0496109_0084774_484_1128 202
300 3300048914 Ga0496111_0572113 Ga0496111_0572113_98_742 202
301 3300048915 Ga0496112_0070949 Ga0496112_0070949_2274_2918 202
302 3300048917 Ga0496114_0037757 Ga0496114_0037757_2887_3522 202
303 3300048919 Ga0496116_0017341 Ga0496116_0017341_4486_5109 202
304 3300048920 Ga0496117_0000304 Ga0496117_0000304_47593_48216 202
305 3300048921 Ga0496118_0002217 Ga0496118_0002217_17734_18357 202
306 3300048922 Ga0496119_0015976 Ga0496119_0015976_3181_3828 202
307 3300048922 Ga0496119_0024099 Ga0496119_0024099_597_1220 202
308 3300048923 Ga0496120_0084985 Ga0496120_0084985_147_770 202
309 3300048923 Ga0496120_0128077 Ga0496120_0128077_613_1260 202
310 3300048924 Ga0496121_0001732 Ga0496121_0001732_30979_31602 202
311 3300048924 Ga0496121_0006289 Ga0496121_0006289_7540_8187 202
312 3300048927 Ga0496124_0225957 Ga0496124_0225957_94_717 202
313 3300048928 Ga0496125_0055774 Ga0496125_0055774_159_782 202
314 3300048929 Ga0496126_0105840 Ga0496126_0105840_424_1047 202
315 3300048929 Ga0496126_0219921 Ga0496126_0219921_910_1557 202
316 3300049568 Ga0501031_0003523 Ga0501031_0003523_1622_2257 202
317 3300049569 Ga0501032_0017270 Ga0501032_0017270_4418_5053 202
318 3300049571 Ga0501034_0006462 Ga0501034_0006462_13_648 202
319 3300049572 Ga0501036_0014776 Ga0501036_0014776_13_648 202
320 3300049573 Ga0501037_0004849 Ga0501037_0004849_1365_2000 202
321 3300049574 Ga0501038_0023987 Ga0501038_0023987_3447_4082 202
322 3300049574 Ga0501038_0067958 Ga0501038_0067958_301_945 202
323 3300049574 Ga0501038_0398104 Ga0501038_0398104_215_847 202
324 3300049575 Ga0501039_0083585 Ga0501039_0083585_224_868 202
325 3300049576 Ga0501040_0097772 Ga0501040_0097772_999_1643 202
326 3300049577 Ga0501041_0017934 Ga0501041_0017934_234_869 202
327 3300049577 Ga0501041_0044264 Ga0501041_0044264_141_785 202
328 3300049578 Ga0501042_0080716 Ga0501042_0080716_635_1279 202
329 3300049579 Ga0501043_0009029 Ga0501043_0009029_1291_1926 202
330 3300049580 Ga0501046_0138966 Ga0501046_0138966_13_648 202
331 3300049581 Ga0501047_0360451 Ga0501047_0360451_196_843 202
332 3300049581 Ga0501047_0703576 Ga0501047_0703576_123_755 202
333 3300049582 Ga0501048_0117504 Ga0501048_0117504_1185_1820 202
334 3300049583 Ga0501067_0001371 Ga0501067_0001371_3216_3851 202
335 3300049584 Ga0501068_0003524 Ga0501068_0003524_41_676 202
336 3300049586 Ga0501070_0033455 Ga0501070_0033455_13_648 202
337 3300049587 Ga0501071_0053521 Ga0501071_0053521_1213_1848 202
338 3300049588 Ga0501072_0058607 Ga0501072_0058607_1764_2408 202
339 3300049588 Ga0501072_0060379 Ga0501072_0060379_927_1562 202
340 3300049591 Ga0501075_0123777 Ga0501075_0123777_977_1621 202
341 3300049592 Ga0501076_0006569 Ga0501076_0006569_7746_8390 202
342 3300049592 Ga0501076_0341770 Ga0501076_0341770_71_706 202
343 3300049593 Ga0501077_0021687 Ga0501077_0021687_3269_3913 202
344 3300049593 Ga0501077_0025605 Ga0501077_0025605_2368_3012 202
345 3300049593 Ga0501077_0171919 Ga0501077_0171919_153_788 202
346 3300049677 Ga0501247_035987 Ga0501247_035987_31_675 202
347 3300049741 Ga0501079_0095136 Ga0501079_0095136_1623_2258 202
348 3300049742 Ga0501080_0117790 Ga0501080_0117790_425_1069 202
349 3300049743 Ga0501081_0006629 Ga0501081_0006629_635_1279 202
350 3300049743 Ga0501081_0576234 Ga0501081_0576234_62_697 202
351 3300049744 Ga0501083_0462621 Ga0501083_0462621_111_746 202
352 3300049757 Ga0501232_022936 Ga0501232_022936_111_755 202
353 3300049822 Ga0501035_0083746 Ga0501035_0083746_231_866 202
354 3300049822 Ga0501035_0107599 Ga0501035_0107599_185_829 202
355 3300049822 Ga0501035_0145515 Ga0501035_0145515_59_694 202
356 3300049823 Ga0501044_0041470 Ga0501044_0041470_3531_4169 202
357 3300049823 Ga0501044_0100938 Ga0501044_0100938_578_1213 202
358 3300049823 Ga0501044_0994969 Ga0501044_0994969_63_698 202
359 3300050489 nmdc:mga03683_40749_c1 nmdc:mga03683_40749_c1_764_1381 202
360 3300050490 nmdc:mga03n38_226559_c1 nmdc:mga03n38_226559_c1_249_893 202
361 3300050490 nmdc:mga03n38_23294_c1 nmdc:mga03n38_23294_c1_1789_2406 202
362 3300050490 nmdc:mga03n38_4879_c1 nmdc:mga03n38_4879_c1_2890_3528 202
363 3300050491 nmdc:mga00v17_14535_c1 nmdc:mga00v17_14535_c1_2791_3429 202
364 3300050491 nmdc:mga00v17_41816_c1 nmdc:mga00v17_41816_c1_1209_1826 202
365 3300050492 nmdc:mga0yw44_3189_c1 nmdc:mga0yw44_3189_c1_5864_6502 202
366 3300050492 nmdc:mga0yw44_4991_c1 nmdc:mga0yw44_4991_c1_4446_5063 202
367 3300050494 nmdc:mga06z11_158726_c1 nmdc:mga06z11_158726_c1_38_655 202
368 3300050494 nmdc:mga06z11_165917_c1 nmdc:mga06z11_165917_c1_45_683 202
369 3300050496 nmdc:mga07m45_11600_c1 nmdc:mga07m45_11600_c1_1873_2511 202
370 3300050496 nmdc:mga07m45_188859_c2 nmdc:mga07m45_188859_c2_26_643 202
371 3300050508 nmdc:mga09592_13410_c1 nmdc:mga09592_13410_c1_4999_5637 202
372 3300050509 nmdc:mga0qj67_104882_c1 nmdc:mga0qj67_104882_c1_1340_1978 202
373 3300050509 nmdc:mga0qj67_271072_c1 nmdc:mga0qj67_271072_c1_166_810 202
374 3300050509 nmdc:mga0qj67_7369_c1 nmdc:mga0qj67_7369_c1_574_1212 202
375 3300050510 nmdc:mga06r32_51468_c1 nmdc:mga06r32_51468_c1_2388_3026 202
376 3300050510 nmdc:mga06r32_52189_c1 nmdc:mga06r32_52189_c1_961_1605 202
377 3300050511 nmdc:mga08y16_10020_c1 nmdc:mga08y16_10020_c1_9171_9815 202
378 3300050511 nmdc:mga08y16_108482_c1 nmdc:mga08y16_108482_c1_1625_2263 202
379 3300050512 nmdc:mga0n895_7252_c1 nmdc:mga0n895_7252_c1_6341_6985 202
380 3300050513 nmdc:mga0rr50_129191_c1 nmdc:mga0rr50_129191_c1_724_1368 202
381 3300050513 nmdc:mga0rr50_80676_c1 nmdc:mga0rr50_80676_c1_481_1125 202
382 3300050514 nmdc:mga08x19_91914_c1 nmdc:mga08x19_91914_c1_938_1582 202
383 3300050515 nmdc:mga0a205_23160_c1 nmdc:mga0a205_23160_c1_1530_2174 202
384 3300050516 nmdc:mga0sz30_18478_c1 nmdc:mga0sz30_18478_c1_758_1396 202
385 3300050516 nmdc:mga0sz30_1970_c1 nmdc:mga0sz30_1970_c1_5467_6090 202
386 3300050516 nmdc:mga0sz30_7825_c1 nmdc:mga0sz30_7825_c1_171_809 202
387 3300053083 Ga0495655_0096555 Ga0495655_0096555_63_695 202
388 3300053085 Ga0495619_0095139 Ga0495619_0095139_134_778 202
389 3300053086 Ga0500578_0015547 Ga0500578_0015547_3736_4368 202
390 3300053093 Ga0500651_0189564 Ga0500651_0189564_458_1090 202
391 3300053104 Ga0500556_0000569 Ga0500556_0000569_15881_16519 202
392 3300053109 Ga0500569_003296 Ga0500569_003296_2250_2882 202
393 3300053134 Ga0500658_0003774 Ga0500658_0003774_247_879 202
394 3300053149 Ga0500600_0007024 Ga0500600_0007024_27_659 202
395 3300053153 Ga0500616_0001925 Ga0500616_0001925_10749_11387 202
396 3300053153 Ga0500616_0004785 Ga0500616_0004785_4807_5448 202
397 3300053153 Ga0500616_0024070 Ga0500616_0024070_2020_2652 202
398 3300053160 Ga0500633_0008546 Ga0500633_0008546_1973_2605 202
399 3300053739 Ga0500587_000325 Ga0500587_000325_4171_4803 202
400 3300054114 Ga0501084_0065178 Ga0501084_0065178_1491_2126 202
401 3300054114 Ga0501084_0351892 Ga0501084_0351892_294_938 202
402 3300059423 Ga0590074_043762 Ga0590074_043762_80_724 202
403 3300061719 Ga0466962_0041029 Ga0466962_0041029_43_690 202
404 3300061734 Ga0530510_0101837 Ga0530510_0101837_913_1557 202
405 3300061734 Ga0530510_0211685 Ga0530510_0211685_663_1298 202
406 3300005337 Ga0070682_100737895 Ga0070682_1007378951 203
407 3300005577 Ga0068857_101215305 Ga0068857_1012153051 203
408 3300005618 Ga0068864_100806163 Ga0068864_1008061632 203
409 3300005983 Ga0081540_1001442 Ga0081540_100144211 203
410 3300013105 Ga0157369_10698983 Ga0157369_106989831 203
411 3300025942 Ga0207689_10508479 Ga0207689_105084792 203
412 3300026095 Ga0207676_10300844 Ga0207676_103008441 203
413 3300026116 Ga0207674_10760709 Ga0207674_107607091 203
414 3300032126 Ga0307415_100430715 Ga0307415_1004307151 203
415 3300041453 Ga0451797_0628083 Ga0451797_0628083_245_991 203
416 3300044694 Ga0466963_0062602 Ga0466963_0062602_1821_2471 203
417 3300044719 Ga0466971_0102154 Ga0466971_0102154_46_696 203
418 3300044765 Ga0466970_0045502 Ga0466970_0045502_1484_2134 203
419 3300047472 Ga0495686_0084174 Ga0495686_0084174_250_885 203
420 3300048920 Ga0496117_0193323 Ga0496117_0193323_74_754 203
421 3300048921 Ga0496118_0040898 Ga0496118_0040898_1743_2423 203
422 3300048929 Ga0496126_0066157 Ga0496126_0066157_719_1366 203
423 3300049570 Ga0501033_0093857 Ga0501033_0093857_13_714 203
424 3300049571 Ga0501034_0035857 Ga0501034_0035857_1838_2539 203
425 3300049572 Ga0501036_0004814 Ga0501036_0004814_1910_2611 203
426 3300049574 Ga0501038_0014445 Ga0501038_0014445_1984_2685 203
427 3300049579 Ga0501043_0019761 Ga0501043_0019761_869_1570 203
428 3300049581 Ga0501047_0134749 Ga0501047_0134749_785_1486 203
429 3300049586 Ga0501070_0042513 Ga0501070_0042513_394_1095 203
430 3300049822 Ga0501035_0185134 Ga0501035_0185134_732_1433 203
431 3300049823 Ga0501044_0021982 Ga0501044_0021982_2509_3210 203
432 3300061719 Ga0466962_0125066 Ga0466962_0125066_341_976 203
433 3300001979 JGI24740J21852_10004000 JGI24740J21852_100040001 205
434 3300013102 Ga0157371_10079526 Ga0157371_100795262 205
435 3300013307 Ga0157372_10215135 Ga0157372_102151353 205
436 3300025986 Ga0207658_10865419 Ga0207658_108654191 205
437 3300031548 Ga0307408_100260597 Ga0307408_1002605971 205
438 3300032004 Ga0307414_10556176 Ga0307414_105561761 205
439 3300037418 Ga0395900_0175495 Ga0395900_0175495_692_1309 205
440 3300044765 Ga0466970_0000022 Ga0466970_0000022_20837_21454 205
441 3300044765 Ga0466970_0022671 Ga0466970_0022671_2615_3232 205
442 3300044842 Ga0466957_0517745 Ga0466957_0517745_88_705 205
443 3300044901 Ga0466960_0101038 Ga0466960_0101038_835_1452 205
444 3300045836 Ga0466958_0065003 Ga0466958_0065003_252_887 205
445 3300049571 Ga0501034_0005888 Ga0501034_0005888_9542_10165 205
446 3300049574 Ga0501038_0058631 Ga0501038_0058631_440_1123 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

3

187

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8372 1 196
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.807 3 194
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8066 1 196
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8025 1 194
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7947 3 194
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8353 4 193 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8257 4 193 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7676 1 201 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7633 1 201 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7462 3 200 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1H4J914-F1-model_v4 Dihydrofolate reductase 0.9275 1 201 GO:0008703
GO:0009231
AF-A0A0F0LNS3-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9169 1 205 GO:0008703
GO:0009231
AF-A0A411YFK1-F1-model_v4 Dihydrofolate reductase 0.9168 42 197 GO:0008703
GO:0009231
AF-A0A7W7SZ10-F1-model_v4 Dihydrofolate reductase 0.912 43 197 GO:0008703
GO:0009231
AF-A0A1Y0BKG4-F1-model_v4 H148 0.9109 3 197 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
85.59 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map