F444785

General Info

Members Datasets Scaffolds Average Seq Length
441 260 882 246

Family's Representative Sequence

Representative Sequence 3300053108|Ga0500562_068870|Ga0500562_068870_50_910
Length 286
Sequence VSPAYTGSTTLRAIITRVIVRFARCSDRQCPVSTELWYHRSEVMRIGIFSDVHANIEAMSAVIDAYKSERIDKYVCIGDVVGYGASPNECCDLIRKVAAYTILGNHDAAVAGRMDYSYYYDAARQALDLHARQLTQDNMMWLRNLPYEVREGEVTFCHGSPINLEEFEYIFSVEQATRCLDIWEELGLVTFIGHSHLCKSFALTREEVYEVVATKFVIRPEHRYIISVGSVGQPRDYDNRASYTIYDTEERTFEFKRVAYDIDGAAQKIFAADLERNFGNRLFLGV

Samples

Sample ID Description Type Environment
1 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
229 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
230 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
245 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
246 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
247 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
248 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
249 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
250 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
256 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
257 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.99
Nodule 0
Rhizoplane 3.17
Rhizosphere 87.07
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500562_068870 3300053108 Bacteria 954
2 Ga0058859_11585728 3300004798 Bacteria 850
3 Ga0065712_10134668 3300005290 Bacteria 1510
4 Ga0065707_10265719 3300005295 Unclassified 1085
5 Ga0070683_100061820 3300005329 Bacteria 3482
6 Ga0070690_100009238 3300005330 Bacteria 5706
7 Ga0068869_100362090 3300005334 Bacteria 1184
8 Ga0070680_100170677 3300005336 Bacteria 1830
9 Ga0068868_100151364 3300005338 Bacteria 1911
10 Ga0070689_100068005 3300005340 Bacteria 2777
11 Ga0070661_100237130 3300005344 Bacteria 1403
12 Ga0070675_100169288 3300005354 Bacteria 1883
13 Ga0070674_100343670 3300005356 Bacteria 1203
14 Ga0070688_100007213 3300005365 Bacteria 5987
15 Ga0070688_100101680 3300005365 Bacteria 1896
16 Ga0070703_10003699 3300005406 Bacteria 4334
17 Ga0070709_10001321 3300005434 Bacteria 13519
18 Ga0070709_10027817 3300005434 Bacteria 3366
19 Ga0070714_100247942 3300005435 Unclassified 1646
20 Ga0070714_100405064 3300005435 Unclassified 1290
21 Ga0070713_100000207 3300005436 Bacteria 39199
22 Ga0070713_100002684 3300005436 Bacteria 11605
23 Ga0070713_100005135 3300005436 Bacteria 8910
24 Ga0070713_100027717 3300005436 Bacteria 4463
25 Ga0070713_100096399 3300005436 Bacteria 2553
26 Ga0070713_100372381 3300005436 Bacteria 1329
27 Ga0070710_10044104 3300005437 Bacteria 2473
28 Ga0070710_10093503 3300005437 Bacteria 1778
29 Ga0070711_100000930 3300005439 Bacteria 15464
30 Ga0070711_100001041 3300005439 Bacteria 14765
31 Ga0070711_100073709 3300005439 Unclassified 2413
32 Ga0070711_100134964 3300005439 Bacteria 1843
33 Ga0070711_100454281 3300005439 Bacteria 1049
34 Ga0070705_100008921 3300005440 Bacteria 4972
35 Ga0070694_100205233 3300005444 Bacteria 1471
36 Ga0070694_100222858 3300005444 Bacteria 1415
37 Ga0070694_100593923 3300005444 Unclassified 891
38 Ga0070708_100059108 3300005445 Bacteria 3417
39 Ga0070678_100003229 3300005456 Bacteria 9055
40 Ga0070681_10011255 3300005458 Bacteria 8849
41 Ga0070681_10109065 3300005458 Bacteria 2708
42 Ga0070681_10379797 3300005458 Bacteria 1324
43 Ga0068867_100587113 3300005459 Bacteria 970
44 Ga0070706_100002645 3300005467 Bacteria 17929
45 Ga0070706_100012811 3300005467 Bacteria 7762
46 Ga0070706_100067679 3300005467 Bacteria 3303
47 Ga0070707_100056676 3300005468 Bacteria 3759
48 Ga0070707_100082330 3300005468 Bacteria 3108
49 Ga0070707_100491420 3300005468 Bacteria 1189
50 Ga0070698_100000114 3300005471 Bacteria 68309
51 Ga0070698_100029570 3300005471 Bacteria 5689
52 Ga0070698_100106601 3300005471 Bacteria 2771
53 Ga0070698_100203850 3300005471 Bacteria 1913
54 Ga0070698_100363355 3300005471 Unclassified 1379
55 Ga0070699_100000257 3300005518 Bacteria 51754
56 Ga0070699_100126647 3300005518 Bacteria 2249
57 Ga0070699_100309580 3300005518 Archaea 1418
58 Ga0070679_100001459 3300005530 Bacteria 20941
59 Ga0070679_100007016 3300005530 Bacteria 10509
60 Ga0070679_100021393 3300005530 Bacteria 6314
61 Ga0070679_100022633 3300005530 Bacteria 6144
62 Ga0070679_100446740 3300005530 Bacteria 1238
63 Ga0070697_100083347 3300005536 Bacteria 2637
64 Ga0070697_100183257 3300005536 Unclassified 1775
65 Ga0070697_100299913 3300005536 Unclassified 1381
66 Ga0070697_100511262 3300005536 Bacteria 1051
67 Ga0070695_100007936 3300005545 Bacteria 6285
68 Ga0070695_100009407 3300005545 Bacteria 5818
69 Ga0070695_100050673 3300005545 Bacteria 2662
70 Ga0070695_100141420 3300005545 Archaea 1669
71 Ga0070696_100011681 3300005546 Bacteria 5885
72 Ga0070696_100016019 3300005546 Bacteria 5041
73 Ga0070696_100043911 3300005546 Bacteria 3094
74 Ga0070696_100134309 3300005546 Bacteria 1803
75 Ga0070665_100002307 3300005548 Bacteria 21174
76 Ga0070704_100014490 3300005549 Bacteria 4927
77 Ga0070704_100200888 3300005549 Unclassified 1609
78 Ga0068855_100809928 3300005563 Bacteria 995
79 Ga0068857_100089472 3300005577 Bacteria 2755
80 Ga0068857_100202797 3300005577 Bacteria 1808
81 Ga0068856_100320668 3300005614 Bacteria 1567
82 Ga0068859_100051043 3300005617 Unclassified 4156
83 Ga0068859_100057851 3300005617 Bacteria 3905
84 Ga0068864_100010255 3300005618 Bacteria 7737
85 Ga0068863_100410522 3300005841 Bacteria 1325
86 Ga0068862_100097971 3300005844 Bacteria 2561
87 Ga0081455_10054710 3300005937 Bacteria 3399
88 Ga0081455_10168779 3300005937 Bacteria 1669
89 Ga0070717_10003527 3300006028 Bacteria 11213
90 Ga0070717_10005386 3300006028 Bacteria 9339
91 Ga0070717_10042588 3300006028 Bacteria 3703
92 Ga0070717_10244386 3300006028 Bacteria 1584
93 Ga0070717_10264968 3300006028 Bacteria 1521
94 Ga0070716_100003788 3300006173 Bacteria 7170
95 Ga0070716_100006101 3300006173 Bacteria 5876
96 Ga0070716_100056737 3300006173 Bacteria 2247
97 Ga0070716_100141170 3300006173 Bacteria 1536
98 Ga0070712_100000174 3300006175 Bacteria 35468
99 Ga0070712_100001176 3300006175 Bacteria 15816
100 Ga0070712_100001429 3300006175 Bacteria 14560
101 Ga0070712_100067334 3300006175 Bacteria 2548
102 Ga0070712_100182091 3300006175 Unclassified 1638
103 Ga0068871_100251722 3300006358 Bacteria 1539
104 Ga0068871_100667284 3300006358 Unclassified 950
105 Ga0075428_100197441 3300006844 Bacteria 2176
106 Ga0075428_100533605 3300006844 Bacteria 1255
107 Ga0075431_100143683 3300006847 Bacteria 2459
108 Ga0075431_100252663 3300006847 Unclassified 1791
109 Ga0075433_10000027 3300006852 Bacteria 57677
110 Ga0075433_10073686 3300006852 Bacteria 3003
111 Ga0075433_10094516 3300006852 Bacteria 2646
112 Ga0075434_100001321 3300006871 Bacteria 20725
113 Ga0075434_100002614 3300006871 Bacteria 15884
114 Ga0075434_100013427 3300006871 Bacteria 7794
115 Ga0075429_100009706 3300006880 Bacteria 8343
116 Ga0075429_100037526 3300006880 Bacteria 4218
117 Ga0075429_100136263 3300006880 Bacteria 2149
118 Ga0075429_100292581 3300006880 Bacteria 1426
119 Ga0075429_100451829 3300006880 Unclassified 1126
120 Ga0075436_100003656 3300006914 Bacteria 10533
121 Ga0075436_100010237 3300006914 Bacteria 6420
122 Ga0097620_100051041 3300006931 Unclassified 4156
123 Ga0097620_100057854 3300006931 Bacteria 3905
124 Ga0075435_100000015 3300007076 Bacteria 100708
125 Ga0075435_100057958 3300007076 Bacteria 3135
126 Ga0075435_100128639 3300007076 Archaea 2118
127 Ga0075435_100455925 3300007076 Unclassified 1103
128 Ga0105240_10022691 3300009093 Bacteria 8316
129 Ga0111539_10002424 3300009094 Bacteria 24805
130 Ga0111539_10012258 3300009094 Bacteria 10751
131 Ga0111539_10624622 3300009094 Bacteria 1255
132 Ga0111539_11252792 3300009094 Unclassified 861
133 Ga0105245_10000099 3300009098 Bacteria 83865
134 Ga0105247_10066347 3300009101 Bacteria 2247
135 Ga0114129_11416782 3300009147 Bacteria 857
136 Ga0105242_10337835 3300009176 Bacteria 1387
137 Ga0105248_10049164 3300009177 Unclassified 4730
138 Ga0105246_10199023 3300011119 Bacteria 1556
139 Ga0157373_10170670 3300013100 Bacteria 1530
140 Ga0157371_10231078 3300013102 Bacteria 1329
141 Ga0157369_10089677 3300013105 Bacteria 3283
142 Ga0157369_10406796 3300013105 Bacteria 1412
143 Ga0157374_10110789 3300013296 Bacteria 2640
144 Ga0157372_10058103 3300013307 Bacteria 4324
145 Ga0163163_10002034 3300014325 Bacteria 17099
146 Ga0163163_10046656 3300014325 Bacteria 4256
147 Ga0157379_10349591 3300014968 Unclassified 1353
148 Ga0157379_10693551 3300014968 Bacteria 955
149 Ga0157376_10551618 3300014969 Bacteria 1141
150 Ga0224570_102890 3300022730 Bacteria 1118
151 Ga0224572_1000267 3300024225 Bacteria 5379
152 Ga0228598_1004459 3300024227 Bacteria 2965
153 Ga0207653_10000472 3300025885 Bacteria 16012
154 Ga0207692_10031429 3300025898 Bacteria 2543
155 Ga0207685_10196437 3300025905 Bacteria 945
156 Ga0207699_10000785 3300025906 Bacteria 15207
157 Ga0207699_10238071 3300025906 Bacteria 1249
158 Ga0207699_10375432 3300025906 Bacteria 1008
159 Ga0207684_10014605 3300025910 Bacteria 6767
160 Ga0207684_10037173 3300025910 Bacteria 4132
161 Ga0207684_10073282 3300025910 Bacteria 2908
162 Ga0207707_10030543 3300025912 Bacteria 4714
163 Ga0207695_10041426 3300025913 Bacteria 4929
164 Ga0207693_10000092 3300025915 Bacteria 80077
165 Ga0207693_10000672 3300025915 Bacteria 30694
166 Ga0207693_10031906 3300025915 Bacteria 4162
167 Ga0207663_10000687 3300025916 Bacteria 15002
168 Ga0207663_10005458 3300025916 Bacteria 6404
169 Ga0207663_10053994 3300025916 Bacteria 2514
170 Ga0207663_10457914 3300025916 Bacteria 985
171 Ga0207660_10014792 3300025917 Bacteria 5142
172 Ga0207662_10052643 3300025918 Bacteria 2423
173 Ga0207652_10386925 3300025921 Bacteria 1262
174 Ga0207646_10104087 3300025922 Unclassified 2546
175 Ga0207659_10145243 3300025926 Bacteria 1846
176 Ga0207687_10000774 3300025927 Bacteria 21584
177 Ga0207687_10048362 3300025927 Bacteria 2952
178 Ga0207687_10229318 3300025927 Bacteria 1466
179 Ga0207700_10000938 3300025928 Bacteria 16771
180 Ga0207700_10003113 3300025928 Bacteria 9587
181 Ga0207700_10039857 3300025928 Bacteria 3424
182 Ga0207700_10133976 3300025928 Bacteria 2027
183 Ga0207700_10381357 3300025928 Bacteria 1233
184 Ga0207664_10000158 3300025929 Bacteria 54104
185 Ga0207670_10064262 3300025936 Bacteria 2515
186 Ga0207704_10092481 3300025938 Bacteria 1991
187 Ga0207665_10002456 3300025939 Bacteria 12514
188 Ga0207665_10007761 3300025939 Bacteria 7082
189 Ga0207711_10509140 3300025941 Bacteria 1122
190 Ga0207689_10101845 3300025942 Bacteria 2359
191 Ga0207661_10701793 3300025944 Bacteria 931
192 Ga0207712_10183547 3300025961 Bacteria 1645
193 Ga0207703_10018477 3300026035 Bacteria 5444
194 Ga0207708_10168456 3300026075 Bacteria 1733
195 Ga0207702_10002392 3300026078 Bacteria 17865
196 Ga0207641_10681302 3300026088 Bacteria 1011
197 Ga0207676_10060803 3300026095 Bacteria 2989
198 Ga0207674_10120712 3300026116 Bacteria 2589
199 Ga0207674_10400142 3300026116 Bacteria 1327
200 Ga0207675_100192869 3300026118 Bacteria 1955
201 Ga0207683_10069180 3300026121 Bacteria 3118
202 Ga0207428_10004318 3300027907 Bacteria 13574
203 Ga0207428_10006333 3300027907 Bacteria 10944
204 Ga0265356_1000062 3300028017 Bacteria 17622
205 Ga0268266_10002328 3300028379 Bacteria 20581
206 Ga0268265_10022841 3300028380 Bacteria 4402
207 Ga0268264_10021131 3300028381 Bacteria 5318
208 Ga0307515_10015000 3300028794 Bacteria 14315
209 Ga0307515_10376728 3300028794 Bacteria 1053
210 Ga0265338_10098120 3300028800 Bacteria 2398
211 Ga0265338_10184303 3300028800 Bacteria 1588
212 Ga0307511_10026671 3300030521 Bacteria 5295
213 Ga0307511_10120785 3300030521 Bacteria 1621
214 Ga0265762_1009501 3300030760 Bacteria 1734
215 Ga0265760_10064588 3300031090 Bacteria 1116
216 Ga0265332_10039065 3300031238 Bacteria 2055
217 Ga0307513_10010635 3300031456 Bacteria 11512
218 Ga0307513_10412343 3300031456 Bacteria 1083
219 Ga0307509_10000007 3300031507 Bacteria 409278
220 Ga0307509_10010793 3300031507 Bacteria 11136
221 Ga0307509_10076138 3300031507 Bacteria 3483
222 Ga0307509_10221952 3300031507 Bacteria 1702
223 Ga0307508_10096092 3300031616 Bacteria 2554
224 Ga0307508_10107022 3300031616 Bacteria 2394
225 Ga0307508_10119142 3300031616 Bacteria 2242
226 Ga0265314_10215417 3300031711 Bacteria 1125
227 Ga0265314_10260604 3300031711 Bacteria 990
228 Ga0265342_10071162 3300031712 Bacteria 2027
229 Ga0316576_10000279 3300031727 Bacteria 22450
230 Ga0316576_10201102 3300031727 Bacteria 1501
231 Ga0316578_10181216 3300031728 Bacteria 1269
232 Ga0307516_10013815 3300031730 Bacteria 8574
233 Ga0307516_10080569 3300031730 Bacteria 3100
234 Ga0316577_10089363 3300031733 Bacteria 1724
235 Ga0307406_10028634 3300031901 Bacteria 3368
236 Ga0307415_100179828 3300032126 Bacteria 1658
237 Ga0373959_0020066 3300034820 Bacteria 1272
238 Ga0373926_0070040 3300035083 Bacteria 1288
239 Ga0373934_0032064 3300035086 Bacteria 2060
240 Ga0373949_0000359 3300035090 Bacteria 16103
241 Ga0373923_0004105 3300035111 Bacteria 4790
242 Ga0373936_0000035 3300035113 Bacteria 108166
243 Ga0373936_0010071 3300035113 Bacteria 3569
244 Ga0373945_0041566 3300035116 Bacteria 1662
245 Ga0373945_0052255 3300035116 Bacteria 1505
246 Ga0373953_0020200 3300035117 Bacteria 2487
247 Ga0373956_0063787 3300035119 Bacteria 1672
248 Ga0373957_0018598 3300035120 Bacteria 2437
249 Ga0373943_0000034 3300035170 Bacteria 45727
250 Ga0373943_0042277 3300035170 Bacteria 2208
251 Ga0373946_0131607 3300035171 Bacteria 1151
252 Ga0373955_0028996 3300035172 Bacteria 2875
253 Ga0373955_0081272 3300035172 Bacteria 1832
254 Ga0373961_0000020 3300035241 Bacteria 100658
255 Ga0373924_0005573 3300035410 Bacteria 4464
256 Ga0373924_0175294 3300035410 Bacteria 943
257 Ga0373935_0001995 3300035692 Bacteria 11504
258 Ga0373935_0002420 3300035692 Bacteria 10685
259 Ga0373935_0063693 3300035692 Bacteria 2364
260 Ga0373927_0000967 3300035695 Bacteria 21803
261 Ga0373927_0020889 3300035695 Bacteria 4291
262 Ga0373927_0161940 3300035695 Bacteria 1466
263 Ga0373927_0376905 3300035695 Unclassified 935
264 Ga0373947_0001533 3300035725 Bacteria 14167
265 Ga0373947_0115123 3300035725 Bacteria 1704
266 Ga0373947_0213777 3300035725 Bacteria 1266
267 Ga0373937_0043808 3300036401 Bacteria 4087
268 Ga0373937_0072678 3300036401 Bacteria 3173
269 Ga0316584_0002111 3300036712 Bacteria 12440
270 Ga0373925_0000695 3300037068 Bacteria 31483
271 Ga0373925_0007502 3300037068 Bacteria 7951
272 Ga0373925_0025818 3300037068 Bacteria 4295
273 Ga0373925_0052757 3300037068 Bacteria 3038
274 Ga0373925_0331774 3300037068 Bacteria 1232
275 Ga0395899_0073914 3300037312 Bacteria 2491
276 Ga0395900_0029071 3300037418 Bacteria 5669
277 Ga0395898_0032406 3300037466 Bacteria 5216
278 Ga0395905_0119077 3300037471 Bacteria 2482
279 Ga0395901_0035919 3300038443 Bacteria 5120
280 Ga0436365_0692132 3300039437 Bacteria 939
281 Ga0436363_0117768 3300039450 Bacteria 1131
282 Ga0436363_1002053 3300039450 Bacteria 842
283 Ga0436363_1026272 3300039450 Bacteria 978
284 Ga0451853_3580235 3300041512 Bacteria 1256
285 Ga0451577_0000630 3300042876 Bacteria 56429
286 Ga0451577_0035007 3300042876 Bacteria 4524
287 Ga0466969_0003330 3300044656 Bacteria 8554
288 Ga0453683_0042664 3300044673 Unclassified 2848
289 Ga0453683_0128856 3300044673 Archaea 1594
290 Ga0453683_0313311 3300044673 Bacteria 1005
291 Ga0466966_0025724 3300044684 Bacteria 3845
292 Ga0466963_0083265 3300044694 Bacteria 2170
293 Ga0466963_0236213 3300044694 Unclassified 1281
294 Ga0453684_0000038 3300044712 Bacteria 706970
295 Ga0453684_0794170 3300044712 Archaea 1021
296 Ga0466957_0064561 3300044842 Bacteria 2253
297 Ga0466959_0114648 3300045049 Bacteria 1920
298 Ga0451576_0016238 3300045051 Bacteria 8223
299 Ga0451576_0261330 3300045051 Unclassified 1809
300 Ga0451576_0313856 3300045051 Bacteria 1640
301 Ga0451576_0433689 3300045051 Unclassified 1379
302 Ga0451576_0541401 3300045051 Bacteria 1223
303 Ga0495603_0032313 3300046455 Bacteria 3149
304 Ga0495629_0057914 3300046459 Bacteria 2708
305 Ga0495629_0179041 3300046459 Bacteria 1470
306 Ga0495580_0000038 3300046472 Bacteria 71800
307 Ga0495580_0000525 3300046472 Bacteria 32345
308 Ga0495580_0170023 3300046472 Bacteria 1507
309 Ga0495582_0007872 3300046473 Bacteria 5889
310 Ga0495639_0059350 3300046475 Bacteria 1751
311 Ga0495664_0028955 3300046477 Bacteria 3237
312 Ga0495664_0200208 3300046477 Bacteria 1210
313 Ga0495594_0029082 3300046499 Bacteria 2985
314 Ga0495628_0077756 3300046516 Bacteria 2581
315 Ga0495630_0057431 3300046517 Bacteria 2917
316 Ga0495630_0179127 3300046517 Bacteria 1616
317 Ga0495665_0202517 3300046531 Bacteria 1029
318 Ga0495598_0008159 3300046537 Bacteria 2428
319 Ga0495645_0031313 3300046543 Bacteria 3876
320 Ga0495635_0241510 3300046663 Bacteria 1219
321 Ga0495659_0002257 3300046664 Bacteria 6252
322 Ga0495657_0355202 3300046675 Bacteria 867
323 Ga0495599_0035370 3300046678 Bacteria 3136
324 Ga0495599_0385100 3300046678 Unclassified 837
325 Ga0495623_0028472 3300046679 Bacteria 3594
326 Ga0495623_0103697 3300046679 Bacteria 1730
327 Ga0495647_0029329 3300046681 Bacteria 2034
328 Ga0495647_0031650 3300046681 Bacteria 1968
329 Ga0495658_0004815 3300046683 Bacteria 6619
330 Ga0495613_0345266 3300046689 Bacteria 1023
331 Ga0495613_0380815 3300046689 Bacteria 965
332 Ga0495624_0170028 3300046690 Bacteria 1330
333 Ga0495600_0102107 3300046809 Bacteria 1869
334 Ga0495581_0032553 3300047315 Unclassified 3019
335 Ga0495604_0043147 3300047317 Bacteria 3532
336 Ga0495674_0008611 3300047319 Bacteria 9706
337 Ga0495674_0034435 3300047319 Bacteria 4581
338 Ga0495676_0096332 3300047321 Bacteria 2200
339 Ga0495680_0151017 3300047322 Bacteria 1694
340 Ga0495684_0187075 3300047471 Bacteria 1533
341 Ga0495593_0046076 3300047673 Unclassified 2325
342 Ga0495602_0036968 3300048088 Bacteria 4538
343 Ga0495602_0117524 3300048088 Bacteria 2146
344 Ga0496100_0064405 3300048903 Bacteria 2426
345 Ga0496101_0329628 3300048904 Bacteria 1198
346 Ga0496104_0000637 3300048907 Bacteria 30053
347 Ga0496105_0001947 3300048908 Bacteria 14827
348 Ga0496105_0363861 3300048908 Bacteria 1153
349 Ga0496108_0001951 3300048911 Bacteria 16525
350 Ga0496109_0000908 3300048912 Bacteria 24650
351 Ga0496111_0002002 3300048914 Bacteria 12119
352 Ga0496112_0019256 3300048915 Bacteria 6438
353 Ga0496112_0068107 3300048915 Bacteria 3515
354 Ga0496113_0042809 3300048916 Bacteria 3347
355 Ga0496114_0068386 3300048917 Bacteria 2982
356 Ga0496115_0010204 3300048918 Bacteria 7008
357 Ga0496115_0204906 3300048918 Bacteria 1629
358 Ga0501299_020881 3300049522 Bacteria 1197
359 Ga0501032_0106749 3300049569 Bacteria 1854
360 Ga0501034_0053364 3300049571 Bacteria 4071
361 Ga0501038_0015291 3300049574 Bacteria 6977
362 Ga0501039_0434188 3300049575 Bacteria 1031
363 Ga0501042_0314748 3300049578 Bacteria 1131
364 Ga0501043_0029286 3300049579 Bacteria 4325
365 Ga0501046_0085627 3300049580 Bacteria 2430
366 Ga0501047_0007109 3300049581 Bacteria 10513
367 Ga0501047_0016449 3300049581 Bacteria 7061
368 Ga0501047_0203262 3300049581 Bacteria 1841
369 Ga0501067_0004075 3300049583 Bacteria 8062
370 Ga0501068_0000122 3300049584 Bacteria 34346
371 Ga0501068_0129606 3300049584 Bacteria 1577
372 Ga0501069_0017462 3300049585 Bacteria 3862
373 Ga0501069_0018981 3300049585 Bacteria 3713
374 Ga0501070_0072273 3300049586 Bacteria 2856
375 Ga0501070_0130110 3300049586 Bacteria 2079
376 Ga0501070_0410091 3300049586 Bacteria 1095
377 Ga0501072_0000162 3300049588 Bacteria 48896
378 Ga0501072_0180398 3300049588 Bacteria 1684
379 Ga0501073_0011475 3300049589 Bacteria 6480
380 Ga0501073_0066892 3300049589 Bacteria 2505
381 Ga0501074_0009201 3300049590 Bacteria 7177
382 Ga0501076_0090553 3300049592 Bacteria 2460
383 Ga0501077_0041150 3300049593 Bacteria 2942
384 Ga0501217_008090 3300049661 Bacteria 2266
385 Ga0501227_001105 3300049665 Bacteria 5996
386 Ga0501230_004229 3300049667 Bacteria 1961
387 Ga0501229_008148 3300049706 Bacteria 1308
388 Ga0501079_0019321 3300049741 Bacteria 5203
389 Ga0501083_0009296 3300049744 Bacteria 6938
390 Ga0501083_0172548 3300049744 Bacteria 1413
391 Ga0501044_0049035 3300049823 Bacteria 4358
392 Ga0501044_0093280 3300049823 Bacteria 3035
393 nmdc:mga09592_100327_c1 3300050508 Bacteria 2479
394 nmdc:mga09592_27977_c1 3300050508 Bacteria 4681
395 nmdc:mga09592_297283_c1 3300050508 Bacteria 1400
396 nmdc:mga0qj67_629101_c1 3300050509 Bacteria 857
397 nmdc:mga06r32_117943_c1 3300050510 Bacteria 2616
398 nmdc:mga06r32_543552_c1 3300050510 Bacteria 1136
399 nmdc:mga06r32_59910_c1 3300050510 Bacteria 3662
400 nmdc:mga08y16_1080455_c1 3300050511 Unclassified 778
401 nmdc:mga08y16_12382_c1 3300050511 Bacteria 8971
402 nmdc:mga08y16_16959_c1 3300050511 Bacteria 7669
403 nmdc:mga08y16_501573_c1 3300050511 Bacteria 1233
404 nmdc:mga08y16_754453_c1 3300050511 Bacteria 969
405 nmdc:mga0n895_2565_c1 3300050512 Bacteria 14253
406 nmdc:mga0n895_2681_c1 3300050512 Bacteria 14053
407 nmdc:mga0n895_79888_c1 3300050512 Unclassified 3258
408 nmdc:mga0rr50_508_c1 3300050513 Bacteria 20736
409 nmdc:mga08x19_21900_c1 3300050514 Bacteria 3951
410 nmdc:mga08x19_57112_c1 3300050514 Bacteria 2521
411 nmdc:mga08x19_73821_c1 3300050514 Bacteria 2228
412 nmdc:mga0a205_136782_c2 3300050515 Bacteria 2051
413 nmdc:mga0a205_180_c1 3300050515 Bacteria 42950
414 nmdc:mga0a205_3325_c1 3300050515 Bacteria 9888
415 Ga0495619_0235134 3300053085 Bacteria 1270
416 Ga0500578_0098930 3300053086 Bacteria 1847
417 Ga0500566_0006746 3300053094 Bacteria 6800
418 Ga0500566_0047802 3300053094 Bacteria 2455
419 Ga0500566_0061800 3300053094 Bacteria 2119
420 Ga0500640_002124 3300053095 Bacteria 6417
421 Ga0500554_003992 3300053102 Bacteria 3078
422 Ga0500572_006670 3300053111 Bacteria 2650
423 Ga0500595_000080 3300053119 Bacteria 67711
424 Ga0500597_008375 3300053120 Bacteria 3573
425 Ga0500597_038346 3300053120 Bacteria 2006
426 Ga0500614_004088 3300053123 Bacteria 3103
427 Ga0500614_011779 3300053123 Bacteria 1899
428 Ga0500642_0131491 3300053130 Bacteria 1173
429 Ga0500568_0014581 3300053139 Bacteria 3545
430 Ga0500568_0031811 3300053139 Bacteria 2174
431 Ga0500603_008037 3300053150 Bacteria 2329
432 Ga0500603_009755 3300053150 Bacteria 2153
433 Ga0500616_0034986 3300053153 Bacteria 2733
434 Ga0500619_122257 3300053154 Bacteria 887
435 Ga0500639_043113 3300053163 Bacteria 2366
436 Ga0500637_0071344 3300053178 Unclassified 1998
437 Ga0501084_0006197 3300054114 Bacteria 9836
438 Ga0501084_0019144 3300054114 Bacteria 5702
439 Ga0501082_0083114 3300060353 Bacteria 2763
440 Ga0501082_0658305 3300060353 Bacteria 916
441 Ga0530510_0013910 3300061734 Bacteria 5669
442 Ga0500562_068870
443 Ga0058859_11585728
444 Ga0065712_10134668
445 Ga0065707_10265719
446 Ga0070683_100061820
447 Ga0070690_100009238
448 Ga0068869_100362090
449 Ga0070680_100170677
450 Ga0068868_100151364
451 Ga0070689_100068005
452 Ga0070661_100237130
453 Ga0070675_100169288
454 Ga0070674_100343670
455 Ga0070688_100007213
456 Ga0070688_100101680
457 Ga0070703_10003699
458 Ga0070709_10001321
459 Ga0070709_10027817
460 Ga0070714_100247942
461 Ga0070714_100405064
462 Ga0070713_100000207
463 Ga0070713_100002684
464 Ga0070713_100005135
465 Ga0070713_100027717
466 Ga0070713_100096399
467 Ga0070713_100372381
468 Ga0070710_10044104
469 Ga0070710_10093503
470 Ga0070711_100000930
471 Ga0070711_100001041
472 Ga0070711_100073709
473 Ga0070711_100134964
474 Ga0070711_100454281
475 Ga0070705_100008921
476 Ga0070694_100205233
477 Ga0070694_100222858
478 Ga0070694_100593923
479 Ga0070708_100059108
480 Ga0070678_100003229
481 Ga0070681_10011255
482 Ga0070681_10109065
483 Ga0070681_10379797
484 Ga0068867_100587113
485 Ga0070706_100002645
486 Ga0070706_100012811
487 Ga0070706_100067679
488 Ga0070707_100056676
489 Ga0070707_100082330
490 Ga0070707_100491420
491 Ga0070698_100000114
492 Ga0070698_100029570
493 Ga0070698_100106601
494 Ga0070698_100203850
495 Ga0070698_100363355
496 Ga0070699_100000257
497 Ga0070699_100126647
498 Ga0070699_100309580
499 Ga0070679_100001459
500 Ga0070679_100007016
501 Ga0070679_100021393
502 Ga0070679_100022633
503 Ga0070679_100446740
504 Ga0070697_100083347
505 Ga0070697_100183257
506 Ga0070697_100299913
507 Ga0070697_100511262
508 Ga0070695_100007936
509 Ga0070695_100009407
510 Ga0070695_100050673
511 Ga0070695_100141420
512 Ga0070696_100011681
513 Ga0070696_100016019
514 Ga0070696_100043911
515 Ga0070696_100134309
516 Ga0070665_100002307
517 Ga0070704_100014490
518 Ga0070704_100200888
519 Ga0068855_100809928
520 Ga0068857_100089472
521 Ga0068857_100202797
522 Ga0068856_100320668
523 Ga0068859_100051043
524 Ga0068859_100057851
525 Ga0068864_100010255
526 Ga0068863_100410522
527 Ga0068862_100097971
528 Ga0081455_10054710
529 Ga0081455_10168779
530 Ga0070717_10003527
531 Ga0070717_10005386
532 Ga0070717_10042588
533 Ga0070717_10244386
534 Ga0070717_10264968
535 Ga0070716_100003788
536 Ga0070716_100006101
537 Ga0070716_100056737
538 Ga0070716_100141170
539 Ga0070712_100000174
540 Ga0070712_100001176
541 Ga0070712_100001429
542 Ga0070712_100067334
543 Ga0070712_100182091
544 Ga0068871_100251722
545 Ga0068871_100667284
546 Ga0075428_100197441
547 Ga0075428_100533605
548 Ga0075431_100143683
549 Ga0075431_100252663
550 Ga0075433_10000027
551 Ga0075433_10073686
552 Ga0075433_10094516
553 Ga0075434_100001321
554 Ga0075434_100002614
555 Ga0075434_100013427
556 Ga0075429_100009706
557 Ga0075429_100037526
558 Ga0075429_100136263
559 Ga0075429_100292581
560 Ga0075429_100451829
561 Ga0075436_100003656
562 Ga0075436_100010237
563 Ga0097620_100051041
564 Ga0097620_100057854
565 Ga0075435_100000015
566 Ga0075435_100057958
567 Ga0075435_100128639
568 Ga0075435_100455925
569 Ga0105240_10022691
570 Ga0111539_10002424
571 Ga0111539_10012258
572 Ga0111539_10624622
573 Ga0111539_11252792
574 Ga0105245_10000099
575 Ga0105247_10066347
576 Ga0114129_11416782
577 Ga0105242_10337835
578 Ga0105248_10049164
579 Ga0105246_10199023
580 Ga0157373_10170670
581 Ga0157371_10231078
582 Ga0157369_10089677
583 Ga0157369_10406796
584 Ga0157374_10110789
585 Ga0157372_10058103
586 Ga0163163_10002034
587 Ga0163163_10046656
588 Ga0157379_10349591
589 Ga0157379_10693551
590 Ga0157376_10551618
591 Ga0224570_102890
592 Ga0224572_1000267
593 Ga0228598_1004459
594 Ga0207653_10000472
595 Ga0207692_10031429
596 Ga0207685_10196437
597 Ga0207699_10000785
598 Ga0207699_10238071
599 Ga0207699_10375432
600 Ga0207684_10014605
601 Ga0207684_10037173
602 Ga0207684_10073282
603 Ga0207707_10030543
604 Ga0207695_10041426
605 Ga0207693_10000092
606 Ga0207693_10000672
607 Ga0207693_10031906
608 Ga0207663_10000687
609 Ga0207663_10005458
610 Ga0207663_10053994
611 Ga0207663_10457914
612 Ga0207660_10014792
613 Ga0207662_10052643
614 Ga0207652_10386925
615 Ga0207646_10104087
616 Ga0207659_10145243
617 Ga0207687_10000774
618 Ga0207687_10048362
619 Ga0207687_10229318
620 Ga0207700_10000938
621 Ga0207700_10003113
622 Ga0207700_10039857
623 Ga0207700_10133976
624 Ga0207700_10381357
625 Ga0207664_10000158
626 Ga0207670_10064262
627 Ga0207704_10092481
628 Ga0207665_10002456
629 Ga0207665_10007761
630 Ga0207711_10509140
631 Ga0207689_10101845
632 Ga0207661_10701793
633 Ga0207712_10183547
634 Ga0207703_10018477
635 Ga0207708_10168456
636 Ga0207702_10002392
637 Ga0207641_10681302
638 Ga0207676_10060803
639 Ga0207674_10120712
640 Ga0207674_10400142
641 Ga0207675_100192869
642 Ga0207683_10069180
643 Ga0207428_10004318
644 Ga0207428_10006333
645 Ga0265356_1000062
646 Ga0268266_10002328
647 Ga0268265_10022841
648 Ga0268264_10021131
649 Ga0307515_10015000
650 Ga0307515_10376728
651 Ga0265338_10098120
652 Ga0265338_10184303
653 Ga0307511_10026671
654 Ga0307511_10120785
655 Ga0265762_1009501
656 Ga0265760_10064588
657 Ga0265332_10039065
658 Ga0307513_10010635
659 Ga0307513_10412343
660 Ga0307509_10000007
661 Ga0307509_10010793
662 Ga0307509_10076138
663 Ga0307509_10221952
664 Ga0307508_10096092
665 Ga0307508_10107022
666 Ga0307508_10119142
667 Ga0265314_10215417
668 Ga0265314_10260604
669 Ga0265342_10071162
670 Ga0316576_10000279
671 Ga0316576_10201102
672 Ga0316578_10181216
673 Ga0307516_10013815
674 Ga0307516_10080569
675 Ga0316577_10089363
676 Ga0307406_10028634
677 Ga0307415_100179828
678 Ga0373959_0020066
679 Ga0373926_0070040
680 Ga0373934_0032064
681 Ga0373949_0000359
682 Ga0373923_0004105
683 Ga0373936_0000035
684 Ga0373936_0010071
685 Ga0373945_0041566
686 Ga0373945_0052255
687 Ga0373953_0020200
688 Ga0373956_0063787
689 Ga0373957_0018598
690 Ga0373943_0000034
691 Ga0373943_0042277
692 Ga0373946_0131607
693 Ga0373955_0028996
694 Ga0373955_0081272
695 Ga0373961_0000020
696 Ga0373924_0005573
697 Ga0373924_0175294
698 Ga0373935_0001995
699 Ga0373935_0002420
700 Ga0373935_0063693
701 Ga0373927_0000967
702 Ga0373927_0020889
703 Ga0373927_0161940
704 Ga0373927_0376905
705 Ga0373947_0001533
706 Ga0373947_0115123
707 Ga0373947_0213777
708 Ga0373937_0043808
709 Ga0373937_0072678
710 Ga0316584_0002111
711 Ga0373925_0000695
712 Ga0373925_0007502
713 Ga0373925_0025818
714 Ga0373925_0052757
715 Ga0373925_0331774
716 Ga0395899_0073914
717 Ga0395900_0029071
718 Ga0395898_0032406
719 Ga0395905_0119077
720 Ga0395901_0035919
721 Ga0436365_0692132
722 Ga0436363_0117768
723 Ga0436363_1002053
724 Ga0436363_1026272
725 Ga0451853_3580235
726 Ga0451577_0000630
727 Ga0451577_0035007
728 Ga0466969_0003330
729 Ga0453683_0042664
730 Ga0453683_0128856
731 Ga0453683_0313311
732 Ga0466966_0025724
733 Ga0466963_0083265
734 Ga0466963_0236213
735 Ga0453684_0000038
736 Ga0453684_0794170
737 Ga0466957_0064561
738 Ga0466959_0114648
739 Ga0451576_0016238
740 Ga0451576_0261330
741 Ga0451576_0313856
742 Ga0451576_0433689
743 Ga0451576_0541401
744 Ga0495603_0032313
745 Ga0495629_0057914
746 Ga0495629_0179041
747 Ga0495580_0000038
748 Ga0495580_0000525
749 Ga0495580_0170023
750 Ga0495582_0007872
751 Ga0495639_0059350
752 Ga0495664_0028955
753 Ga0495664_0200208
754 Ga0495594_0029082
755 Ga0495628_0077756
756 Ga0495630_0057431
757 Ga0495630_0179127
758 Ga0495665_0202517
759 Ga0495598_0008159
760 Ga0495645_0031313
761 Ga0495635_0241510
762 Ga0495659_0002257
763 Ga0495657_0355202
764 Ga0495599_0035370
765 Ga0495599_0385100
766 Ga0495623_0028472
767 Ga0495623_0103697
768 Ga0495647_0029329
769 Ga0495647_0031650
770 Ga0495658_0004815
771 Ga0495613_0345266
772 Ga0495613_0380815
773 Ga0495624_0170028
774 Ga0495600_0102107
775 Ga0495581_0032553
776 Ga0495604_0043147
777 Ga0495674_0008611
778 Ga0495674_0034435
779 Ga0495676_0096332
780 Ga0495680_0151017
781 Ga0495684_0187075
782 Ga0495593_0046076
783 Ga0495602_0036968
784 Ga0495602_0117524
785 Ga0496100_0064405
786 Ga0496101_0329628
787 Ga0496104_0000637
788 Ga0496105_0001947
789 Ga0496105_0363861
790 Ga0496108_0001951
791 Ga0496109_0000908
792 Ga0496111_0002002
793 Ga0496112_0019256
794 Ga0496112_0068107
795 Ga0496113_0042809
796 Ga0496114_0068386
797 Ga0496115_0010204
798 Ga0496115_0204906
799 Ga0501299_020881
800 Ga0501032_0106749
801 Ga0501034_0053364
802 Ga0501038_0015291
803 Ga0501039_0434188
804 Ga0501042_0314748
805 Ga0501043_0029286
806 Ga0501046_0085627
807 Ga0501047_0007109
808 Ga0501047_0016449
809 Ga0501047_0203262
810 Ga0501067_0004075
811 Ga0501068_0000122
812 Ga0501068_0129606
813 Ga0501069_0017462
814 Ga0501069_0018981
815 Ga0501070_0072273
816 Ga0501070_0130110
817 Ga0501070_0410091
818 Ga0501072_0000162
819 Ga0501072_0180398
820 Ga0501073_0011475
821 Ga0501073_0066892
822 Ga0501074_0009201
823 Ga0501076_0090553
824 Ga0501077_0041150
825 Ga0501217_008090
826 Ga0501227_001105
827 Ga0501230_004229
828 Ga0501229_008148
829 Ga0501079_0019321
830 Ga0501083_0009296
831 Ga0501083_0172548
832 Ga0501044_0049035
833 Ga0501044_0093280
834 nmdc:mga09592_100327_c1
835 nmdc:mga09592_27977_c1
836 nmdc:mga09592_297283_c1
837 nmdc:mga0qj67_629101_c1
838 nmdc:mga06r32_117943_c1
839 nmdc:mga06r32_543552_c1
840 nmdc:mga06r32_59910_c1
841 nmdc:mga08y16_1080455_c1
842 nmdc:mga08y16_12382_c1
843 nmdc:mga08y16_16959_c1
844 nmdc:mga08y16_501573_c1
845 nmdc:mga08y16_754453_c1
846 nmdc:mga0n895_2565_c1
847 nmdc:mga0n895_2681_c1
848 nmdc:mga0n895_79888_c1
849 nmdc:mga0rr50_508_c1
850 nmdc:mga08x19_21900_c1
851 nmdc:mga08x19_57112_c1
852 nmdc:mga08x19_73821_c1
853 nmdc:mga0a205_136782_c2
854 nmdc:mga0a205_180_c1
855 nmdc:mga0a205_3325_c1
856 Ga0495619_0235134
857 Ga0500578_0098930
858 Ga0500566_0006746
859 Ga0500566_0047802
860 Ga0500566_0061800
861 Ga0500640_002124
862 Ga0500554_003992
863 Ga0500572_006670
864 Ga0500595_000080
865 Ga0500597_008375
866 Ga0500597_038346
867 Ga0500614_004088
868 Ga0500614_011779
869 Ga0500642_0131491
870 Ga0500568_0014581
871 Ga0500568_0031811
872 Ga0500603_008037
873 Ga0500603_009755
874 Ga0500616_0034986
875 Ga0500619_122257
876 Ga0500639_043113
877 Ga0500637_0071344
878 Ga0501084_0006197
879 Ga0501084_0019144
880 Ga0501082_0083114
881 Ga0501082_0658305
882 Ga0530510_0013910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

44

251

0.76

PF00149

Metallophos

Calcineurin-like phosphoesterase

44

229

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8706 1 244
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8671 1 244
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8624 1 244
3rqz-assembly3.cif.gz_C crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.856 1 244
3rqz-assembly1.cif.gz_A crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.8522 1 244
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9104 3 244 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9029 3 244 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8623 3 244 3.60.21.10
3rqzB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8553 3 244 3.60.21.10
af_Q4CUW1_3_206_3.40.1000.50 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Repressor of RNA polymerase III transcription 0.7923 197 210 3.40.1000.50
ID Description Score Start End GO Terms
AF-A0A832EA52-F1-model_v4 deleted 0.9968 1 244
AF-A0A2E7BR76-F1-model_v4 Metallophosphoesterase 0.9933 1 244 GO:0005737
GO:0016791
AF-A0A3A4JZ36-F1-model_v4 Metallophosphoesterase 0.992 1 244 GO:0005737
GO:0016791
AF-A0A0D6QHK0-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9918 1 244 GO:0005737
GO:0016791
AF-A0A2E7BR76-F1-model_v4 Metallophosphoesterase 0.9893 1 244 GO:0005737
GO:0016791

Map