F445032

General Info

Members Datasets Scaffolds Average Seq Length
443 264 438 137

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100355127|Ga0070713_1003551274
Length 158
Sequence MRSWPSSVASNPAAIRPATLIDSCVLLDVITGDQQWADWSAAEIAAAMDTGRAVINPLIYAEVSVGYQTIEELEELLPPGDYEREPLPYLAGFAAGKAFLRYRRGGGDKRSPMPDFYIGAHAAIAGYRLLTRDVRRYRTYFPTIEIIAPPSSPDETAG

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
3 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
4 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
5 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
165 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
166 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
247 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
248 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
249 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
253 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
256 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
260 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
261 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0.9
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 1.13
Rhizoplane 3.61
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 6.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1012472 3300002987 Bacteria 2025
2 JGI25406J46586_10002426 3300003203 Bacteria 8814
3 JGI25406J46586_10015592 3300003203 Bacteria 3199
4 rootH2_10312604 3300003320 Bacteria 1336
5 JGI25160J50197_1020124 3300003354 Bacteria 2024
6 Ga0055528_1011911 3300003790 Bacteria 3412
7 Ga0065165_1054431 3300005262 Bacteria 1121
8 Ga0070676_10184558 3300005328 Bacteria 1358
9 Ga0070690_100976851 3300005330 Unclassified 666
10 Ga0070682_100167958 3300005337 Bacteria 1522
11 Ga0070682_100334622 3300005337 Bacteria 1123
12 Ga0070689_101115607 3300005340 Bacteria 705
13 Ga0070692_10005051 3300005345 Bacteria 5580
14 Ga0070668_100652201 3300005347 Unclassified 925
15 Ga0070675_100817220 3300005354 Bacteria 852
16 Ga0070674_100003751 3300005356 Bacteria 8572
17 Ga0070674_100251160 3300005356 Bacteria 1389
18 Ga0070673_102247738 3300005364 Bacteria 518
19 Ga0070667_101969062 3300005367 Unclassified 550
20 Ga0070709_10265499 3300005434 Unclassified 1242
21 Ga0070709_10420979 3300005434 Bacteria 1001
22 Ga0070709_10424030 3300005434 Bacteria 997
23 Ga0070714_100023538 3300005435 Bacteria 5063
24 Ga0070714_100055754 3300005435 Bacteria 3379
25 Ga0070714_100109861 3300005435 Unclassified 2440
26 Ga0070714_100116014 3300005435 Bacteria 2377
27 Ga0070714_100638358 3300005435 Unclassified 1024
28 Ga0070714_100750323 3300005435 Bacteria 943
29 Ga0070713_100066871 3300005436 Unclassified 3024
30 Ga0070713_100326729 3300005436 Bacteria 1418
31 Ga0070713_100355127 3300005436 Bacteria 1361
32 Ga0070713_100604108 3300005436 Bacteria 1042
33 Ga0070710_10088496 3300005437 Bacteria 1822
34 Ga0070710_10105820 3300005437 Bacteria 1683
35 Ga0070711_100125632 3300005439 Bacteria 1904
36 Ga0070711_100289651 3300005439 Unclassified 1298
37 Ga0070711_100877482 3300005439 Bacteria 764
38 Ga0070708_100019926 3300005445 Bacteria 5646
39 Ga0070708_100096273 3300005445 Bacteria 2703
40 Ga0070663_100264525 3300005455 Bacteria 1365
41 Ga0070663_100341743 3300005455 Bacteria 1210
42 Ga0070663_100444241 3300005455 Unclassified 1068
43 Ga0070678_100035036 3300005456 Bacteria 3501
44 Ga0070678_101461279 3300005456 Unclassified 639
45 Ga0070662_100478675 3300005457 Bacteria 1036
46 Ga0070681_11252792 3300005458 Bacteria 664
47 Ga0070706_100092898 3300005467 Bacteria 2799
48 Ga0070706_100470451 3300005467 Bacteria 1169
49 Ga0070706_100498760 3300005467 Bacteria 1133
50 Ga0070707_100041488 3300005468 Bacteria 4405
51 Ga0070707_100050770 3300005468 Bacteria 3976
52 Ga0070707_100059833 3300005468 Bacteria 3653
53 Ga0070707_100106690 3300005468 Bacteria 2717
54 Ga0070707_100416089 3300005468 Bacteria 1304
55 Ga0070698_100000159 3300005471 Bacteria 61650
56 Ga0070698_100106383 3300005471 Bacteria 2774
57 Ga0070698_100157368 3300005471 Bacteria 2217
58 Ga0070698_100552521 3300005471 Bacteria 1091
59 Ga0070698_101003956 3300005471 Unclassified 782
60 Ga0070699_100009482 3300005518 Bacteria 8432
61 Ga0070699_100010042 3300005518 Bacteria 8194
62 Ga0070699_100668274 3300005518 Bacteria 948
63 Ga0070679_100014554 3300005530 Bacteria 7558
64 Ga0070679_100272088 3300005530 Bacteria 1648
65 Ga0070684_100065683 3300005535 Bacteria 3185
66 Ga0070697_100270679 3300005536 Bacteria 1456
67 Ga0068853_100041279 3300005539 Bacteria 3940
68 Ga0068853_101952825 3300005539 Bacteria 569
69 Ga0070693_100061872 3300005547 Unclassified 2177
70 Ga0070665_100030856 3300005548 Bacteria 5394
71 Ga0070665_100248638 3300005548 Bacteria 1779
72 Ga0070704_100393970 3300005549 Bacteria 1180
73 Ga0068855_100623322 3300005563 Bacteria 1161
74 Ga0068855_100804215 3300005563 Bacteria 999
75 Ga0068856_100013553 3300005614 Bacteria 7892
76 Ga0068856_100262955 3300005614 Bacteria 1741
77 Ga0068856_100738472 3300005614 Bacteria 1004
78 Ga0068856_100746008 3300005614 Unclassified 999
79 Ga0068859_100702262 3300005617 Bacteria 1102
80 Ga0068864_100420057 3300005618 Bacteria 1274
81 Ga0068861_101907716 3300005719 Unclassified 591
82 Ga0068863_100304919 3300005841 Bacteria 1545
83 Ga0068862_101493887 3300005844 Bacteria 681
84 Ga0081455_10002249 3300005937 Bacteria 22983
85 Ga0081539_10002846 3300005985 Bacteria 23053
86 Ga0070717_10037010 3300006028 Bacteria 3960
87 Ga0070717_10194807 3300006028 Bacteria 1772
88 Ga0070717_10214955 3300006028 Bacteria 1688
89 Ga0070717_10482398 3300006028 Bacteria 1119
90 Ga0075365_10755475 3300006038 Unclassified 687
91 Ga0075363_100309394 3300006048 Bacteria 918
92 Ga0070716_100193632 3300006173 Bacteria 1345
93 Ga0070716_100256680 3300006173 Bacteria 1194
94 Ga0070712_100164043 3300006175 Bacteria 1718
95 Ga0075370_10634524 3300006353 Bacteria 648
96 Ga0068871_100502144 3300006358 Bacteria 1093
97 Ga0075430_100019454 3300006846 Bacteria 5775
98 Ga0075431_100056566 3300006847 Bacteria 4045
99 Ga0075429_100002223 3300006880 Bacteria 16246
100 Ga0075436_100291631 3300006914 Bacteria 1168
101 Ga0097620_100358870 3300006931 Bacteria 1552
102 Ga0097620_100702300 3300006931 Bacteria 1102
103 Ga0099795_10012436 3300007788 Bacteria 2582
104 Ga0099795_10090480 3300007788 Bacteria 1186
105 Ga0105240_10089519 3300009093 Unclassified 3764
106 Ga0105240_10769100 3300009093 Bacteria 1046
107 Ga0105240_11209915 3300009093 Bacteria 800
108 Ga0114129_11309219 3300009147 Unclassified 898
109 Ga0105243_11028719 3300009148 Unclassified 828
110 Ga0105241_10570292 3300009174 Unclassified 1019
111 Ga0105242_10033166 3300009176 Bacteria 4134
112 Ga0105242_10825626 3300009176 Bacteria 920
113 Ga0105242_11079674 3300009176 Bacteria 815
114 Ga0105248_10072987 3300009177 Bacteria 3857
115 Ga0105248_10946983 3300009177 Bacteria 972
116 Ga0105237_10242631 3300009545 Bacteria 1803
117 Ga0105238_10109667 3300009551 Bacteria 2741
118 Ga0099796_10015919 3300010159 Bacteria 2210
119 Ga0105239_10108172 3300010375 Bacteria 3081
120 Ga0105239_10409366 3300010375 Bacteria 1535
121 Ga0157370_11089912 3300013104 Unclassified 722
122 Ga0157369_10045694 3300013105 Bacteria 4761
123 Ga0157369_10098973 3300013105 Bacteria 3109
124 Ga0157374_10141730 3300013296 Bacteria 2334
125 Ga0157378_11900943 3300013297 Unclassified 644
126 Ga0157372_10447832 3300013307 Plasmid 1505
127 Ga0157375_10620468 3300013308 Unclassified 1239
128 Ga0157375_11003684 3300013308 Bacteria 974
129 Ga0157380_10361919 3300014326 Bacteria 1361
130 Ga0182008_10393035 3300014497 Bacteria 743
131 Ga0157376_11118808 3300014969 Unclassified 814
132 Ga0163161_10475529 3300017792 Bacteria 1014
133 Ga0197907_11512887 3300020069 Unclassified 819
134 Ga0206349_1275810 3300020075 Bacteria 888
135 Ga0206350_10214382 3300020080 Bacteria 1027
136 Ga0213874_10062647 3300021377 Bacteria 1169
137 Ga0213874_10309167 3300021377 Unclassified 597
138 Ga0213875_10000955 3300021388 Bacteria 20648
139 Ga0213875_10009261 3300021388 Bacteria 4996
140 Ga0213875_10062707 3300021388 Bacteria 1738
141 Ga0224712_10279566 3300022467 Bacteria 777
142 Ga0209130_1000793 3300025284 Bacteria 27090
143 Ga0209025_1038403 3300025294 Bacteria 2106
144 Ga0207426_1000179 3300025302 Bacteria 158635
145 Ga0207692_10038842 3300025898 Bacteria 2337
146 Ga0207699_10225256 3300025906 Unclassified 1282
147 Ga0207684_10066448 3300025910 Bacteria 3062
148 Ga0207684_10076779 3300025910 Bacteria 2839
149 Ga0207684_10430306 3300025910 Bacteria 1134
150 Ga0207684_10474653 3300025910 Unclassified 1073
151 Ga0207684_10476987 3300025910 Bacteria 1070
152 Ga0207654_10746246 3300025911 Unclassified 705
153 Ga0207707_10034607 3300025912 Bacteria 4419
154 Ga0207695_10186305 3300025913 Bacteria 1994
155 Ga0207671_10238815 3300025914 Bacteria 1427
156 Ga0207693_10035833 3300025915 Bacteria 3910
157 Ga0207693_10183648 3300025915 Bacteria 1646
158 Ga0207663_10145839 3300025916 Bacteria 1654
159 Ga0207649_10518942 3300025920 Bacteria 908
160 Ga0207652_10001733 3300025921 Bacteria 19037
161 Ga0207646_10042429 3300025922 Bacteria 4086
162 Ga0207646_10169085 3300025922 Bacteria 1974
163 Ga0207646_10213929 3300025922 Bacteria 1741
164 Ga0207646_10350447 3300025922 Bacteria 1334
165 Ga0207681_11410958 3300025923 Bacteria 584
166 Ga0207694_10221792 3300025924 Bacteria 1542
167 Ga0207687_10000460 3300025927 Bacteria 27723
168 Ga0207700_10063303 3300025928 Unclassified 2813
169 Ga0207700_10243113 3300025928 Bacteria 1535
170 Ga0207700_10362406 3300025928 Bacteria 1264
171 Ga0207664_10000888 3300025929 Bacteria 20143
172 Ga0207664_10022933 3300025929 Bacteria 4670
173 Ga0207664_10036013 3300025929 Bacteria 3823
174 Ga0207664_10329018 3300025929 Bacteria 1349
175 Ga0207664_10515050 3300025929 Unclassified 1072
176 Ga0207706_10382411 3300025933 Bacteria 1221
177 Ga0207686_10006882 3300025934 Bacteria 6123
178 Ga0207689_10296898 3300025942 Bacteria 1339
179 Ga0207661_10004460 3300025944 Bacteria 9836
180 Ga0207679_11077415 3300025945 Bacteria 737
181 Ga0207668_10147551 3300025972 Bacteria 1817
182 Ga0207640_10902589 3300025981 Bacteria 772
183 Ga0207639_10005999 3300026041 Bacteria 8242
184 Ga0207678_10688664 3300026067 Bacteria 899
185 Ga0207702_10014646 3300026078 Bacteria 6508
186 Ga0207702_10462184 3300026078 Bacteria 1233
187 Ga0207702_10492790 3300026078 Bacteria 1194
188 Ga0207702_11145346 3300026078 Unclassified 772
189 Ga0207702_12177295 3300026078 Unclassified 543
190 Ga0207674_11359190 3300026116 Bacteria 680
191 Ga0207675_101797456 3300026118 Unclassified 632
192 Ga0207683_10150214 3300026121 Bacteria 2102
193 Ga0209179_1013668 3300027512 Bacteria 1478
194 Ga0268266_10011981 3300028379 Bacteria 7507
195 Ga0265338_10006479 3300028800 Bacteria 14906
196 Ga0265338_10009317 3300028800 Bacteria 11732
197 Ga0265338_10131954 3300028800 Bacteria 1971
198 Ga0265338_10242429 3300028800 Bacteria 1334
199 Ga0307511_10177120 3300030521 Bacteria 1157
200 Ga0265332_10260182 3300031238 Unclassified 718
201 Ga0265320_10356172 3300031240 Bacteria 646
202 Ga0265325_10053464 3300031241 Bacteria 2070
203 Ga0265325_10118795 3300031241 Bacteria 1277
204 Ga0265325_10201804 3300031241 Unclassified 917
205 Ga0265340_10098492 3300031247 Bacteria 1361
206 Ga0265339_10013897 3300031249 Bacteria 4871
207 Ga0265339_10016810 3300031249 Bacteria 4351
208 Ga0265331_10133772 3300031250 Bacteria 1130
209 Ga0265331_10144343 3300031250 Bacteria 1081
210 Ga0265327_10062220 3300031251 Unclassified 1901
211 Ga0265316_10584032 3300031344 Bacteria 793
212 Ga0307513_10280159 3300031456 Bacteria 1445
213 Ga0307513_10559608 3300031456 Bacteria 855
214 Ga0307509_10298542 3300031507 Bacteria 1360
215 Ga0307408_100518305 3300031548 Bacteria 1047
216 Ga0265313_10000079 3300031595 Bacteria 95515
217 Ga0265313_10007550 3300031595 Bacteria 7394
218 Ga0307508_10163589 3300031616 Bacteria 1828
219 Ga0307508_10361256 3300031616 Bacteria 1043
220 Ga0265314_10014243 3300031711 Bacteria 6375
221 Ga0265314_10163383 3300031711 Bacteria 1352
222 Ga0265314_10413368 3300031711 Bacteria 726
223 Ga0265342_10030080 3300031712 Bacteria 3369
224 Ga0265342_10085225 3300031712 Bacteria 1819
225 Ga0307516_10000244 3300031730 Bacteria 70125
226 Ga0307516_10614916 3300031730 Bacteria 741
227 Ga0307507_10067813 3300033179 Bacteria 3260
228 Ga0307510_10205831 3300033180 Bacteria 1496
229 Ga0373945_0518934 3300035116 Unclassified 532
230 Ga0373953_0170315 3300035117 Unclassified 937
231 Ga0373954_0103821 3300035118 Bacteria 1372
232 Ga0373956_0073343 3300035119 Bacteria 1564
233 Ga0373943_0874400 3300035170 Unclassified 536
234 Ga0373955_0519833 3300035172 Unclassified 727
235 Ga0373935_0817200 3300035692 Unclassified 688
236 Ga0373927_0233528 3300035695 Bacteria 1208
237 Ga0373933_0004810 3300035724 Bacteria 7384
238 Ga0373933_0257304 3300035724 Bacteria 1125
239 Ga0373947_0568829 3300035725 Bacteria 772
240 Ga0373947_0639418 3300035725 Unclassified 725
241 Ga0373937_0060998 3300036401 Bacteria 3466
242 Ga0373925_0084414 3300037068 Bacteria 2420
243 Ga0373925_0086097 3300037068 Unclassified 2397
244 Ga0395899_0000356 3300037312 Bacteria 56002
245 Ga0395900_0000016 3300037418 Bacteria 382407
246 Ga0395900_1371902 3300037418 Bacteria 620
247 Ga0395898_0007018 3300037466 Bacteria 11967
248 Ga0395898_1127106 3300037466 Bacteria 717
249 Ga0395905_0001846 3300037471 Bacteria 24436
250 Ga0395905_0008339 3300037471 Bacteria 10221
251 Ga0436364_0451820 3300037853 Bacteria 12064
252 Ga0436364_1114741 3300037853 Bacteria 3988
253 Ga0436364_1151778 3300037853 Plasmid 4472
254 Ga0395901_0000022 3300038443 Bacteria 296356
255 Ga0400488_24119 3300038741 Bacteria 4240
256 Ga0400486_24201 3300038742 Bacteria 1192
257 Ga0400483_111354 3300039062 Unclassified 2110
258 Ga0436361_1071402 3300039447 Unclassified 722
259 Ga0436363_0614229 3300039450 Bacteria 1069
260 Ga0436363_1167372 3300039450 Unclassified 1196
261 Ga0436362_1301255 3300039453 Unclassified 776
262 Ga0451791_1128699 3300041451 Bacteria 670
263 Ga0451807_0456072 3300041486 Bacteria 660
264 Ga0451841_0111470 3300041498 Bacteria 690
265 Ga0451853_2040062 3300041512 Bacteria 559
266 Ga0451576_0743694 3300045051 Bacteria 1030
267 Ga0466958_0394784 3300045836 Bacteria 893
268 Ga0466967_2521095 3300045976 Unclassified 509
269 Ga0495638_0265436 3300046460 Bacteria 939
270 Ga0495641_0316258 3300046461 Unclassified 704
271 Ga0495651_0707471 3300046462 Unclassified 627
272 Ga0495596_0237806 3300046500 Unclassified 707
273 Ga0495608_0008815 3300046511 Bacteria 7058
274 Ga0495630_1344410 3300046517 Bacteria 538
275 Ga0495632_0416194 3300046519 Unclassified 586
276 Ga0495586_0046684 3300046535 Bacteria 2335
277 Ga0495587_0227907 3300046536 Unclassified 1050
278 Ga0495622_0078619 3300046557 Bacteria 1519
279 Ga0495667_0094532 3300046559 Bacteria 1935
280 Ga0495635_0757221 3300046663 Unclassified 627
281 Ga0495647_0400773 3300046681 Unclassified 630
282 Ga0495658_0533573 3300046683 Unclassified 751
283 Ga0495670_0006058 3300046691 Bacteria 5927
284 Ga0495589_0275248 3300046794 Bacteria 783
285 Ga0495676_0134048 3300047321 Bacteria 1784
286 Ga0495680_0001430 3300047322 Bacteria 25733
287 Ga0495675_0053913 3300047444 Bacteria 2552
288 Ga0495679_005301 3300047446 Bacteria 5741
289 Ga0495686_0190409 3300047472 Bacteria 1183
290 Ga0495602_0375714 3300048088 Unclassified 1019
291 Ga0496100_0100643 3300048903 Unclassified 1991
292 Ga0496101_0153604 3300048904 Bacteria 1762
293 Ga0496104_0035523 3300048907 Unclassified 4653
294 Ga0496104_0261024 3300048907 Bacteria 1645
295 Ga0496106_0004512 3300048909 Bacteria 10312
296 Ga0496107_0034561 3300048910 Bacteria 3621
297 Ga0496109_0003817 3300048912 Bacteria 12582
298 Ga0496109_0303108 3300048912 Bacteria 1507
299 Ga0496110_0025624 3300048913 Bacteria 5042
300 Ga0496111_0063312 3300048914 Unclassified 2682
301 Ga0496112_1057021 3300048915 Unclassified 731
302 Ga0496112_1143220 3300048915 Bacteria 696
303 Ga0496113_0597373 3300048916 Bacteria 884
304 Ga0496114_0005535 3300048917 Bacteria 9895
305 Ga0496118_0090461 3300048921 Bacteria 2109
306 Ga0496121_0655320 3300048924 Unclassified 639
307 Ga0496126_0007968 3300048929 Bacteria 11509
308 Ga0496126_0444342 3300048929 Unclassified 1045
309 Ga0501031_1000054 3300049568 Bacteria 534
310 Ga0501032_0031661 3300049569 Bacteria 3626
311 Ga0501032_0054520 3300049569 Bacteria 2691
312 Ga0501032_0479544 3300049569 Bacteria 796
313 Ga0501032_0656670 3300049569 Unclassified 666
314 Ga0501032_0767955 3300049569 Unclassified 609
315 Ga0501033_0007287 3300049570 Bacteria 8628
316 Ga0501033_0018654 3300049570 Bacteria 5243
317 Ga0501033_0021217 3300049570 Bacteria 4900
318 Ga0501033_0257825 3300049570 Bacteria 1235
319 Ga0501033_0501994 3300049570 Bacteria 839
320 Ga0501034_0001448 3300049571 Bacteria 31444
321 Ga0501034_0333697 3300049571 Bacteria 1447
322 Ga0501036_0153889 3300049572 Bacteria 1940
323 Ga0501037_0000271 3300049573 Bacteria 44641
324 Ga0501037_0118935 3300049573 Bacteria 1901
325 Ga0501037_0777801 3300049573 Unclassified 633
326 Ga0501038_0332481 3300049574 Bacteria 1186
327 Ga0501038_0901046 3300049574 Bacteria 653
328 Ga0501039_0442682 3300049575 Bacteria 1020
329 Ga0501039_0786144 3300049575 Bacteria 743
330 Ga0501042_0250112 3300049578 Bacteria 1279
331 Ga0501043_0000096 3300049579 Bacteria 79864
332 Ga0501043_0037264 3300049579 Bacteria 3824
333 Ga0501043_0082500 3300049579 Bacteria 2527
334 Ga0501043_0128517 3300049579 Bacteria 1986
335 Ga0501043_0160006 3300049579 Bacteria 1760
336 Ga0501043_0320100 3300049579 Bacteria 1183
337 Ga0501043_0321306 3300049579 Bacteria 1180
338 Ga0501047_0024606 3300049581 Bacteria 5780
339 Ga0501047_0262456 3300049581 Bacteria 1575
340 Ga0501047_0292973 3300049581 Bacteria 1471
341 Ga0501047_0353951 3300049581 Bacteria 1305
342 Ga0501047_0383258 3300049581 Unclassified 1240
343 Ga0501047_0765255 3300049581 Bacteria 781
344 Ga0501047_1175934 3300049581 Bacteria 580
345 Ga0501048_0099976 3300049582 Bacteria 2046
346 Ga0501048_0346236 3300049582 Bacteria 1060
347 Ga0501068_0032975 3300049584 Bacteria 3082
348 Ga0501068_0113837 3300049584 Bacteria 1684
349 Ga0501069_0000012 3300049585 Bacteria 148453
350 Ga0501069_0046868 3300049585 Bacteria 2398
351 Ga0501069_0095962 3300049585 Bacteria 1680
352 Ga0501069_0221294 3300049585 Bacteria 1100
353 Ga0501069_0245788 3300049585 Bacteria 1043
354 Ga0501070_0000329 3300049586 Bacteria 43062
355 Ga0501070_0000655 3300049586 Bacteria 31899
356 Ga0501070_0002286 3300049586 Bacteria 16840
357 Ga0501070_0043367 3300049586 Bacteria 3744
358 Ga0501070_0063031 3300049586 Bacteria 3071
359 Ga0501070_0087397 3300049586 Bacteria 2580
360 Ga0501070_0245087 3300049586 Bacteria 1466
361 Ga0501070_0384917 3300049586 Bacteria 1136
362 Ga0501070_0543593 3300049586 Bacteria 930
363 Ga0501070_0775681 3300049586 Bacteria 754
364 Ga0501071_0005903 3300049587 Bacteria 7920
365 Ga0501071_0129491 3300049587 Bacteria 1874
366 Ga0501071_0363830 3300049587 Bacteria 1102
367 Ga0501072_0531387 3300049588 Bacteria 929
368 Ga0501073_0040779 3300049589 Bacteria 3284
369 Ga0501073_0078417 3300049589 Bacteria 2298
370 Ga0501073_0107797 3300049589 Bacteria 1933
371 Ga0501074_0000018 3300049590 Bacteria 76326
372 Ga0501074_0001388 3300049590 Bacteria 16079
373 Ga0501074_0200331 3300049590 Bacteria 1423
374 Ga0501074_0919865 3300049590 Bacteria 615
375 Ga0501075_0199180 3300049591 Bacteria 1527
376 Ga0501076_0046649 3300049592 Bacteria 3424
377 Ga0501076_0564802 3300049592 Bacteria 938
378 Ga0501079_0399577 3300049741 Bacteria 1078
379 Ga0501079_1430457 3300049741 Bacteria 544
380 Ga0501080_0000558 3300049742 Bacteria 29460
381 Ga0501080_0004527 3300049742 Bacteria 12392
382 Ga0501080_0076186 3300049742 Bacteria 3120
383 Ga0501080_0364021 3300049742 Bacteria 1304
384 Ga0501080_0377645 3300049742 Bacteria 1277
385 Ga0501080_0422900 3300049742 Bacteria 1197
386 Ga0501081_0564824 3300049743 Bacteria 850
387 Ga0501083_0001735 3300049744 Bacteria 14857
388 Ga0501083_0166597 3300049744 Bacteria 1440
389 Ga0501035_0000039 3300049822 Bacteria 156824
390 Ga0501035_0001538 3300049822 Bacteria 23474
391 Ga0501035_0005458 3300049822 Bacteria 12026
392 Ga0501035_0036028 3300049822 Bacteria 4487
393 Ga0501035_0160469 3300049822 Bacteria 1946
394 Ga0501035_0464228 3300049822 Unclassified 1046
395 Ga0501035_0706987 3300049822 Bacteria 812
396 Ga0501035_1369073 3300049822 Unclassified 543
397 Ga0501035_1569545 3300049822 Unclassified 500
398 Ga0501044_0000047 3300049823 Bacteria 146449
399 Ga0501044_0016976 3300049823 Bacteria 7809
400 Ga0501044_0027020 3300049823 Bacteria 6072
401 Ga0501044_0111970 3300049823 Bacteria 2736
402 Ga0501044_0309508 3300049823 Bacteria 1506
403 Ga0501044_0320199 3300049823 Bacteria 1475
404 Ga0501044_0391550 3300049823 Bacteria 1303
405 Ga0501044_0949951 3300049823 Bacteria 733
406 Ga0501045_0293730 3300049824 Bacteria 1209
407 Ga0501045_0347604 3300049824 Bacteria 1104
408 nmdc:mga07m45_578298_c1 3300050496 Bacteria 649
409 nmdc:mga05p37_195544_c1 3300050507 Bacteria 2452
410 nmdc:mga09592_1503_c1 3300050508 Bacteria 18776
411 nmdc:mga0qj67_32949_c1 3300050509 Bacteria 4042
412 nmdc:mga06r32_31481_c1 3300050510 Bacteria 4983
413 nmdc:mga06r32_453876_c1 3300050510 Bacteria 1261
414 Ga0500635_0121438 3300053080 Unclassified 978
415 Ga0500646_0101040 3300053090 Bacteria 905
416 Ga0500647_0206325 3300053091 Unclassified 888
417 Ga0500572_236113 3300053111 Bacteria 597
418 Ga0500658_0184709 3300053134 Bacteria 950
419 Ga0500573_0245750 3300053140 Bacteria 925
420 Ga0500590_151002 3300053148 Bacteria 1048
421 Ga0500604_0054459 3300053151 Bacteria 1242
422 Ga0500616_0106293 3300053153 Bacteria 1363
423 Ga0500627_0089214 3300053158 Bacteria 1379
424 Ga0500639_177118 3300053163 Unclassified 948
425 Ga0500636_0003999 3300053177 Bacteria 8311
426 Ga0500636_0034801 3300053177 Bacteria 2981
427 Ga0500636_0192514 3300053177 Bacteria 1085
428 Ga0500637_0063418 3300053178 Unclassified 2119
429 Ga0500637_0177914 3300053178 Bacteria 1220
430 Ga0500637_0292511 3300053178 Bacteria 891
431 Ga0500570_104290 3300053724 Bacteria 1178
432 Ga0500657_126445 3300053728 Bacteria 1001
433 Ga0500552_011538 3300053733 Bacteria 1112
434 Ga0501084_0000366 3300054114 Bacteria 34534
435 Ga0501084_0162522 3300054114 Bacteria 1884
436 Ga0501082_0059465 3300060353 Bacteria 3293
437 Ga0501082_0148041 3300060353 Bacteria 2039
438 Ga0530510_0173431 3300061734 Bacteria 1598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100167958 Ga0070682_1001679583 119
2 3300010375 Ga0105239_10409366 Ga0105239_104093663 120
3 3300048909 Ga0496106_0004512 Ga0496106_0004512_3794_4171 125
4 3300048910 Ga0496107_0034561 Ga0496107_0034561_1615_1992 125
5 3300005437 Ga0070710_10088496 Ga0070710_100884962 127
6 3300006028 Ga0070717_10214955 Ga0070717_102149553 127
7 3300006175 Ga0070712_100164043 Ga0070712_1001640432 127
8 3300014497 Ga0182008_10393035 Ga0182008_103930351 127
9 3300049741 Ga0501079_1430457 Ga0501079_1430457_13_399 128
10 iso_pu_bacteria 2841911363 2841912233 128
11 iso_pu_bacteria 2841917233 2841919998 128
12 3300026078 Ga0207702_12177295 Ga0207702_121772951 130
13 iso_pu_bacteria 2517572101 2517760446 130
14 3300017792 Ga0163161_10475529 Ga0163161_104755292 131
15 3300021388 Ga0213875_10062707 Ga0213875_100627073 131
16 3300025929 Ga0207664_10000888 Ga0207664_1000088816 131
17 3300031240 Ga0265320_10356172 Ga0265320_103561721 131
18 3300037853 Ga0436364_1151778 Ga0436364_1151778_3391_3795 131
19 3300039450 Ga0436363_0614229 Ga0436363_0614229_645_1049 131
20 3300049590 Ga0501074_0001388 Ga0501074_0001388_789_1184 131
21 3300005328 Ga0070676_10184558 Ga0070676_101845582 132
22 3300005330 Ga0070690_100976851 Ga0070690_1009768511 132
23 3300005340 Ga0070689_101115607 Ga0070689_1011156072 132
24 3300005347 Ga0070668_100652201 Ga0070668_1006522012 132
25 3300005539 Ga0068853_101952825 Ga0068853_1019528251 132
26 3300005548 Ga0070665_100248638 Ga0070665_1002486382 132
27 3300005937 Ga0081455_10002249 Ga0081455_1000224914 132
28 3300009093 Ga0105240_11209915 Ga0105240_112099151 132
29 3300009177 Ga0105248_10946983 Ga0105248_109469832 132
30 3300009545 Ga0105237_10242631 Ga0105237_102426313 132
31 3300025914 Ga0207671_10238815 Ga0207671_102388153 132
32 3300035116 Ga0373945_0518934 Ga0373945_0518934_81_479 132
33 3300037068 Ga0373925_0086097 Ga0373925_0086097_113_511 132
34 3300039447 Ga0436361_1071402 Ga0436361_1071402_186_584 132
35 3300041512 Ga0451853_2040062 Ga0451853_2040062_24_422 132
36 3300045051 Ga0451576_0743694 Ga0451576_0743694_503_901 132
37 3300048921 Ga0496118_0090461 Ga0496118_0090461_34_432 132
38 3300048924 Ga0496121_0655320 Ga0496121_0655320_136_534 132
39 3300003320 rootH2_10312604 rootH2_103126041 133
40 3300005354 Ga0070675_100817220 Ga0070675_1008172202 133
41 3300005356 Ga0070674_100003751 Ga0070674_1000037519 133
42 3300005434 Ga0070709_10265499 Ga0070709_102654991 133
43 3300005435 Ga0070714_100055754 Ga0070714_1000557542 133
44 3300005435 Ga0070714_100116014 Ga0070714_1001160143 133
45 3300005455 Ga0070663_100341743 Ga0070663_1003417433 133
46 3300005456 Ga0070678_100035036 Ga0070678_1000350363 133
47 3300005456 Ga0070678_101461279 Ga0070678_1014612792 133
48 3300005457 Ga0070662_100478675 Ga0070662_1004786751 133
49 3300006846 Ga0075430_100019454 Ga0075430_1000194546 133
50 3300006847 Ga0075431_100056566 Ga0075431_1000565663 133
51 3300006880 Ga0075429_100002223 Ga0075429_1000022233 133
52 3300009093 Ga0105240_10089519 Ga0105240_100895196 133
53 3300009147 Ga0114129_11309219 Ga0114129_113092192 133
54 3300014969 Ga0157376_11118808 Ga0157376_111188081 133
55 3300021377 Ga0213874_10062647 Ga0213874_100626472 133
56 3300025906 Ga0207699_10225256 Ga0207699_102252561 133
57 3300025913 Ga0207695_10186305 Ga0207695_101863053 133
58 3300025929 Ga0207664_10022933 Ga0207664_100229337 133
59 3300025929 Ga0207664_10515050 Ga0207664_105150502 133
60 3300025933 Ga0207706_10382411 Ga0207706_103824112 133
61 3300025972 Ga0207668_10147551 Ga0207668_101475511 133
62 3300026067 Ga0207678_10688664 Ga0207678_106886643 133
63 3300026121 Ga0207683_10150214 Ga0207683_101502145 133
64 3300031241 Ga0265325_10053464 Ga0265325_100534643 133
65 3300031730 Ga0307516_10000244 Ga0307516_1000024430 133
66 3300035724 Ga0373933_0257304 Ga0373933_0257304_424_849 133
67 3300039450 Ga0436363_1167372 Ga0436363_1167372_266_667 133
68 3300048904 Ga0496101_0153604 Ga0496101_0153604_1065_1466 133
69 3300048907 Ga0496104_0261024 Ga0496104_0261024_627_1028 133
70 3300048915 Ga0496112_1057021 Ga0496112_1057021_238_639 133
71 3300048929 Ga0496126_0007968 Ga0496126_0007968_10360_10761 133
72 3300048929 Ga0496126_0444342 Ga0496126_0444342_484_885 133
73 3300049570 Ga0501033_0257825 Ga0501033_0257825_324_725 133
74 3300049571 Ga0501034_0333697 Ga0501034_0333697_691_1092 133
75 3300049581 Ga0501047_0353951 Ga0501047_0353951_791_1192 133
76 3300049823 Ga0501044_0949951 Ga0501044_0949951_86_487 133
77 3300050507 nmdc:mga05p37_195544_c1 nmdc:mga05p37_195544_c1_1964_2365 133
78 3300050508 nmdc:mga09592_1503_c1 nmdc:mga09592_1503_c1_7815_8216 133
79 3300050509 nmdc:mga0qj67_32949_c1 nmdc:mga0qj67_32949_c1_152_553 133
80 3300050510 nmdc:mga06r32_31481_c1 nmdc:mga06r32_31481_c1_492_893 133
81 iso_pu_bacteria 2838022645 2838024427 133
82 iso_pu_bacteria 2842198810 2842199970 133
83 3300003203 JGI25406J46586_10002426 JGI25406J46586_100024266 134
84 3300003203 JGI25406J46586_10015592 JGI25406J46586_100155923 134
85 3300005434 Ga0070709_10420979 Ga0070709_104209792 134
86 3300005435 Ga0070714_100023538 Ga0070714_1000235383 134
87 3300005436 Ga0070713_100326729 Ga0070713_1003267293 134
88 3300005445 Ga0070708_100096273 Ga0070708_1000962734 134
89 3300005455 Ga0070663_100264525 Ga0070663_1002645253 134
90 3300005467 Ga0070706_100470451 Ga0070706_1004704513 134
91 3300005468 Ga0070707_100041488 Ga0070707_1000414881 134
92 3300005468 Ga0070707_100106690 Ga0070707_1001066902 134
93 3300005471 Ga0070698_100000159 Ga0070698_10000015924 134
94 3300005471 Ga0070698_100552521 Ga0070698_1005525212 134
95 3300005518 Ga0070699_100009482 Ga0070699_10000948212 134
96 3300005518 Ga0070699_100010042 Ga0070699_1000100423 134
97 3300005563 Ga0068855_100804215 Ga0068855_1008042152 134
98 3300005617 Ga0068859_100702262 Ga0068859_1007022622 134
99 3300005618 Ga0068864_100420057 Ga0068864_1004200571 134
100 3300005985 Ga0081539_10002846 Ga0081539_1000284610 134
101 3300006358 Ga0068871_100502144 Ga0068871_1005021442 134
102 3300006931 Ga0097620_100702300 Ga0097620_1007023002 134
103 3300007788 Ga0099795_10090480 Ga0099795_100904802 134
104 3300009176 Ga0105242_10825626 Ga0105242_108256262 134
105 3300021388 Ga0213875_10009261 Ga0213875_100092615 134
106 3300025910 Ga0207684_10066448 Ga0207684_100664484 134
107 3300025910 Ga0207684_10476987 Ga0207684_104769873 134
108 3300025920 Ga0207649_10518942 Ga0207649_105189422 134
109 3300025922 Ga0207646_10042429 Ga0207646_100424295 134
110 3300025922 Ga0207646_10213929 Ga0207646_102139291 134
111 3300025929 Ga0207664_10036013 Ga0207664_100360134 134
112 3300025942 Ga0207689_10296898 Ga0207689_102968982 134
113 3300025945 Ga0207679_11077415 Ga0207679_110774151 134
114 3300028800 Ga0265338_10006479 Ga0265338_100064795 134
115 3300031249 Ga0265339_10016810 Ga0265339_100168102 134
116 3300031344 Ga0265316_10584032 Ga0265316_105840322 134
117 3300031456 Ga0307513_10280159 Ga0307513_102801592 134
118 3300031711 Ga0265314_10163383 Ga0265314_101633834 134
119 3300031711 Ga0265314_10413368 Ga0265314_104133682 134
120 3300031712 Ga0265342_10085225 Ga0265342_100852252 134
121 3300035117 Ga0373953_0170315 Ga0373953_0170315_171_575 134
122 3300035118 Ga0373954_0103821 Ga0373954_0103821_687_1091 134
123 3300035119 Ga0373956_0073343 Ga0373956_0073343_452_856 134
124 3300035172 Ga0373955_0519833 Ga0373955_0519833_203_607 134
125 3300035724 Ga0373933_0004810 Ga0373933_0004810_5075_5479 134
126 3300036401 Ga0373937_0060998 Ga0373937_0060998_1008_1412 134
127 3300037312 Ga0395899_0000356 Ga0395899_0000356_23842_24246 134
128 3300037418 Ga0395900_0000016 Ga0395900_0000016_222737_223141 134
129 3300037466 Ga0395898_0007018 Ga0395898_0007018_6577_6981 134
130 3300037471 Ga0395905_0008339 Ga0395905_0008339_6839_7243 134
131 3300038443 Ga0395901_0000022 Ga0395901_0000022_260818_261222 134
132 3300046462 Ga0495651_0707471 Ga0495651_0707471_97_501 134
133 3300046500 Ga0495596_0237806 Ga0495596_0237806_171_575 134
134 3300046511 Ga0495608_0008815 Ga0495608_0008815_3864_4268 134
135 3300046536 Ga0495587_0227907 Ga0495587_0227907_414_818 134
136 3300046559 Ga0495667_0094532 Ga0495667_0094532_524_928 134
137 3300046663 Ga0495635_0757221 Ga0495635_0757221_32_436 134
138 3300047444 Ga0495675_0053913 Ga0495675_0053913_1063_1467 134
139 3300048088 Ga0495602_0375714 Ga0495602_0375714_106_510 134
140 3300048903 Ga0496100_0100643 Ga0496100_0100643_943_1347 134
141 3300048907 Ga0496104_0035523 Ga0496104_0035523_4102_4506 134
142 3300048912 Ga0496109_0003817 Ga0496109_0003817_9843_10247 134
143 3300048912 Ga0496109_0303108 Ga0496109_0303108_633_1037 134
144 3300048913 Ga0496110_0025624 Ga0496110_0025624_1873_2277 134
145 3300048914 Ga0496111_0063312 Ga0496111_0063312_597_1001 134
146 3300048915 Ga0496112_1143220 Ga0496112_1143220_83_487 134
147 3300048916 Ga0496113_0597373 Ga0496113_0597373_299_703 134
148 3300048917 Ga0496114_0005535 Ga0496114_0005535_8087_8491 134
149 3300049568 Ga0501031_1000054 Ga0501031_1000054_59_463 134
150 3300049569 Ga0501032_0767955 Ga0501032_0767955_106_510 134
151 3300049570 Ga0501033_0501994 Ga0501033_0501994_92_496 134
152 3300049573 Ga0501037_0777801 Ga0501037_0777801_155_559 134
153 3300049575 Ga0501039_0442682 Ga0501039_0442682_331_735 134
154 3300049578 Ga0501042_0250112 Ga0501042_0250112_720_1124 134
155 3300049581 Ga0501047_0292973 Ga0501047_0292973_597_1001 134
156 3300049582 Ga0501048_0099976 Ga0501048_0099976_1054_1458 134
157 3300049587 Ga0501071_0363830 Ga0501071_0363830_503_907 134
158 3300049588 Ga0501072_0531387 Ga0501072_0531387_204_608 134
159 3300049589 Ga0501073_0078417 Ga0501073_0078417_249_653 134
160 3300049590 Ga0501074_0919865 Ga0501074_0919865_27_431 134
161 3300049591 Ga0501075_0199180 Ga0501075_0199180_89_493 134
162 3300049592 Ga0501076_0046649 Ga0501076_0046649_721_1125 134
163 3300049592 Ga0501076_0564802 Ga0501076_0564802_353_757 134
164 3300049742 Ga0501080_0076186 Ga0501080_0076186_2173_2577 134
165 3300049743 Ga0501081_0564824 Ga0501081_0564824_241_645 134
166 3300049744 Ga0501083_0166597 Ga0501083_0166597_475_879 134
167 3300049822 Ga0501035_1369073 Ga0501035_1369073_102_506 134
168 3300049824 Ga0501045_0293730 Ga0501045_0293730_296_700 134
169 3300053177 Ga0500636_0003999 Ga0500636_0003999_4670_5074 134
170 3300053178 Ga0500637_0063418 Ga0500637_0063418_163_567 134
171 3300053178 Ga0500637_0177914 Ga0500637_0177914_241_645 134
172 3300054114 Ga0501084_0162522 Ga0501084_0162522_495_899 134
173 3300060353 Ga0501082_0148041 Ga0501082_0148041_1308_1712 134
174 3300061734 Ga0530510_0173431 Ga0530510_0173431_612_1016 134
175 3300005337 Ga0070682_100334622 Ga0070682_1003346223 135
176 3300005468 Ga0070707_100050770 Ga0070707_1000507704 135
177 3300005471 Ga0070698_101003956 Ga0070698_1010039562 135
178 3300005530 Ga0070679_100014554 Ga0070679_1000145546 135
179 3300005535 Ga0070684_100065683 Ga0070684_1000656834 135
180 3300005536 Ga0070697_100270679 Ga0070697_1002706791 135
181 3300005539 Ga0068853_100041279 Ga0068853_1000412796 135
182 3300005549 Ga0070704_100393970 Ga0070704_1003939702 135
183 3300005563 Ga0068855_100623322 Ga0068855_1006233223 135
184 3300005614 Ga0068856_100013553 Ga0068856_1000135537 135
185 3300005614 Ga0068856_100262955 Ga0068856_1002629554 135
186 3300006173 Ga0070716_100256680 Ga0070716_1002566802 135
187 3300006931 Ga0097620_100358870 Ga0097620_1003588702 135
188 3300007788 Ga0099795_10012436 Ga0099795_100124364 135
189 3300009174 Ga0105241_10570292 Ga0105241_105702922 135
190 3300009551 Ga0105238_10109667 Ga0105238_101096673 135
191 3300010159 Ga0099796_10015919 Ga0099796_100159191 135
192 3300010375 Ga0105239_10108172 Ga0105239_101081722 135
193 3300013104 Ga0157370_11089912 Ga0157370_110899122 135
194 3300013105 Ga0157369_10045694 Ga0157369_100456943 135
195 3300013297 Ga0157378_11900943 Ga0157378_119009432 135
196 3300020075 Ga0206349_1275810 Ga0206349_12758101 135
197 3300021388 Ga0213875_10000955 Ga0213875_1000095521 135
198 3300022467 Ga0224712_10279566 Ga0224712_102795661 135
199 3300025911 Ga0207654_10746246 Ga0207654_107462461 135
200 3300025912 Ga0207707_10034607 Ga0207707_100346075 135
201 3300025921 Ga0207652_10001733 Ga0207652_1000173317 135
202 3300025922 Ga0207646_10169085 Ga0207646_101690853 135
203 3300025924 Ga0207694_10221792 Ga0207694_102217923 135
204 3300025927 Ga0207687_10000460 Ga0207687_100004609 135
205 3300025944 Ga0207661_10004460 Ga0207661_100044609 135
206 3300026041 Ga0207639_10005999 Ga0207639_100059999 135
207 3300026078 Ga0207702_10014646 Ga0207702_100146467 135
208 3300026078 Ga0207702_10492790 Ga0207702_104927903 135
209 3300027512 Ga0209179_1013668 Ga0209179_10136682 135
210 3300028800 Ga0265338_10131954 Ga0265338_101319542 135
211 3300030521 Ga0307511_10177120 Ga0307511_101771202 135
212 3300031238 Ga0265332_10260182 Ga0265332_102601822 135
213 3300031241 Ga0265325_10118795 Ga0265325_101187953 135
214 3300031241 Ga0265325_10201804 Ga0265325_102018041 135
215 3300031247 Ga0265340_10098492 Ga0265340_100984923 135
216 3300031249 Ga0265339_10013897 Ga0265339_100138972 135
217 3300031250 Ga0265331_10144343 Ga0265331_101443432 135
218 3300031507 Ga0307509_10298542 Ga0307509_102985422 135
219 3300031548 Ga0307408_100518305 Ga0307408_1005183052 135
220 3300031595 Ga0265313_10000079 Ga0265313_1000007976 135
221 3300031595 Ga0265313_10007550 Ga0265313_100075506 135
222 3300031616 Ga0307508_10163589 Ga0307508_101635892 135
223 3300031711 Ga0265314_10014243 Ga0265314_100142431 135
224 3300031712 Ga0265342_10030080 Ga0265342_100300802 135
225 3300031730 Ga0307516_10614916 Ga0307516_106149162 135
226 3300033179 Ga0307507_10067813 Ga0307507_100678134 135
227 3300033180 Ga0307510_10205831 Ga0307510_102058312 135
228 3300035170 Ga0373943_0874400 Ga0373943_0874400_103_510 135
229 3300035692 Ga0373935_0817200 Ga0373935_0817200_105_512 135
230 3300035695 Ga0373927_0233528 Ga0373927_0233528_281_688 135
231 3300035725 Ga0373947_0568829 Ga0373947_0568829_208_621 135
232 3300035725 Ga0373947_0639418 Ga0373947_0639418_45_452 135
233 3300037068 Ga0373925_0084414 Ga0373925_0084414_864_1274 135
234 3300037853 Ga0436364_0451820 Ga0436364_0451820_5940_6368 135
235 3300037853 Ga0436364_1114741 Ga0436364_1114741_1377_1784 135
236 3300041451 Ga0451791_1128699 Ga0451791_1128699_204_611 135
237 3300046461 Ga0495641_0316258 Ga0495641_0316258_228_635 135
238 3300046517 Ga0495630_1344410 Ga0495630_1344410_53_460 135
239 3300046535 Ga0495586_0046684 Ga0495586_0046684_1323_1730 135
240 3300046557 Ga0495622_0078619 Ga0495622_0078619_256_663 135
241 3300046681 Ga0495647_0400773 Ga0495647_0400773_27_434 135
242 3300046683 Ga0495658_0533573 Ga0495658_0533573_67_474 135
243 3300046691 Ga0495670_0006058 Ga0495670_0006058_1683_2093 135
244 3300046794 Ga0495589_0275248 Ga0495589_0275248_148_561 135
245 3300047321 Ga0495676_0134048 Ga0495676_0134048_553_966 135
246 3300047322 Ga0495680_0001430 Ga0495680_0001430_9003_9410 135
247 3300047446 Ga0495679_005301 Ga0495679_005301_376_783 135
248 3300049569 Ga0501032_0031661 Ga0501032_0031661_74_481 135
249 3300049569 Ga0501032_0479544 Ga0501032_0479544_301_708 135
250 3300049569 Ga0501032_0656670 Ga0501032_0656670_46_453 135
251 3300049570 Ga0501033_0007287 Ga0501033_0007287_7982_8389 135
252 3300049570 Ga0501033_0018654 Ga0501033_0018654_3402_3809 135
253 3300049570 Ga0501033_0021217 Ga0501033_0021217_251_658 135
254 3300049571 Ga0501034_0001448 Ga0501034_0001448_23826_24233 135
255 3300049572 Ga0501036_0153889 Ga0501036_0153889_255_662 135
256 3300049573 Ga0501037_0000271 Ga0501037_0000271_19323_19730 135
257 3300049573 Ga0501037_0118935 Ga0501037_0118935_1326_1733 135
258 3300049574 Ga0501038_0332481 Ga0501038_0332481_711_1118 135
259 3300049574 Ga0501038_0901046 Ga0501038_0901046_40_447 135
260 3300049575 Ga0501039_0786144 Ga0501039_0786144_91_498 135
261 3300049579 Ga0501043_0000096 Ga0501043_0000096_25249_25656 135
262 3300049579 Ga0501043_0037264 Ga0501043_0037264_3112_3519 135
263 3300049579 Ga0501043_0082500 Ga0501043_0082500_1345_1752 135
264 3300049579 Ga0501043_0128517 Ga0501043_0128517_932_1339 135
265 3300049579 Ga0501043_0320100 Ga0501043_0320100_747_1154 135
266 3300049579 Ga0501043_0321306 Ga0501043_0321306_394_801 135
267 3300049581 Ga0501047_0262456 Ga0501047_0262456_49_456 135
268 3300049581 Ga0501047_0765255 Ga0501047_0765255_34_441 135
269 3300049581 Ga0501047_1175934 Ga0501047_1175934_40_447 135
270 3300049582 Ga0501048_0346236 Ga0501048_0346236_602_1009 135
271 3300049584 Ga0501068_0032975 Ga0501068_0032975_191_598 135
272 3300049584 Ga0501068_0113837 Ga0501068_0113837_1026_1433 135
273 3300049585 Ga0501069_0000012 Ga0501069_0000012_54209_54616 135
274 3300049585 Ga0501069_0095962 Ga0501069_0095962_177_584 135
275 3300049585 Ga0501069_0221294 Ga0501069_0221294_515_922 135
276 3300049585 Ga0501069_0245788 Ga0501069_0245788_324_731 135
277 3300049586 Ga0501070_0000329 Ga0501070_0000329_4585_4992 135
278 3300049586 Ga0501070_0000655 Ga0501070_0000655_26551_26958 135
279 3300049586 Ga0501070_0043367 Ga0501070_0043367_1340_1747 135
280 3300049586 Ga0501070_0063031 Ga0501070_0063031_2627_3034 135
281 3300049586 Ga0501070_0087397 Ga0501070_0087397_1735_2142 135
282 3300049586 Ga0501070_0245087 Ga0501070_0245087_371_778 135
283 3300049586 Ga0501070_0543593 Ga0501070_0543593_250_657 135
284 3300049586 Ga0501070_0775681 Ga0501070_0775681_28_435 135
285 3300049587 Ga0501071_0005903 Ga0501071_0005903_1679_2086 135
286 3300049589 Ga0501073_0040779 Ga0501073_0040779_314_721 135
287 3300049590 Ga0501074_0000018 Ga0501074_0000018_54210_54617 135
288 3300049590 Ga0501074_0200331 Ga0501074_0200331_483_890 135
289 3300049741 Ga0501079_0399577 Ga0501079_0399577_325_732 135
290 3300049742 Ga0501080_0000558 Ga0501080_0000558_22206_22613 135
291 3300049742 Ga0501080_0004527 Ga0501080_0004527_11688_12095 135
292 3300049742 Ga0501080_0364021 Ga0501080_0364021_633_1040 135
293 3300049742 Ga0501080_0422900 Ga0501080_0422900_366_773 135
294 3300049744 Ga0501083_0001735 Ga0501083_0001735_12196_12603 135
295 3300049822 Ga0501035_0000039 Ga0501035_0000039_102125_102532 135
296 3300049822 Ga0501035_0001538 Ga0501035_0001538_18328_18735 135
297 3300049822 Ga0501035_0036028 Ga0501035_0036028_2717_3124 135
298 3300049822 Ga0501035_0160469 Ga0501035_0160469_1464_1871 135
299 3300049822 Ga0501035_0464228 Ga0501035_0464228_335_742 135
300 3300049822 Ga0501035_0706987 Ga0501035_0706987_376_783 135
301 3300049822 Ga0501035_1569545 Ga0501035_1569545_36_443 135
302 3300049823 Ga0501044_0000047 Ga0501044_0000047_54372_54779 135
303 3300049823 Ga0501044_0027020 Ga0501044_0027020_5008_5415 135
304 3300049823 Ga0501044_0309508 Ga0501044_0309508_751_1158 135
305 3300049823 Ga0501044_0320199 Ga0501044_0320199_882_1289 135
306 3300049823 Ga0501044_0391550 Ga0501044_0391550_92_499 135
307 3300050510 nmdc:mga06r32_453876_c1 nmdc:mga06r32_453876_c1_74_481 135
308 3300053080 Ga0500635_0121438 Ga0500635_0121438_126_533 135
309 3300053091 Ga0500647_0206325 Ga0500647_0206325_244_651 135
310 3300053140 Ga0500573_0245750 Ga0500573_0245750_487_894 135
311 3300053148 Ga0500590_151002 Ga0500590_151002_166_573 135
312 3300053153 Ga0500616_0106293 Ga0500616_0106293_29_436 135
313 3300053163 Ga0500639_177118 Ga0500639_177118_124_531 135
314 3300053177 Ga0500636_0192514 Ga0500636_0192514_38_445 135
315 3300053178 Ga0500637_0292511 Ga0500637_0292511_202_609 135
316 3300053728 Ga0500657_126445 Ga0500657_126445_458_865 135
317 3300053733 Ga0500552_011538 Ga0500552_011538_573_980 135
318 3300060353 Ga0501082_0059465 Ga0501082_0059465_2705_3112 135
319 3300005364 Ga0070673_102247738 Ga0070673_1022477381 136
320 3300005434 Ga0070709_10424030 Ga0070709_104240302 136
321 3300005435 Ga0070714_100638358 Ga0070714_1006383582 136
322 3300005435 Ga0070714_100750323 Ga0070714_1007503232 136
323 3300005436 Ga0070713_100604108 Ga0070713_1006041082 136
324 3300005437 Ga0070710_10105820 Ga0070710_101058203 136
325 3300005439 Ga0070711_100289651 Ga0070711_1002896512 136
326 3300005439 Ga0070711_100877482 Ga0070711_1008774822 136
327 3300005445 Ga0070708_100019926 Ga0070708_1000199263 136
328 3300005455 Ga0070663_100444241 Ga0070663_1004442411 136
329 3300005467 Ga0070706_100092898 Ga0070706_1000928982 136
330 3300005468 Ga0070707_100059833 Ga0070707_1000598333 136
331 3300005471 Ga0070698_100157368 Ga0070698_1001573683 136
332 3300005547 Ga0070693_100061872 Ga0070693_1000618722 136
333 3300005614 Ga0068856_100738472 Ga0068856_1007384722 136
334 3300005614 Ga0068856_100746008 Ga0068856_1007460082 136
335 3300006028 Ga0070717_10037010 Ga0070717_100370105 136
336 3300006028 Ga0070717_10482398 Ga0070717_104823982 136
337 3300006173 Ga0070716_100193632 Ga0070716_1001936322 136
338 3300006914 Ga0075436_100291631 Ga0075436_1002916312 136
339 3300009177 Ga0105248_10072987 Ga0105248_100729872 136
340 3300013307 Ga0157372_10447832 Ga0157372_104478325 136
341 3300025898 Ga0207692_10038842 Ga0207692_100388423 136
342 3300025910 Ga0207684_10474653 Ga0207684_104746532 136
343 3300025915 Ga0207693_10183648 Ga0207693_101836482 136
344 3300025928 Ga0207700_10362406 Ga0207700_103624062 136
345 3300025929 Ga0207664_10329018 Ga0207664_103290182 136
346 3300026078 Ga0207702_11145346 Ga0207702_111453461 136
347 3300037471 Ga0395905_0001846 Ga0395905_0001846_22098_22508 136
348 3300046460 Ga0495638_0265436 Ga0495638_0265436_261_671 136
349 3300053090 Ga0500646_0101040 Ga0500646_0101040_249_659 136
350 3300053158 Ga0500627_0089214 Ga0500627_0089214_178_588 136
351 3300054114 Ga0501084_0000366 Ga0501084_0000366_6940_7350 136
352 3300003790 Ga0055528_1011911 Ga0055528_10119113 137
353 3300005548 Ga0070665_100030856 Ga0070665_1000308563 137
354 3300005844 Ga0068862_101493887 Ga0068862_1014938871 137
355 3300006038 Ga0075365_10755475 Ga0075365_107554752 137
356 3300006048 Ga0075363_100309394 Ga0075363_1003093941 137
357 3300006353 Ga0075370_10634524 Ga0075370_106345242 137
358 3300009148 Ga0105243_11028719 Ga0105243_110287192 137
359 3300009176 Ga0105242_11079674 Ga0105242_110796742 137
360 3300028379 Ga0268266_10011981 Ga0268266_100119812 137
361 3300031456 Ga0307513_10559608 Ga0307513_105596082 137
362 3300038741 Ga0400488_24119 Ga0400488_24119_3208_3621 137
363 3300038742 Ga0400486_24201 Ga0400486_24201_490_903 137
364 3300039062 Ga0400483_111354 Ga0400483_111354_652_1074 137
365 3300041486 Ga0451807_0456072 Ga0451807_0456072_73_486 137
366 3300041498 Ga0451841_0111470 Ga0451841_0111470_139_552 137
367 3300046519 Ga0495632_0416194 Ga0495632_0416194_115_528 137
368 3300047472 Ga0495686_0190409 Ga0495686_0190409_105_518 137
369 3300049586 Ga0501070_0384917 Ga0501070_0384917_132_548 137
370 3300050496 nmdc:mga07m45_578298_c1 nmdc:mga07m45_578298_c1_48_461 137
371 3300053134 Ga0500658_0184709 Ga0500658_0184709_198_611 137
372 3300053151 Ga0500604_0054459 Ga0500604_0054459_366_779 137
373 3300005345 Ga0070692_10005051 Ga0070692_100050515 138
374 3300005458 Ga0070681_11252792 Ga0070681_112527922 138
375 3300009093 Ga0105240_10769100 Ga0105240_107691003 138
376 3300013296 Ga0157374_10141730 Ga0157374_101417303 138
377 3300013308 Ga0157375_10620468 Ga0157375_106204683 138
378 3300025981 Ga0207640_10902589 Ga0207640_109025892 138
379 3300049569 Ga0501032_0054520 Ga0501032_0054520_1662_2117 138
380 3300049579 Ga0501043_0160006 Ga0501043_0160006_195_650 138
381 3300049581 Ga0501047_0024606 Ga0501047_0024606_1254_1709 138
382 3300049585 Ga0501069_0046868 Ga0501069_0046868_707_1162 138
383 3300049586 Ga0501070_0002286 Ga0501070_0002286_13893_14348 138
384 3300049587 Ga0501071_0129491 Ga0501071_0129491_474_929 138
385 3300049589 Ga0501073_0107797 Ga0501073_0107797_551_1006 138
386 3300049742 Ga0501080_0377645 Ga0501080_0377645_503_958 138
387 3300049822 Ga0501035_0005458 Ga0501035_0005458_2833_3288 138
388 3300049823 Ga0501044_0016976 Ga0501044_0016976_3136_3591 138
389 3300049824 Ga0501045_0347604 Ga0501045_0347604_608_1030 138
390 3300005356 Ga0070674_100251160 Ga0070674_1002511602 139
391 3300005367 Ga0070667_101969062 Ga0070667_1019690621 139
392 3300005719 Ga0068861_101907716 Ga0068861_1019077162 139
393 3300005841 Ga0068863_100304919 Ga0068863_1003049192 139
394 3300009176 Ga0105242_10033166 Ga0105242_100331663 139
395 3300013308 Ga0157375_11003684 Ga0157375_110036842 139
396 3300014326 Ga0157380_10361919 Ga0157380_103619193 139
397 3300020080 Ga0206350_10214382 Ga0206350_102143822 139
398 3300025934 Ga0207686_10006882 Ga0207686_100068826 139
399 3300026118 Ga0207675_101797456 Ga0207675_1017974561 139
400 3300031250 Ga0265331_10133772 Ga0265331_101337722 139
401 3300031251 Ga0265327_10062220 Ga0265327_100622203 139
402 3300037418 Ga0395900_1371902 Ga0395900_1371902_76_495 139
403 3300053111 Ga0500572_236113 Ga0500572_236113_55_474 139
404 3300053177 Ga0500636_0034801 Ga0500636_0034801_154_573 139
405 3300002987 JGI25159J45721_1012472 JGI25159J45721_10124724 140
406 3300003354 JGI25160J50197_1020124 JGI25160J50197_10201244 140
407 3300005262 Ga0065165_1054431 Ga0065165_10544313 140
408 3300005435 Ga0070714_100109861 Ga0070714_1001098615 140
409 3300005436 Ga0070713_100066871 Ga0070713_1000668715 140
410 3300005436 Ga0070713_100355127 Ga0070713_1003551274 140
411 3300005439 Ga0070711_100125632 Ga0070711_1001256321 140
412 3300005467 Ga0070706_100498760 Ga0070706_1004987603 140
413 3300005468 Ga0070707_100416089 Ga0070707_1004160892 140
414 3300005471 Ga0070698_100106383 Ga0070698_1001063831 140
415 3300005518 Ga0070699_100668274 Ga0070699_1006682743 140
416 3300005530 Ga0070679_100272088 Ga0070679_1002720883 140
417 3300006028 Ga0070717_10194807 Ga0070717_101948072 140
418 3300013105 Ga0157369_10098973 Ga0157369_100989733 140
419 3300020069 Ga0197907_11512887 Ga0197907_115128872 140
420 3300021377 Ga0213874_10309167 Ga0213874_103091671 140
421 3300025284 Ga0209130_1000793 Ga0209130_100079316 140
422 3300025294 Ga0209025_1038403 Ga0209025_10384032 140
423 3300025302 Ga0207426_1000179 Ga0207426_100017976 140
424 3300025910 Ga0207684_10076779 Ga0207684_100767792 140
425 3300025910 Ga0207684_10430306 Ga0207684_104303062 140
426 3300025915 Ga0207693_10035833 Ga0207693_100358333 140
427 3300025916 Ga0207663_10145839 Ga0207663_101458391 140
428 3300025922 Ga0207646_10350447 Ga0207646_103504472 140
429 3300025923 Ga0207681_11410958 Ga0207681_114109582 140
430 3300025928 Ga0207700_10063303 Ga0207700_100633036 140
431 3300025928 Ga0207700_10243113 Ga0207700_102431132 140
432 3300026078 Ga0207702_10462184 Ga0207702_104621842 140
433 3300026116 Ga0207674_11359190 Ga0207674_113591901 140
434 3300028800 Ga0265338_10009317 Ga0265338_100093174 140
435 3300028800 Ga0265338_10242429 Ga0265338_102424292 140
436 3300031616 Ga0307508_10361256 Ga0307508_103612562 140
437 3300037466 Ga0395898_1127106 Ga0395898_1127106_104_532 140
438 3300039453 Ga0436362_1301255 Ga0436362_1301255_272_697 140
439 3300045836 Ga0466958_0394784 Ga0466958_0394784_320_778 140
440 3300045976 Ga0466967_2521095 Ga0466967_2521095_27_482 140
441 3300049581 Ga0501047_0383258 Ga0501047_0383258_451_876 140
442 3300049823 Ga0501044_0111970 Ga0501044_0111970_462_887 140
443 3300053724 Ga0500570_104290 Ga0500570_104290_632_1054 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

19

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5sv2-assembly1.cif.gz_A-2 toxin vapc21 from mycobacterium tuberculosis 0.7873 1 131
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.7751 2 133
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7728 4 133
5ed0-assembly2.cif.gz_B structure of the shigella flexneri vapc mutant d7n 0.7719 1 133
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7718 2 133
ID Description Score Start End Superfamily
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8191 1 133 3.40.50.1010
5sv2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7874 1 131 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7867 4 131 3.40.50.1010
af_L0T5V6_2_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7767 1 133 3.40.50.1010
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7708 41 134 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A5Q4G861-F1-model_v4 PIN domain-containing protein 0.9974 1 134 GO:0004518
GO:0046872
AF-A0A833GBT0-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9959 1 134 GO:0004518
GO:0046872
AF-A0A557YKD1-F1-model_v4 deleted 0.9928 2 134
AF-A0A7G6SRS8-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9925 2 134 GO:0004518
GO:0046872
AF-A0A2U2DW85-F1-model_v4 DNA-binding protein 0.9909 2 135 GO:0003677
GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map