F444823

General Info

Members Datasets Scaffolds Average Seq Length
442 226 884 256

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100157443|Ga0070660_1001574432
Length 288
Sequence MTRASGTASARVPIATLSPPGRGRRTARAAAARLWIGVATFGVLFVAWYALTTLTHTISPGRFPAPAEVWDALVQINVAGYADARLWQHVLHSVKLVLLGFFAAILVGVPLGLAMGASRAFEAFINPPFLLLRPIPPLAWIPLAIVWLGLGDAAKVLIIWFAAFVPAVINSYSGVRAIEPHLVEAARMLGVPRRLFVREVLIPGAMPMIFTGLRLSLQACWTTLVAGELIGAIAGLGHVLYQASLDIFPAMIVVGMAAVAMTGAVMTLALGWLERRAMPWVAARGGRG

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
226 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.75
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 6.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100157443 3300005339 Bacteria 1829
2 Ga0065715_10158824 3300005293 Bacteria 1649
3 Ga0070658_10023848 3300005327 Bacteria 4908
4 Ga0070658_10068631 3300005327 Bacteria 2899
5 Ga0070658_10116896 3300005327 Bacteria 2214
6 Ga0070676_10011579 3300005328 Bacteria 4797
7 Ga0070676_10056312 3300005328 Bacteria 2323
8 Ga0070690_100018659 3300005330 Bacteria 4193
9 Ga0070690_100453232 3300005330 Bacteria 952
10 Ga0070670_100000356 3300005331 Bacteria 38360
11 Ga0070670_100001266 3300005331 Bacteria 20137
12 Ga0070670_100020479 3300005331 Bacteria 5686
13 Ga0070670_100070650 3300005331 Bacteria 2997
14 Ga0070670_100119446 3300005331 Bacteria 2274
15 Ga0070670_100144545 3300005331 Unclassified 2057
16 Ga0070677_10012316 3300005333 Bacteria 2969
17 Ga0068869_100147902 3300005334 Bacteria 1819
18 Ga0068869_100375205 3300005334 Bacteria 1164
19 Ga0070680_100308843 3300005336 Bacteria 1341
20 Ga0068868_100150744 3300005338 Bacteria 1915
21 Ga0068868_100238280 3300005338 Bacteria 1528
22 Ga0070660_100000853 3300005339 Bacteria 20293
23 Ga0070660_100140866 3300005339 Bacteria 1935
24 Ga0070660_100142492 3300005339 Bacteria 1924
25 Ga0070689_100469792 3300005340 Unclassified 1073
26 Ga0070687_100142541 3300005343 Bacteria 1397
27 Ga0070687_100153648 3300005343 Bacteria 1353
28 Ga0070661_100007062 3300005344 Bacteria 7747
29 Ga0070661_100295669 3300005344 Bacteria 1259
30 Ga0070661_100505113 3300005344 Unclassified 968
31 Ga0070668_100015208 3300005347 Bacteria 5750
32 Ga0070668_100244665 3300005347 Bacteria 1487
33 Ga0070668_100244712 3300005347 Bacteria 1487
34 Ga0070669_100058322 3300005353 Bacteria 2833
35 Ga0070669_100241243 3300005353 Unclassified 1436
36 Ga0070669_100247828 3300005353 Bacteria 1417
37 Ga0070669_100329887 3300005353 Bacteria 1234
38 Ga0070675_100037580 3300005354 Bacteria 3945
39 Ga0070675_100052817 3300005354 Bacteria 3342
40 Ga0070675_100305830 3300005354 Bacteria 1402
41 Ga0070671_100004994 3300005355 Bacteria 10571
42 Ga0070671_100120160 3300005355 Unclassified 2210
43 Ga0070671_100543734 3300005355 Bacteria 1001
44 Ga0070674_100044938 3300005356 Bacteria 3015
45 Ga0070674_100093047 3300005356 Bacteria 2180
46 Ga0070674_100442504 3300005356 Bacteria 1071
47 Ga0070673_100027607 3300005364 Bacteria 4210
48 Ga0070673_100033355 3300005364 Bacteria 3887
49 Ga0070673_100044289 3300005364 Bacteria 3445
50 Ga0070673_100274378 3300005364 Unclassified 1477
51 Ga0070688_100025660 3300005365 Bacteria 3491
52 Ga0070688_100080101 3300005365 Bacteria 2111
53 Ga0070659_100001250 3300005366 Bacteria 18454
54 Ga0070659_100050567 3300005366 Bacteria 3267
55 Ga0070659_100316814 3300005366 Bacteria 1303
56 Ga0070659_100424627 3300005366 Bacteria 1125
57 Ga0070667_100044748 3300005367 Bacteria 3719
58 Ga0070667_100067463 3300005367 Bacteria 3042
59 Ga0070667_100229775 3300005367 Bacteria 1654
60 Ga0070667_100254673 3300005367 Bacteria 1570
61 Ga0070714_100728489 3300005435 Bacteria 958
62 Ga0070713_100000020 3300005436 Bacteria 108930
63 Ga0070713_100350934 3300005436 Bacteria 1369
64 Ga0070701_10026604 3300005438 Bacteria 2823
65 Ga0070701_10247234 3300005438 Unclassified 1075
66 Ga0070711_100214753 3300005439 Bacteria 1492
67 Ga0070711_100259065 3300005439 Bacteria 1367
68 Ga0070705_100115265 3300005440 Bacteria 1725
69 Ga0070700_100037403 3300005441 Bacteria 2951
70 Ga0070700_100078401 3300005441 Bacteria 2127
71 Ga0070694_100104986 3300005444 Bacteria 2005
72 Ga0070694_100289734 3300005444 Bacteria 1251
73 Ga0070663_100006817 3300005455 Bacteria 6906
74 Ga0070663_100748834 3300005455 Bacteria 834
75 Ga0070678_100018143 3300005456 Bacteria 4555
76 Ga0070678_100142449 3300005456 Bacteria 1920
77 Ga0070678_100239285 3300005456 Unclassified 1517
78 Ga0070678_100292650 3300005456 Bacteria 1381
79 Ga0070662_100000743 3300005457 Bacteria 19966
80 Ga0070662_100235229 3300005457 Bacteria 1467
81 Ga0070662_100254965 3300005457 Bacteria 1412
82 Ga0070662_100265379 3300005457 Bacteria 1384
83 Ga0070681_10011907 3300005458 Bacteria 8626
84 Ga0070681_10076132 3300005458 Bacteria 3315
85 Ga0068867_100045826 3300005459 Bacteria 3209
86 Ga0068867_100072839 3300005459 Bacteria 2572
87 Ga0070685_10015648 3300005466 Bacteria 4032
88 Ga0070699_100224085 3300005518 Bacteria 1676
89 Ga0070699_100261914 3300005518 Bacteria 1546
90 Ga0070679_100013769 3300005530 Bacteria 7750
91 Ga0070679_100052340 3300005530 Bacteria 4068
92 Ga0070679_100220074 3300005530 Bacteria 1860
93 Ga0070679_100297518 3300005530 Bacteria 1565
94 Ga0070684_100048923 3300005535 Bacteria 3668
95 Ga0068853_100020799 3300005539 Bacteria 5459
96 Ga0068853_100214636 3300005539 Bacteria 1755
97 Ga0068853_100568634 3300005539 Bacteria 1075
98 Ga0070672_100082219 3300005543 Bacteria 2584
99 Ga0070672_100126699 3300005543 Bacteria 2095
100 Ga0070686_100024132 3300005544 Bacteria 3642
101 Ga0070695_100050971 3300005545 Bacteria 2654
102 Ga0070695_100302369 3300005545 Bacteria 1183
103 Ga0070696_100001787 3300005546 Bacteria 14090
104 Ga0070696_100060819 3300005546 Unclassified 2642
105 Ga0070696_100342280 3300005546 Bacteria 1156
106 Ga0070696_100354899 3300005546 Bacteria 1136
107 Ga0070693_100071538 3300005547 Bacteria 2044
108 Ga0070665_100055140 3300005548 Bacteria 3986
109 Ga0070665_100252122 3300005548 Bacteria 1766
110 Ga0070665_100258647 3300005548 Bacteria 1742
111 Ga0070704_100002572 3300005549 Bacteria 10232
112 Ga0070704_100198219 3300005549 Bacteria 1619
113 Ga0068855_100000596 3300005563 Bacteria 44278
114 Ga0068855_100048108 3300005563 Bacteria 5035
115 Ga0068855_100104039 3300005563 Bacteria 3266
116 Ga0068855_100297614 3300005563 Bacteria 1788
117 Ga0068855_100401578 3300005563 Bacteria 1502
118 Ga0068855_100487657 3300005563 Bacteria 1341
119 Ga0070664_100020855 3300005564 Bacteria 5398
120 Ga0070664_100021539 3300005564 Bacteria 5315
121 Ga0070664_100049635 3300005564 Bacteria 3549
122 Ga0070664_100298243 3300005564 Unclassified 1456
123 Ga0070664_100333797 3300005564 Bacteria 1376
124 Ga0068857_100164186 3300005577 Bacteria 2016
125 Ga0068857_100193349 3300005577 Bacteria 1853
126 Ga0068857_100374775 3300005577 Bacteria 1321
127 Ga0068854_100011456 3300005578 Bacteria 5777
128 Ga0068854_100047715 3300005578 Bacteria 3053
129 Ga0068854_100100497 3300005578 Bacteria 2168
130 Ga0068856_100006376 3300005614 Bacteria 11575
131 Ga0068856_100030251 3300005614 Bacteria 5294
132 Ga0068856_100033634 3300005614 Bacteria 5020
133 Ga0068856_100171761 3300005614 Bacteria 2180
134 Ga0068856_100337970 3300005614 Bacteria 1524
135 Ga0070702_100219368 3300005615 Bacteria 1271
136 Ga0068852_100004918 3300005616 Bacteria 9484
137 Ga0068852_100021971 3300005616 Bacteria 5107
138 Ga0068852_100064541 3300005616 Bacteria 3192
139 Ga0068859_100022726 3300005617 Bacteria 6288
140 Ga0068859_100058627 3300005617 Bacteria 3878
141 Ga0068864_100001742 3300005618 Bacteria 17878
142 Ga0068864_100028082 3300005618 Bacteria 4755
143 Ga0068864_100063039 3300005618 Bacteria 3213
144 Ga0068861_100014823 3300005719 Bacteria 5477
145 Ga0068861_100019436 3300005719 Bacteria 4853
146 Ga0068861_100366957 3300005719 Bacteria 1268
147 Ga0068851_10009318 3300005834 Bacteria 4559
148 Ga0068851_10148426 3300005834 Bacteria 1280
149 Ga0068870_10047552 3300005840 Bacteria 2256
150 Ga0068870_10062709 3300005840 Bacteria 2003
151 Ga0068863_100003719 3300005841 Bacteria 15086
152 Ga0068863_100161384 3300005841 Bacteria 2147
153 Ga0068858_100035782 3300005842 Bacteria 4604
154 Ga0068858_100132538 3300005842 Unclassified 2337
155 Ga0068858_100165516 3300005842 Bacteria 2083
156 Ga0068858_100179589 3300005842 Unclassified 1998
157 Ga0068860_100291778 3300005843 Unclassified 1596
158 Ga0068862_100170282 3300005844 Bacteria 1949
159 Ga0068862_100559408 3300005844 Bacteria 1093
160 Ga0068862_100570716 3300005844 Bacteria 1083
161 Ga0081539_10001912 3300005985 Bacteria 32258
162 Ga0070712_100044799 3300006175 Bacteria 3052
163 Ga0097621_100194750 3300006237 Bacteria 1757
164 Ga0097621_100498750 3300006237 Bacteria 1102
165 Ga0068871_100047381 3300006358 Bacteria 3466
166 Ga0075428_100039732 3300006844 Bacteria 5178
167 Ga0075428_100208422 3300006844 Bacteria 2112
168 Ga0075430_100407316 3300006846 Bacteria 1122
169 Ga0075433_10518761 3300006852 Bacteria 1048
170 Ga0075436_100010637 3300006914 Bacteria 6310
171 Ga0075436_100037803 3300006914 Bacteria 3333
172 Ga0097620_100022724 3300006931 Bacteria 6288
173 Ga0097620_100058624 3300006931 Bacteria 3878
174 Ga0075435_100170689 3300007076 Bacteria 1835
175 Ga0075435_100225018 3300007076 Bacteria 1593
176 Ga0075435_100419985 3300007076 Bacteria 1152
177 Ga0105251_10102181 3300009011 Unclassified 1310
178 Ga0105240_10018471 3300009093 Bacteria 9360
179 Ga0105240_10089616 3300009093 Bacteria 3762
180 Ga0105240_10313477 3300009093 Bacteria 1790
181 Ga0105245_10041970 3300009098 Bacteria 4080
182 Ga0114129_10237195 3300009147 Bacteria 2453
183 Ga0114129_10701398 3300009147 Unclassified 1301
184 Ga0105242_10035629 3300009176 Bacteria 3990
185 Ga0105248_10045830 3300009177 Bacteria 4902
186 Ga0105248_10060386 3300009177 Bacteria 4256
187 Ga0105248_10749766 3300009177 Bacteria 1102
188 Ga0105237_10048910 3300009545 Bacteria 4251
189 Ga0105238_10014121 3300009551 Bacteria 8076
190 Ga0105238_10474891 3300009551 Bacteria 1249
191 Ga0105238_10775315 3300009551 Bacteria 974
192 Ga0105249_10076189 3300009553 Bacteria 3108
193 Ga0105249_10250678 3300009553 Bacteria 1755
194 Ga0105239_10891008 3300010375 Bacteria 1021
195 Ga0157373_10001644 3300013100 Bacteria 17070
196 Ga0157373_10168486 3300013100 Bacteria 1541
197 Ga0157371_10001047 3300013102 Bacteria 30349
198 Ga0157370_10010656 3300013104 Bacteria 9676
199 Ga0157370_10028554 3300013104 Bacteria 5486
200 Ga0157370_10083450 3300013104 Bacteria 3004
201 Ga0157370_10522022 3300013104 Bacteria 1090
202 Ga0157369_10002279 3300013105 Bacteria 23079
203 Ga0157369_10048263 3300013105 Bacteria 4620
204 Ga0157369_10539989 3300013105 Bacteria 1205
205 Ga0157369_10583575 3300013105 Bacteria 1154
206 Ga0157374_10023006 3300013296 Bacteria 5566
207 Ga0157378_10029136 3300013297 Bacteria 4873
208 Ga0163162_10043324 3300013306 Bacteria 4506
209 Ga0163162_10102889 3300013306 Bacteria 2950
210 Ga0163162_10580997 3300013306 Unclassified 1247
211 Ga0163162_10668640 3300013306 Bacteria 1162
212 Ga0157372_10003409 3300013307 Bacteria 17153
213 Ga0157372_10005089 3300013307 Bacteria 13979
214 Ga0157372_10013966 3300013307 Bacteria 8581
215 Ga0157372_10021378 3300013307 Bacteria 6991
216 Ga0157372_10063844 3300013307 Bacteria 4131
217 Ga0157372_10076831 3300013307 Bacteria 3771
218 Ga0157375_10016376 3300013308 Bacteria 6658
219 Ga0157375_10226495 3300013308 Bacteria 2028
220 Ga0157375_10817841 3300013308 Bacteria 1080
221 Ga0163163_10001473 3300014325 Bacteria 19921
222 Ga0163163_10031491 3300014325 Bacteria 5119
223 Ga0163163_10060180 3300014325 Bacteria 3760
224 Ga0157380_10026357 3300014326 Bacteria 4413
225 Ga0157380_10046657 3300014326 Bacteria 3404
226 Ga0157380_10051507 3300014326 Bacteria 3256
227 Ga0157380_10218408 3300014326 Bacteria 1704
228 Ga0157380_10282211 3300014326 Bacteria 1520
229 Ga0157376_10099327 3300014969 Bacteria 2539
230 Ga0163161_10070218 3300017792 Bacteria 2561
231 Ga0163161_10163797 3300017792 Bacteria 1697
232 Ga0207697_10002525 3300025315 Bacteria 9433
233 Ga0207642_10054355 3300025899 Bacteria 1826
234 Ga0207688_10074177 3300025901 Bacteria 1934
235 Ga0207647_10043338 3300025904 Bacteria 2817
236 Ga0207699_10194612 3300025906 Bacteria 1370
237 Ga0207699_10280672 3300025906 Bacteria 1157
238 Ga0207645_10011574 3300025907 Bacteria 6015
239 Ga0207643_10002190 3300025908 Bacteria 10658
240 Ga0207643_10050013 3300025908 Bacteria 2370
241 Ga0207705_10481864 3300025909 Bacteria 963
242 Ga0207707_10027434 3300025912 Bacteria 4980
243 Ga0207695_10030785 3300025913 Bacteria 5904
244 Ga0207663_10091090 3300025916 Bacteria 2024
245 Ga0207660_10090800 3300025917 Bacteria 2264
246 Ga0207662_10029560 3300025918 Bacteria 3176
247 Ga0207657_10001180 3300025919 Bacteria 27737
248 Ga0207657_10089727 3300025919 Bacteria 2567
249 Ga0207649_10013618 3300025920 Bacteria 4544
250 Ga0207649_10143242 3300025920 Bacteria 1638
251 Ga0207652_10256327 3300025921 Bacteria 1578
252 Ga0207681_10005501 3300025923 Bacteria 7777
253 Ga0207681_10023632 3300025923 Bacteria 3935
254 Ga0207681_10170312 3300025923 Unclassified 1650
255 Ga0207681_10215159 3300025923 Bacteria 1483
256 Ga0207681_10228707 3300025923 Bacteria 1442
257 Ga0207694_10514318 3300025924 Unclassified 1003
258 Ga0207650_10000755 3300025925 Bacteria 24847
259 Ga0207650_10003114 3300025925 Bacteria 11426
260 Ga0207650_10004774 3300025925 Bacteria 9259
261 Ga0207650_10007706 3300025925 Bacteria 7337
262 Ga0207659_10016211 3300025926 Bacteria 4845
263 Ga0207659_10017772 3300025926 Bacteria 4650
264 Ga0207659_10019507 3300025926 Bacteria 4466
265 Ga0207700_10000086 3300025928 Bacteria 58118
266 Ga0207700_10661737 3300025928 Bacteria 931
267 Ga0207664_10075295 3300025929 Bacteria 2728
268 Ga0207644_10006858 3300025931 Bacteria 7420
269 Ga0207644_10015129 3300025931 Bacteria 5175
270 Ga0207644_10472426 3300025931 Bacteria 1032
271 Ga0207690_10000937 3300025932 Bacteria 18676
272 Ga0207690_10043983 3300025932 Bacteria 2942
273 Ga0207690_10122646 3300025932 Bacteria 1890
274 Ga0207690_10418490 3300025932 Bacteria 1072
275 Ga0207706_10000144 3300025933 Bacteria 76997
276 Ga0207706_10075873 3300025933 Bacteria 2957
277 Ga0207706_10129522 3300025933 Bacteria 2219
278 Ga0207686_10067524 3300025934 Bacteria 2288
279 Ga0207670_10162439 3300025936 Bacteria 1668
280 Ga0207670_10344181 3300025936 Unclassified 1179
281 Ga0207704_10072418 3300025938 Bacteria 2190
282 Ga0207665_10376756 3300025939 Bacteria 1076
283 Ga0207691_10163906 3300025940 Bacteria 1949
284 Ga0207691_10169152 3300025940 Bacteria 1914
285 Ga0207691_10189959 3300025940 Bacteria 1791
286 Ga0207711_10001814 3300025941 Bacteria 19514
287 Ga0207711_10031395 3300025941 Bacteria 4484
288 Ga0207711_10073518 3300025941 Bacteria 2971
289 Ga0207689_10002758 3300025942 Bacteria 16247
290 Ga0207689_10006317 3300025942 Bacteria 10497
291 Ga0207679_10018487 3300025945 Bacteria 4670
292 Ga0207679_10028608 3300025945 Bacteria 3870
293 Ga0207679_10034409 3300025945 Bacteria 3574
294 Ga0207667_10013736 3300025949 Bacteria 9255
295 Ga0207667_10051369 3300025949 Bacteria 4347
296 Ga0207667_10062792 3300025949 Bacteria 3883
297 Ga0207651_10256967 3300025960 Bacteria 1432
298 Ga0207712_10117431 3300025961 Bacteria 2006
299 Ga0207712_10398008 3300025961 Unclassified 1157
300 Ga0207668_10020268 3300025972 Bacteria 4221
301 Ga0207668_10220705 3300025972 Bacteria 1522
302 Ga0207640_10021532 3300025981 Bacteria 3844
303 Ga0207640_10100067 3300025981 Bacteria 2030
304 Ga0207640_10466976 3300025981 Bacteria 1044
305 Ga0207658_10084026 3300025986 Bacteria 2449
306 Ga0207658_10218968 3300025986 Bacteria 1600
307 Ga0207658_10822831 3300025986 Unclassified 844
308 Ga0207703_10374423 3300026035 Unclassified 1316
309 Ga0207639_10007370 3300026041 Bacteria 7500
310 Ga0207639_10405512 3300026041 Bacteria 1229
311 Ga0207678_10006255 3300026067 Bacteria 10576
312 Ga0207678_10014916 3300026067 Bacteria 6835
313 Ga0207708_10012680 3300026075 Bacteria 6284
314 Ga0207708_10081780 3300026075 Bacteria 2483
315 Ga0207702_10065015 3300026078 Bacteria 3123
316 Ga0207702_10247433 3300026078 Bacteria 1673
317 Ga0207702_10406587 3300026078 Bacteria 1314
318 Ga0207702_10426204 3300026078 Unclassified 1283
319 Ga0207641_10006823 3300026088 Bacteria 9563
320 Ga0207641_10144363 3300026088 Bacteria 2151
321 Ga0207648_10020140 3300026089 Bacteria 6014
322 Ga0207648_10104055 3300026089 Bacteria 2489
323 Ga0207648_10506786 3300026089 Bacteria 1105
324 Ga0207676_10010597 3300026095 Bacteria 6570
325 Ga0207676_10018370 3300026095 Bacteria 5081
326 Ga0207676_10229534 3300026095 Bacteria 1658
327 Ga0207674_10008990 3300026116 Bacteria 11479
328 Ga0207674_10105784 3300026116 Bacteria 2792
329 Ga0207674_10152917 3300026116 Bacteria 2264
330 Ga0207675_100020409 3300026118 Bacteria 6175
331 Ga0207675_100025794 3300026118 Bacteria 5469
332 Ga0207675_100036569 3300026118 Bacteria 4580
333 Ga0207683_10011451 3300026121 Bacteria 7570
334 Ga0207683_10066053 3300026121 Bacteria 3189
335 Ga0207683_10075996 3300026121 Bacteria 2974
336 Ga0207683_10303437 3300026121 Bacteria 1461
337 Ga0207698_10003523 3300026142 Bacteria 9437
338 Ga0207698_10018311 3300026142 Bacteria 4770
339 Ga0207698_10505507 3300026142 Unclassified 1177
340 Ga0209971_1002450 3300027682 Bacteria 4463
341 Ga0209966_1002437 3300027695 Bacteria 3105
342 Ga0209998_10014180 3300027717 Bacteria 1662
343 Ga0209974_10006584 3300027876 Bacteria 4045
344 Ga0209974_10007562 3300027876 Bacteria 3740
345 Ga0268266_10026906 3300028379 Bacteria 4893
346 Ga0268265_10034870 3300028380 Bacteria 3671
347 Ga0268265_10131683 3300028380 Bacteria 2079
348 Ga0268264_10025582 3300028381 Bacteria 4822
349 Ga0268264_10037247 3300028381 Bacteria 4010
350 Ga0268264_10256484 3300028381 Unclassified 1627
351 Ga0265338_10000341 3300028800 Bacteria 84990
352 Ga0307408_100005123 3300031548 Bacteria 8795
353 Ga0307410_10078601 3300031852 Bacteria 2309
354 Ga0307406_10007922 3300031901 Bacteria 5915
355 Ga0307407_10064758 3300031903 Bacteria 2149
356 Ga0307412_10033376 3300031911 Bacteria 3271
357 Ga0307409_100004885 3300031995 Bacteria 7623
358 Ga0307409_100351670 3300031995 Bacteria 1391
359 Ga0307414_10059343 3300032004 Bacteria 2701
360 Ga0307411_10000643 3300032005 Bacteria 12701
361 Ga0307411_10562235 3300032005 Bacteria 975
362 Ga0373938_0039105 3300034957 Bacteria 1048
363 Ga0373923_0052985 3300035111 Bacteria 1706
364 Ga0373955_0032050 3300035172 Bacteria 2756
365 Ga0373931_0007853 3300035691 Bacteria 5044
366 Ga0373931_0105568 3300035691 Bacteria 1591
367 Ga0373927_0072388 3300035695 Bacteria 2231
368 Ga0373933_0152146 3300035724 Bacteria 1466
369 Ga0373937_0036498 3300036401 Bacteria 4479
370 Ga0373925_0054220 3300037068 Bacteria 2998
371 Ga0395899_0087645 3300037312 Bacteria 2259
372 Ga0395900_0029007 3300037418 Bacteria 5675
373 Ga0395898_0028150 3300037466 Bacteria 5635
374 Ga0395905_0016901 3300037471 Bacteria 6931
375 Ga0436364_0565335 3300037853 Bacteria 2026
376 Ga0395901_0059624 3300038443 Bacteria 3971
377 Ga0436361_0897970 3300039447 Unclassified 1877
378 Ga0436363_0455187 3300039450 Unclassified 1079
379 Ga0436362_0033661 3300039453 Bacteria 2166
380 Ga0439441_000128 3300042001 Bacteria 6367
381 Ga0439435_0010293 3300042436 Bacteria 2215
382 Ga0439444_0006111 3300042437 Bacteria 1809
383 Ga0439460_0025065 3300042461 Bacteria 1658
384 Ga0453683_0117895 3300044673 Bacteria 1671
385 Ga0466963_0207148 3300044694 Bacteria 1372
386 Ga0466963_0338102 3300044694 Unclassified 1060
387 Ga0453684_0271629 3300044712 Bacteria 1937
388 Ga0451576_0007549 3300045051 Bacteria 12959
389 Ga0451576_0799468 3300045051 Bacteria 990
390 Ga0495658_0316382 3300046683 Unclassified 989
391 Ga0495686_0004076 3300047472 Bacteria 12197
392 Ga0496102_0005496 3300048905 Bacteria 10755
393 Ga0496102_0140141 3300048905 Bacteria 2267
394 Ga0496102_0405456 3300048905 Bacteria 1281
395 Ga0496102_0451309 3300048905 Bacteria 1206
396 Ga0496104_0007302 3300048907 Bacteria 9751
397 Ga0496105_0092664 3300048908 Bacteria 2495
398 Ga0496106_0002831 3300048909 Bacteria 12867
399 Ga0496107_0006777 3300048910 Bacteria 7884
400 Ga0496107_0043532 3300048910 Bacteria 3226
401 Ga0496108_0003054 3300048911 Bacteria 13457
402 Ga0496108_0158253 3300048911 Bacteria 1957
403 Ga0496109_0021506 3300048912 Bacteria 5704
404 Ga0496109_0498995 3300048912 Bacteria 1149
405 Ga0496109_0720219 3300048912 Bacteria 935
406 Ga0496110_0010236 3300048913 Bacteria 7619
407 Ga0496110_0227833 3300048913 Bacteria 1695
408 Ga0496112_0063485 3300048915 Bacteria 3643
409 Ga0496112_0070830 3300048915 Bacteria 3446
410 Ga0496113_0131387 3300048916 Bacteria 1965
411 Ga0496113_0298501 3300048916 Unclassified 1290
412 Ga0496114_0026105 3300048917 Bacteria 4780
413 Ga0501039_0053697 3300049575 Bacteria 3119
414 Ga0501041_0139895 3300049577 Bacteria 1509
415 Ga0501042_0032616 3300049578 Bacteria 3690
416 Ga0501042_0268462 3300049578 Bacteria 1232
417 Ga0501048_0037859 3300049582 Bacteria 3464
418 Ga0501067_0021418 3300049583 Bacteria 3577
419 Ga0501069_0090978 3300049585 Bacteria 1726
420 Ga0501070_0015001 3300049586 Bacteria 6518
421 Ga0501071_0131863 3300049587 Bacteria 1857
422 Ga0501072_0007021 3300049588 Bacteria 8551
423 Ga0501073_0045149 3300049589 Bacteria 3104
424 Ga0501079_0093434 3300049741 Bacteria 2331
425 Ga0501079_0562571 3300049741 Bacteria 897
426 Ga0501080_0010726 3300049742 Bacteria 8381
427 Ga0501083_0146278 3300049744 Bacteria 1547
428 Ga0501045_0086066 3300049824 Bacteria 2320
429 nmdc:mga05p37_778480_c1 3300050507 Bacteria 1050
430 nmdc:mga09592_38440_c1 3300050508 Bacteria 4018
431 nmdc:mga0qj67_448261_c1 3300050509 Bacteria 1040
432 nmdc:mga08y16_43193_c1 3300050511 Bacteria 4722
433 nmdc:mga0n895_66495_c1 3300050512 Bacteria 3570
434 nmdc:mga0rr50_153950_c1 3300050513 Bacteria 1861
435 nmdc:mga08x19_126620_c1 3300050514 Bacteria 1716
436 nmdc:mga08x19_16920_c1 3300050514 Bacteria 4455
437 nmdc:mga08x19_243464_c1 3300050514 Bacteria 1240
438 nmdc:mga0a205_82488_c1 3300050515 Bacteria 3105
439 Ga0495601_0098226 3300053077 Bacteria 1890
440 Ga0501082_0277677 3300060353 Bacteria 1458
441 2723876283 2721755763 Bacteria 4464185
442 8003400711 8003400568 Bacteria 5535898
443 Ga0070660_100157443
444 Ga0065715_10158824
445 Ga0070658_10023848
446 Ga0070658_10068631
447 Ga0070658_10116896
448 Ga0070676_10011579
449 Ga0070676_10056312
450 Ga0070690_100018659
451 Ga0070690_100453232
452 Ga0070670_100000356
453 Ga0070670_100001266
454 Ga0070670_100020479
455 Ga0070670_100070650
456 Ga0070670_100119446
457 Ga0070670_100144545
458 Ga0070677_10012316
459 Ga0068869_100147902
460 Ga0068869_100375205
461 Ga0070680_100308843
462 Ga0068868_100150744
463 Ga0068868_100238280
464 Ga0070660_100000853
465 Ga0070660_100140866
466 Ga0070660_100142492
467 Ga0070689_100469792
468 Ga0070687_100142541
469 Ga0070687_100153648
470 Ga0070661_100007062
471 Ga0070661_100295669
472 Ga0070661_100505113
473 Ga0070668_100015208
474 Ga0070668_100244665
475 Ga0070668_100244712
476 Ga0070669_100058322
477 Ga0070669_100241243
478 Ga0070669_100247828
479 Ga0070669_100329887
480 Ga0070675_100037580
481 Ga0070675_100052817
482 Ga0070675_100305830
483 Ga0070671_100004994
484 Ga0070671_100120160
485 Ga0070671_100543734
486 Ga0070674_100044938
487 Ga0070674_100093047
488 Ga0070674_100442504
489 Ga0070673_100027607
490 Ga0070673_100033355
491 Ga0070673_100044289
492 Ga0070673_100274378
493 Ga0070688_100025660
494 Ga0070688_100080101
495 Ga0070659_100001250
496 Ga0070659_100050567
497 Ga0070659_100316814
498 Ga0070659_100424627
499 Ga0070667_100044748
500 Ga0070667_100067463
501 Ga0070667_100229775
502 Ga0070667_100254673
503 Ga0070714_100728489
504 Ga0070713_100000020
505 Ga0070713_100350934
506 Ga0070701_10026604
507 Ga0070701_10247234
508 Ga0070711_100214753
509 Ga0070711_100259065
510 Ga0070705_100115265
511 Ga0070700_100037403
512 Ga0070700_100078401
513 Ga0070694_100104986
514 Ga0070694_100289734
515 Ga0070663_100006817
516 Ga0070663_100748834
517 Ga0070678_100018143
518 Ga0070678_100142449
519 Ga0070678_100239285
520 Ga0070678_100292650
521 Ga0070662_100000743
522 Ga0070662_100235229
523 Ga0070662_100254965
524 Ga0070662_100265379
525 Ga0070681_10011907
526 Ga0070681_10076132
527 Ga0068867_100045826
528 Ga0068867_100072839
529 Ga0070685_10015648
530 Ga0070699_100224085
531 Ga0070699_100261914
532 Ga0070679_100013769
533 Ga0070679_100052340
534 Ga0070679_100220074
535 Ga0070679_100297518
536 Ga0070684_100048923
537 Ga0068853_100020799
538 Ga0068853_100214636
539 Ga0068853_100568634
540 Ga0070672_100082219
541 Ga0070672_100126699
542 Ga0070686_100024132
543 Ga0070695_100050971
544 Ga0070695_100302369
545 Ga0070696_100001787
546 Ga0070696_100060819
547 Ga0070696_100342280
548 Ga0070696_100354899
549 Ga0070693_100071538
550 Ga0070665_100055140
551 Ga0070665_100252122
552 Ga0070665_100258647
553 Ga0070704_100002572
554 Ga0070704_100198219
555 Ga0068855_100000596
556 Ga0068855_100048108
557 Ga0068855_100104039
558 Ga0068855_100297614
559 Ga0068855_100401578
560 Ga0068855_100487657
561 Ga0070664_100020855
562 Ga0070664_100021539
563 Ga0070664_100049635
564 Ga0070664_100298243
565 Ga0070664_100333797
566 Ga0068857_100164186
567 Ga0068857_100193349
568 Ga0068857_100374775
569 Ga0068854_100011456
570 Ga0068854_100047715
571 Ga0068854_100100497
572 Ga0068856_100006376
573 Ga0068856_100030251
574 Ga0068856_100033634
575 Ga0068856_100171761
576 Ga0068856_100337970
577 Ga0070702_100219368
578 Ga0068852_100004918
579 Ga0068852_100021971
580 Ga0068852_100064541
581 Ga0068859_100022726
582 Ga0068859_100058627
583 Ga0068864_100001742
584 Ga0068864_100028082
585 Ga0068864_100063039
586 Ga0068861_100014823
587 Ga0068861_100019436
588 Ga0068861_100366957
589 Ga0068851_10009318
590 Ga0068851_10148426
591 Ga0068870_10047552
592 Ga0068870_10062709
593 Ga0068863_100003719
594 Ga0068863_100161384
595 Ga0068858_100035782
596 Ga0068858_100132538
597 Ga0068858_100165516
598 Ga0068858_100179589
599 Ga0068860_100291778
600 Ga0068862_100170282
601 Ga0068862_100559408
602 Ga0068862_100570716
603 Ga0081539_10001912
604 Ga0070712_100044799
605 Ga0097621_100194750
606 Ga0097621_100498750
607 Ga0068871_100047381
608 Ga0075428_100039732
609 Ga0075428_100208422
610 Ga0075430_100407316
611 Ga0075433_10518761
612 Ga0075436_100010637
613 Ga0075436_100037803
614 Ga0097620_100022724
615 Ga0097620_100058624
616 Ga0075435_100170689
617 Ga0075435_100225018
618 Ga0075435_100419985
619 Ga0105251_10102181
620 Ga0105240_10018471
621 Ga0105240_10089616
622 Ga0105240_10313477
623 Ga0105245_10041970
624 Ga0114129_10237195
625 Ga0114129_10701398
626 Ga0105242_10035629
627 Ga0105248_10045830
628 Ga0105248_10060386
629 Ga0105248_10749766
630 Ga0105237_10048910
631 Ga0105238_10014121
632 Ga0105238_10474891
633 Ga0105238_10775315
634 Ga0105249_10076189
635 Ga0105249_10250678
636 Ga0105239_10891008
637 Ga0157373_10001644
638 Ga0157373_10168486
639 Ga0157371_10001047
640 Ga0157370_10010656
641 Ga0157370_10028554
642 Ga0157370_10083450
643 Ga0157370_10522022
644 Ga0157369_10002279
645 Ga0157369_10048263
646 Ga0157369_10539989
647 Ga0157369_10583575
648 Ga0157374_10023006
649 Ga0157378_10029136
650 Ga0163162_10043324
651 Ga0163162_10102889
652 Ga0163162_10580997
653 Ga0163162_10668640
654 Ga0157372_10003409
655 Ga0157372_10005089
656 Ga0157372_10013966
657 Ga0157372_10021378
658 Ga0157372_10063844
659 Ga0157372_10076831
660 Ga0157375_10016376
661 Ga0157375_10226495
662 Ga0157375_10817841
663 Ga0163163_10001473
664 Ga0163163_10031491
665 Ga0163163_10060180
666 Ga0157380_10026357
667 Ga0157380_10046657
668 Ga0157380_10051507
669 Ga0157380_10218408
670 Ga0157380_10282211
671 Ga0157376_10099327
672 Ga0163161_10070218
673 Ga0163161_10163797
674 Ga0207697_10002525
675 Ga0207642_10054355
676 Ga0207688_10074177
677 Ga0207647_10043338
678 Ga0207699_10194612
679 Ga0207699_10280672
680 Ga0207645_10011574
681 Ga0207643_10002190
682 Ga0207643_10050013
683 Ga0207705_10481864
684 Ga0207707_10027434
685 Ga0207695_10030785
686 Ga0207663_10091090
687 Ga0207660_10090800
688 Ga0207662_10029560
689 Ga0207657_10001180
690 Ga0207657_10089727
691 Ga0207649_10013618
692 Ga0207649_10143242
693 Ga0207652_10256327
694 Ga0207681_10005501
695 Ga0207681_10023632
696 Ga0207681_10170312
697 Ga0207681_10215159
698 Ga0207681_10228707
699 Ga0207694_10514318
700 Ga0207650_10000755
701 Ga0207650_10003114
702 Ga0207650_10004774
703 Ga0207650_10007706
704 Ga0207659_10016211
705 Ga0207659_10017772
706 Ga0207659_10019507
707 Ga0207700_10000086
708 Ga0207700_10661737
709 Ga0207664_10075295
710 Ga0207644_10006858
711 Ga0207644_10015129
712 Ga0207644_10472426
713 Ga0207690_10000937
714 Ga0207690_10043983
715 Ga0207690_10122646
716 Ga0207690_10418490
717 Ga0207706_10000144
718 Ga0207706_10075873
719 Ga0207706_10129522
720 Ga0207686_10067524
721 Ga0207670_10162439
722 Ga0207670_10344181
723 Ga0207704_10072418
724 Ga0207665_10376756
725 Ga0207691_10163906
726 Ga0207691_10169152
727 Ga0207691_10189959
728 Ga0207711_10001814
729 Ga0207711_10031395
730 Ga0207711_10073518
731 Ga0207689_10002758
732 Ga0207689_10006317
733 Ga0207679_10018487
734 Ga0207679_10028608
735 Ga0207679_10034409
736 Ga0207667_10013736
737 Ga0207667_10051369
738 Ga0207667_10062792
739 Ga0207651_10256967
740 Ga0207712_10117431
741 Ga0207712_10398008
742 Ga0207668_10020268
743 Ga0207668_10220705
744 Ga0207640_10021532
745 Ga0207640_10100067
746 Ga0207640_10466976
747 Ga0207658_10084026
748 Ga0207658_10218968
749 Ga0207658_10822831
750 Ga0207703_10374423
751 Ga0207639_10007370
752 Ga0207639_10405512
753 Ga0207678_10006255
754 Ga0207678_10014916
755 Ga0207708_10012680
756 Ga0207708_10081780
757 Ga0207702_10065015
758 Ga0207702_10247433
759 Ga0207702_10406587
760 Ga0207702_10426204
761 Ga0207641_10006823
762 Ga0207641_10144363
763 Ga0207648_10020140
764 Ga0207648_10104055
765 Ga0207648_10506786
766 Ga0207676_10010597
767 Ga0207676_10018370
768 Ga0207676_10229534
769 Ga0207674_10008990
770 Ga0207674_10105784
771 Ga0207674_10152917
772 Ga0207675_100020409
773 Ga0207675_100025794
774 Ga0207675_100036569
775 Ga0207683_10011451
776 Ga0207683_10066053
777 Ga0207683_10075996
778 Ga0207683_10303437
779 Ga0207698_10003523
780 Ga0207698_10018311
781 Ga0207698_10505507
782 Ga0209971_1002450
783 Ga0209966_1002437
784 Ga0209998_10014180
785 Ga0209974_10006584
786 Ga0209974_10007562
787 Ga0268266_10026906
788 Ga0268265_10034870
789 Ga0268265_10131683
790 Ga0268264_10025582
791 Ga0268264_10037247
792 Ga0268264_10256484
793 Ga0265338_10000341
794 Ga0307408_100005123
795 Ga0307410_10078601
796 Ga0307406_10007922
797 Ga0307407_10064758
798 Ga0307412_10033376
799 Ga0307409_100004885
800 Ga0307409_100351670
801 Ga0307414_10059343
802 Ga0307411_10000643
803 Ga0307411_10562235
804 Ga0373938_0039105
805 Ga0373923_0052985
806 Ga0373955_0032050
807 Ga0373931_0007853
808 Ga0373931_0105568
809 Ga0373927_0072388
810 Ga0373933_0152146
811 Ga0373937_0036498
812 Ga0373925_0054220
813 Ga0395899_0087645
814 Ga0395900_0029007
815 Ga0395898_0028150
816 Ga0395905_0016901
817 Ga0436364_0565335
818 Ga0395901_0059624
819 Ga0436361_0897970
820 Ga0436363_0455187
821 Ga0436362_0033661
822 Ga0439441_000128
823 Ga0439435_0010293
824 Ga0439444_0006111
825 Ga0439460_0025065
826 Ga0453683_0117895
827 Ga0466963_0207148
828 Ga0466963_0338102
829 Ga0453684_0271629
830 Ga0451576_0007549
831 Ga0451576_0799468
832 Ga0495658_0316382
833 Ga0495686_0004076
834 Ga0496102_0005496
835 Ga0496102_0140141
836 Ga0496102_0405456
837 Ga0496102_0451309
838 Ga0496104_0007302
839 Ga0496105_0092664
840 Ga0496106_0002831
841 Ga0496107_0006777
842 Ga0496107_0043532
843 Ga0496108_0003054
844 Ga0496108_0158253
845 Ga0496109_0021506
846 Ga0496109_0498995
847 Ga0496109_0720219
848 Ga0496110_0010236
849 Ga0496110_0227833
850 Ga0496112_0063485
851 Ga0496112_0070830
852 Ga0496113_0131387
853 Ga0496113_0298501
854 Ga0496114_0026105
855 Ga0501039_0053697
856 Ga0501041_0139895
857 Ga0501042_0032616
858 Ga0501042_0268462
859 Ga0501048_0037859
860 Ga0501067_0021418
861 Ga0501069_0090978
862 Ga0501070_0015001
863 Ga0501071_0131863
864 Ga0501072_0007021
865 Ga0501073_0045149
866 Ga0501079_0093434
867 Ga0501079_0562571
868 Ga0501080_0010726
869 Ga0501083_0146278
870 Ga0501045_0086066
871 nmdc:mga05p37_778480_c1
872 nmdc:mga09592_38440_c1
873 nmdc:mga0qj67_448261_c1
874 nmdc:mga08y16_43193_c1
875 nmdc:mga0n895_66495_c1
876 nmdc:mga0rr50_153950_c1
877 nmdc:mga08x19_126620_c1
878 nmdc:mga08x19_16920_c1
879 nmdc:mga08x19_243464_c1
880 nmdc:mga0a205_82488_c1
881 Ga0495601_0098226
882 Ga0501082_0277677
883 2723876283
884 8003400711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

97

282

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.6566 16 249
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6348 61 254
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.63 12 250
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6293 38 251
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.6199 16 253
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8422 61 249 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8413 56 251 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8293 56 251 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8264 59 250 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8177 63 250 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A8B3FT74-F1-model_v4 Taurine ABC transporter permease 0.9141 8 201 GO:0005886
GO:0010438
GO:0055085
AF-A0A0Q7AIE9-F1-model_v4 ABC transporter permease 0.9041 10 255 GO:0005886
GO:0055085
AF-A0A3N5WZ77-F1-model_v4 ABC transporter permease 0.901 10 255 GO:0005886
GO:0055085
AF-A0A836T7S1-F1-model_v4 ABC transporter permease 0.9004 10 257 GO:0005886
GO:0010438
GO:0055085
AF-A0A3D1UBV0-F1-model_v4 deleted 0.8989 10 255

Map