F444659

General Info

Members Datasets Scaffolds Average Seq Length
441 211 440 308

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10005433|Ga0157380_100054337
Length 351
Sequence MLKFNLYDIFLNIIETIFKSQNPPSAIRKYAISFTMEKTISKNKSFSTNGTSEKKAPSKRIEVLKTYKIYIGGQFPRTESGRYYIAKNSKGEQLANVCLSSRKDFRDAVVAARSASKGWAARAAFNRGQILYRIAEMLEGRKVQFIEELMQQDASKAQAQKEVSLSIDRLVYYAGWCDKYQQLFGTVNPVASSHFNFSVPEPTGVVAAIAPQDNSLLGLVSIIAPIIAGGNVCIILASESKPLCSVTFAEVINSSDTPGGVVNILTGKPSELAPHFSSHMDVNAIISTLEDKKLNKEMQEKGADNVKRVLIYDSINWFSAAGESPYFIMDTQEIKTTWHPIENIGGGGAKY

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
171 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 1.13
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1084371 2162886006 Unclassified 2171
2 SwRhRL3b_contig_599329 2162886006 Unclassified 2169
3 SwRhRL3b_contig_805396 2162886006 Bacteria 1606
4 SwRhRL3b_contig_955947 2162886006 Unclassified 2230
5 rootH1_10289428 3300003323 Bacteria 1369
6 Ga0065704_10086894 3300005289 Bacteria 3074
7 Ga0065712_10002165 3300005290 Bacteria 5760
8 Ga0065712_10076727 3300005290 Bacteria 3612
9 Ga0065712_10084322 3300005290 Bacteria 2772
10 Ga0065715_10186949 3300005293 Bacteria 1439
11 Ga0065707_10002579 3300005295 Bacteria 5614
12 Ga0070676_10027303 3300005328 Bacteria 3236
13 Ga0070676_10149076 3300005328 Unclassified 1496
14 Ga0070683_100012844 3300005329 Bacteria 7288
15 Ga0070683_100027068 3300005329 Bacteria 5169
16 Ga0070690_100046222 3300005330 Bacteria 2767
17 Ga0070690_100087538 3300005330 Bacteria 2046
18 Ga0070670_100009960 3300005331 Bacteria 8112
19 Ga0070670_100010832 3300005331 Bacteria 7789
20 Ga0070670_100042699 3300005331 Bacteria 3898
21 Ga0070670_100048830 3300005331 Bacteria 3641
22 Ga0070670_100055667 3300005331 Bacteria 3395
23 Ga0068869_100002728 3300005334 Bacteria 10689
24 Ga0068869_100043647 3300005334 Bacteria 3222
25 Ga0068869_100075503 3300005334 Bacteria 2504
26 Ga0068869_100111086 3300005334 Unclassified 2086
27 Ga0068869_100290387 3300005334 Bacteria 1317
28 Ga0070666_10015559 3300005335 Bacteria 4854
29 Ga0070682_100000005 3300005337 Bacteria 386439
30 Ga0070682_100116539 3300005337 Bacteria 1787
31 Ga0068868_100007333 3300005338 Bacteria 7852
32 Ga0068868_100043735 3300005338 Bacteria 3499
33 Ga0068868_100051193 3300005338 Bacteria 3247
34 Ga0070660_100024552 3300005339 Bacteria 4472
35 Ga0070660_100170861 3300005339 Bacteria 1756
36 Ga0070689_100009269 3300005340 Bacteria 6974
37 Ga0070689_100287010 3300005340 Bacteria 1367
38 Ga0070687_100055536 3300005343 Bacteria 2068
39 Ga0070661_100014434 3300005344 Bacteria 5567
40 Ga0070661_100021724 3300005344 Bacteria 4588
41 Ga0070661_100076732 3300005344 Bacteria 2463
42 Ga0070661_100236136 3300005344 Bacteria 1406
43 Ga0070668_100090666 3300005347 Bacteria 2408
44 Ga0070668_100109686 3300005347 Unclassified 2196
45 Ga0070669_100001860 3300005353 Bacteria 15189
46 Ga0070669_100113890 3300005353 Bacteria 2056
47 Ga0070675_100013409 3300005354 Bacteria 6441
48 Ga0070675_100038168 3300005354 Bacteria 3913
49 Ga0070671_100156258 3300005355 Bacteria 1927
50 Ga0070674_100053307 3300005356 Bacteria 2792
51 Ga0070674_100058492 3300005356 Bacteria 2680
52 Ga0070674_100253947 3300005356 Bacteria 1382
53 Ga0070673_100020053 3300005364 Bacteria 4813
54 Ga0070673_100134783 3300005364 Bacteria 2077
55 Ga0070673_100210853 3300005364 Bacteria 1677
56 Ga0070673_100216090 3300005364 Bacteria 1657
57 Ga0070673_100249185 3300005364 Bacteria 1547
58 Ga0070688_100003487 3300005365 Bacteria 8104
59 Ga0070688_100009062 3300005365 Bacteria 5427
60 Ga0070688_100107509 3300005365 Bacteria 1849
61 Ga0070659_100006466 3300005366 Bacteria 8462
62 Ga0070659_100018162 3300005366 Bacteria 5306
63 Ga0070667_100015753 3300005367 Bacteria 6252
64 Ga0070667_100052237 3300005367 Bacteria 3448
65 Ga0070667_100152937 3300005367 Bacteria 2028
66 Ga0070667_100380400 3300005367 Bacteria 1282
67 Ga0070709_10139417 3300005434 Bacteria 1664
68 Ga0070701_10053951 3300005438 Bacteria 2094
69 Ga0070701_10227335 3300005438 Bacteria 1116
70 Ga0070711_100002174 3300005439 Bacteria 11126
71 Ga0070705_100034206 3300005440 Bacteria 2839
72 Ga0070700_100074727 3300005441 Bacteria 2172
73 Ga0070678_100020422 3300005456 Bacteria 4346
74 Ga0070678_100117722 3300005456 Bacteria 2090
75 Ga0070678_100378474 3300005456 Bacteria 1224
76 Ga0070662_100001394 3300005457 Bacteria 14889
77 Ga0070662_100007840 3300005457 Bacteria 6935
78 Ga0070662_100008182 3300005457 Bacteria 6812
79 Ga0070662_100091169 3300005457 Bacteria 2289
80 Ga0070662_100121777 3300005457 Bacteria 2000
81 Ga0070681_10275012 3300005458 Bacteria 1595
82 Ga0068867_100060841 3300005459 Bacteria 2802
83 Ga0068867_100127621 3300005459 Bacteria 1973
84 Ga0068867_100171981 3300005459 Bacteria 1716
85 Ga0070685_10001218 3300005466 Bacteria 13676
86 Ga0070685_10004973 3300005466 Bacteria 6733
87 Ga0070685_10082978 3300005466 Bacteria 1924
88 Ga0070685_10296265 3300005466 Bacteria 1089
89 Ga0070706_100019430 3300005467 Bacteria 6266
90 Ga0070707_100000440 3300005468 Bacteria 41280
91 Ga0070698_100004094 3300005471 Bacteria 16016
92 Ga0070698_100024716 3300005471 Bacteria 6266
93 Ga0070698_100107463 3300005471 Bacteria 2758
94 Ga0070699_100077066 3300005518 Bacteria 2902
95 Ga0070684_100004426 3300005535 Bacteria 10694
96 Ga0070684_100007516 3300005535 Bacteria 8479
97 Ga0070684_100009945 3300005535 Bacteria 7519
98 Ga0070684_100213766 3300005535 Bacteria 1758
99 Ga0070684_100242411 3300005535 Bacteria 1647
100 Ga0068853_100008512 3300005539 Bacteria 8245
101 Ga0068853_100013323 3300005539 Bacteria 6713
102 Ga0068853_100170999 3300005539 Bacteria 1966
103 Ga0068853_100423681 3300005539 Bacteria 1248
104 Ga0070672_100249117 3300005543 Unclassified 1496
105 Ga0070672_100327557 3300005543 Bacteria 1303
106 Ga0070686_100124915 3300005544 Bacteria 1771
107 Ga0070665_100174876 3300005548 Bacteria 2148
108 Ga0070665_100469211 3300005548 Unclassified 1269
109 Ga0070664_100009584 3300005564 Bacteria 7855
110 Ga0070664_100017212 3300005564 Bacteria 5935
111 Ga0070664_100019394 3300005564 Bacteria 5596
112 Ga0070664_100091342 3300005564 Bacteria 2635
113 Ga0070664_100146862 3300005564 Bacteria 2080
114 Ga0070664_100236411 3300005564 Bacteria 1639
115 Ga0070664_100451110 3300005564 Bacteria 1181
116 Ga0070664_100486527 3300005564 Bacteria 1136
117 Ga0068857_100013254 3300005577 Bacteria 7180
118 Ga0068857_100093131 3300005577 Unclassified 2698
119 Ga0068857_100158003 3300005577 Bacteria 2056
120 Ga0068857_100224660 3300005577 Bacteria 1716
121 Ga0068854_100016433 3300005578 Bacteria 4934
122 Ga0068856_100273409 3300005614 Bacteria 1705
123 Ga0068852_100001054 3300005616 Bacteria 18187
124 Ga0068852_100044794 3300005616 Bacteria 3761
125 Ga0068852_100049435 3300005616 Bacteria 3598
126 Ga0068859_100005728 3300005617 Bacteria 12637
127 Ga0068859_100183611 3300005617 Bacteria 2175
128 Ga0068859_100339660 3300005617 Bacteria 1596
129 Ga0068859_100404847 3300005617 Bacteria 1460
130 Ga0068864_100006385 3300005618 Bacteria 9658
131 Ga0068864_100012605 3300005618 Bacteria 6991
132 Ga0068864_100109785 3300005618 Unclassified 2456
133 Ga0068864_100346571 3300005618 Bacteria 1400
134 Ga0068866_10038504 3300005718 Unclassified 2354
135 Ga0068866_10207052 3300005718 Bacteria 1175
136 Ga0068861_100020707 3300005719 Bacteria 4716
137 Ga0068861_100071960 3300005719 Unclassified 2681
138 Ga0068861_100326630 3300005719 Bacteria 1338
139 Ga0068861_100575965 3300005719 Bacteria 1030
140 Ga0068851_10025672 3300005834 Bacteria 2892
141 Ga0068851_10028001 3300005834 Bacteria 2781
142 Ga0068870_10015176 3300005840 Bacteria 3651
143 Ga0068870_10157796 3300005840 Bacteria 1342
144 Ga0068863_100028270 3300005841 Bacteria 5354
145 Ga0068863_100037437 3300005841 Bacteria 4619
146 Ga0068863_100113192 3300005841 Unclassified 2585
147 Ga0068863_100150196 3300005841 Unclassified 2229
148 Ga0068863_100229170 3300005841 Unclassified 1792
149 Ga0068858_100069273 3300005842 Bacteria 3270
150 Ga0068858_100090607 3300005842 Bacteria 2846
151 Ga0068858_100422125 3300005842 Bacteria 1283
152 Ga0068860_100021871 3300005843 Bacteria 6189
153 Ga0068860_100058042 3300005843 Bacteria 3679
154 Ga0068860_100242342 3300005843 Bacteria 1754
155 Ga0068860_100365340 3300005843 Bacteria 1423
156 Ga0068860_100370281 3300005843 Bacteria 1413
157 Ga0068862_100003226 3300005844 Bacteria 14125
158 Ga0068862_100035485 3300005844 Bacteria 4224
159 Ga0068862_100143478 3300005844 Bacteria 2121
160 Ga0068862_100255842 3300005844 Bacteria 1597
161 Ga0081539_10021815 3300005985 Bacteria 4263
162 Ga0070716_100112362 3300006173 Bacteria 1691
163 Ga0070712_100349025 3300006175 Bacteria 1210
164 Ga0075366_10067475 3300006195 Unclassified 2129
165 Ga0097621_100003042 3300006237 Bacteria 11511
166 Ga0097621_100068130 3300006237 Bacteria 2934
167 Ga0097621_100125327 3300006237 Bacteria 2182
168 Ga0068871_100190297 3300006358 Unclassified 1767
169 Ga0068871_100351993 3300006358 Bacteria 1303
170 Ga0075428_100014094 3300006844 Bacteria 8894
171 Ga0075428_100047315 3300006844 Bacteria 4725
172 Ga0075430_100003532 3300006846 Bacteria 13091
173 Ga0075431_100008504 3300006847 Bacteria 10277
174 Ga0075431_100109372 3300006847 Bacteria 2853
175 Ga0075434_100229844 3300006871 Bacteria 1874
176 Ga0075429_100003120 3300006880 Bacteria 14078
177 Ga0075429_100055649 3300006880 Bacteria 3442
178 Ga0068865_100076511 3300006881 Bacteria 2389
179 Ga0097620_100005728 3300006931 Bacteria 12637
180 Ga0097620_100183618 3300006931 Bacteria 2175
181 Ga0097620_100339668 3300006931 Bacteria 1596
182 Ga0097620_100404848 3300006931 Bacteria 1460
183 Ga0099795_10061854 3300007788 Bacteria 1391
184 Ga0105240_10462819 3300009093 Bacteria 1417
185 Ga0111539_10006109 3300009094 Bacteria 15547
186 Ga0111539_10166599 3300009094 Unclassified 2576
187 Ga0105247_10129364 3300009101 Bacteria 1644
188 Ga0105247_10163146 3300009101 Bacteria 1477
189 Ga0114129_10286792 3300009147 Unclassified 2198
190 Ga0105243_10053450 3300009148 Bacteria 3204
191 Ga0105241_10187769 3300009174 Bacteria 1718
192 Ga0105242_10016088 3300009176 Bacteria 5811
193 Ga0105242_10024135 3300009176 Bacteria 4800
194 Ga0105242_10037315 3300009176 Bacteria 3903
195 Ga0105242_10048857 3300009176 Bacteria 3440
196 Ga0105242_10076929 3300009176 Bacteria 2783
197 Ga0105242_10097456 3300009176 Bacteria 2486
198 Ga0105242_10174979 3300009176 Bacteria 1889
199 Ga0105242_10274794 3300009176 Bacteria 1528
200 Ga0105248_10455362 3300009177 Bacteria 1442
201 Ga0105249_10000971 3300009553 Bacteria 25411
202 Ga0105249_10002746 3300009553 Bacteria 15234
203 Ga0105249_10005140 3300009553 Bacteria 11289
204 Ga0105249_10006953 3300009553 Bacteria 9866
205 Ga0105249_10017276 3300009553 Bacteria 6404
206 Ga0105249_10033134 3300009553 Unclassified 4677
207 Ga0105249_10056967 3300009553 Bacteria 3579
208 Ga0105249_10098240 3300009553 Bacteria 2749
209 Ga0105239_10409828 3300010375 Bacteria 1535
210 Ga0105246_10051458 3300011119 Bacteria 2829
211 Ga0105246_10060938 3300011119 Bacteria 2623
212 Ga0157373_10027085 3300013100 Bacteria 4136
213 Ga0157373_10282427 3300013100 Unclassified 1177
214 Ga0157371_10020257 3300013102 Bacteria 4896
215 Ga0157369_10651438 3300013105 Unclassified 1086
216 Ga0157374_10000952 3300013296 Bacteria 25154
217 Ga0157378_10059655 3300013297 Bacteria 3404
218 Ga0157378_10306843 3300013297 Bacteria 1538
219 Ga0157378_10367979 3300013297 Bacteria 1408
220 Ga0157378_10369928 3300013297 Bacteria 1405
221 Ga0157378_10512751 3300013297 Bacteria 1200
222 Ga0163162_10010731 3300013306 Bacteria 8911
223 Ga0163162_10017585 3300013306 Bacteria 6996
224 Ga0163162_10025548 3300013306 Bacteria 5837
225 Ga0163162_10028437 3300013306 Bacteria 5532
226 Ga0163162_10107126 3300013306 Unclassified 2890
227 Ga0163162_10261665 3300013306 Unclassified 1862
228 Ga0157372_10001022 3300013307 Bacteria 30584
229 Ga0157372_10014191 3300013307 Bacteria 8512
230 Ga0157375_10009356 3300013308 Bacteria 8599
231 Ga0157375_10037227 3300013308 Bacteria 4660
232 Ga0157375_10040774 3300013308 Bacteria 4479
233 Ga0157375_10318691 3300013308 Unclassified 1719
234 Ga0157375_10332749 3300013308 Unclassified 1684
235 Ga0163163_10004860 3300014325 Bacteria 11547
236 Ga0163163_10028022 3300014325 Bacteria 5404
237 Ga0163163_10096627 3300014325 Bacteria 2975
238 Ga0163163_10163122 3300014325 Bacteria 2274
239 Ga0157380_10000516 3300014326 Bacteria 23691
240 Ga0157380_10005433 3300014326 Bacteria 8903
241 Ga0157380_10068136 3300014326 Unclassified 2868
242 Ga0157377_10011000 3300014745 Bacteria 4500
243 Ga0157377_10043367 3300014745 Bacteria 2503
244 Ga0157379_10327120 3300014968 Bacteria 1400
245 Ga0157376_10013658 3300014969 Bacteria 6068
246 Ga0157376_10022265 3300014969 Bacteria 4936
247 Ga0157376_10063096 3300014969 Unclassified 3120
248 Ga0163161_10111263 3300017792 Bacteria 2047
249 Ga0163161_10113608 3300017792 Bacteria 2027
250 Ga0163161_10131798 3300017792 Bacteria 1886
251 Ga0207656_10058568 3300025321 Bacteria 1683
252 Ga0207642_10010060 3300025899 Bacteria 3316
253 Ga0207642_10171300 3300025899 Bacteria 1175
254 Ga0207710_10164109 3300025900 Bacteria 1083
255 Ga0207680_10011314 3300025903 Bacteria 4504
256 Ga0207680_10153535 3300025903 Bacteria 1537
257 Ga0207647_10000279 3300025904 Bacteria 41622
258 Ga0207647_10046543 3300025904 Bacteria 2703
259 Ga0207645_10000093 3300025907 Bacteria 64854
260 Ga0207645_10009301 3300025907 Bacteria 6805
261 Ga0207643_10068123 3300025908 Unclassified 2044
262 Ga0207663_10015285 3300025916 Bacteria 4232
263 Ga0207662_10016819 3300025918 Bacteria 4130
264 Ga0207649_10011162 3300025920 Bacteria 4946
265 Ga0207649_10056627 3300025920 Bacteria 2449
266 Ga0207649_10176531 3300025920 Unclassified 1492
267 Ga0207646_10001162 3300025922 Bacteria 33395
268 Ga0207681_10023850 3300025923 Bacteria 3918
269 Ga0207681_10143743 3300025923 Bacteria 1780
270 Ga0207650_10002993 3300025925 Bacteria 11654
271 Ga0207650_10030188 3300025925 Bacteria 3903
272 Ga0207650_10038936 3300025925 Bacteria 3474
273 Ga0207659_10079614 3300025926 Bacteria 2418
274 Ga0207659_10122121 3300025926 Unclassified 1997
275 Ga0207644_10060219 3300025931 Bacteria 2747
276 Ga0207644_10083573 3300025931 Bacteria 2365
277 Ga0207690_10012265 3300025932 Bacteria 5128
278 Ga0207690_10076290 3300025932 Bacteria 2327
279 Ga0207706_10002395 3300025933 Bacteria 18300
280 Ga0207706_10008204 3300025933 Bacteria 9635
281 Ga0207706_10011531 3300025933 Bacteria 8051
282 Ga0207706_10023508 3300025933 Bacteria 5535
283 Ga0207706_10113600 3300025933 Bacteria 2382
284 Ga0207706_10156993 3300025933 Bacteria 2000
285 Ga0207686_10002843 3300025934 Bacteria 9343
286 Ga0207686_10005531 3300025934 Bacteria 6775
287 Ga0207686_10143639 3300025934 Bacteria 1653
288 Ga0207686_10240384 3300025934 Bacteria 1318
289 Ga0207709_10048603 3300025935 Bacteria 2585
290 Ga0207670_10016033 3300025936 Bacteria 4494
291 Ga0207670_10022814 3300025936 Bacteria 3885
292 Ga0207669_10044369 3300025937 Bacteria 2611
293 Ga0207691_10036619 3300025940 Bacteria 4546
294 Ga0207691_10179210 3300025940 Unclassified 1852
295 Ga0207691_10276016 3300025940 Bacteria 1447
296 Ga0207689_10004426 3300025942 Bacteria 12750
297 Ga0207689_10007188 3300025942 Bacteria 9780
298 Ga0207689_10025449 3300025942 Bacteria 4960
299 Ga0207689_10027239 3300025942 Unclassified 4785
300 Ga0207689_10326812 3300025942 Bacteria 1273
301 Ga0207661_10003477 3300025944 Bacteria 10936
302 Ga0207661_10032447 3300025944 Bacteria 4046
303 Ga0207661_10041007 3300025944 Bacteria 3642
304 Ga0207679_10004830 3300025945 Bacteria 8404
305 Ga0207679_10010463 3300025945 Bacteria 5974
306 Ga0207651_10011344 3300025960 Bacteria 4987
307 Ga0207651_10027230 3300025960 Bacteria 3587
308 Ga0207651_10050697 3300025960 Bacteria 2820
309 Ga0207651_10110457 3300025960 Unclassified 2062
310 Ga0207651_10183750 3300025960 Bacteria 1661
311 Ga0207712_10014288 3300025961 Bacteria 5104
312 Ga0207712_10025041 3300025961 Bacteria 3961
313 Ga0207712_10047531 3300025961 Bacteria 2980
314 Ga0207712_10097582 3300025961 Unclassified 2177
315 Ga0207712_10141870 3300025961 Unclassified 1845
316 Ga0207640_10047738 3300025981 Bacteria 2764
317 Ga0207658_10138185 3300025986 Bacteria 1968
318 Ga0207658_10343384 3300025986 Unclassified 1298
319 Ga0207677_10012659 3300026023 Bacteria 4859
320 Ga0207677_10025726 3300026023 Bacteria 3676
321 Ga0207677_10027783 3300026023 Bacteria 3570
322 Ga0207703_10015589 3300026035 Bacteria 5928
323 Ga0207703_10352508 3300026035 Unclassified 1355
324 Ga0207639_10008997 3300026041 Bacteria 6876
325 Ga0207639_10014313 3300026041 Bacteria 5575
326 Ga0207678_10108214 3300026067 Bacteria 2371
327 Ga0207708_10233253 3300026075 Unclassified 1478
328 Ga0207708_10250445 3300026075 Bacteria 1427
329 Ga0207702_10070466 3300026078 Bacteria 3007
330 Ga0207641_10005179 3300026088 Bacteria 11143
331 Ga0207641_10011490 3300026088 Bacteria 7269
332 Ga0207641_10012722 3300026088 Bacteria 6899
333 Ga0207641_10039386 3300026088 Bacteria 3952
334 Ga0207641_10119596 3300026088 Bacteria 2348
335 Ga0207648_10001844 3300026089 Bacteria 23186
336 Ga0207648_10002814 3300026089 Bacteria 18440
337 Ga0207648_10277130 3300026089 Bacteria 1499
338 Ga0207648_10280628 3300026089 Bacteria 1489
339 Ga0207676_10008139 3300026095 Bacteria 7454
340 Ga0207676_10014772 3300026095 Bacteria 5624
341 Ga0207676_10185499 3300026095 Bacteria 1825
342 Ga0207674_10009670 3300026116 Bacteria 10991
343 Ga0207674_10010788 3300026116 Bacteria 10305
344 Ga0207674_10069232 3300026116 Bacteria 3550
345 Ga0207674_10134661 3300026116 Unclassified 2433
346 Ga0207674_10215149 3300026116 Bacteria 1870
347 Ga0207675_100007097 3300026118 Bacteria 10588
348 Ga0207675_100007348 3300026118 Bacteria 10407
349 Ga0207675_100128274 3300026118 Bacteria 2404
350 Ga0207675_100351441 3300026118 Bacteria 1445
351 Ga0207675_100360184 3300026118 Bacteria 1427
352 Ga0207683_10000788 3300026121 Bacteria 28890
353 Ga0207683_10031231 3300026121 Bacteria 4622
354 Ga0207698_10011803 3300026142 Bacteria 5684
355 Ga0207698_10139734 3300026142 Bacteria 2084
356 Ga0207698_10483133 3300026142 Bacteria 1202
357 Ga0209995_1003069 3300027471 Bacteria 2652
358 Ga0209974_10014269 3300027876 Bacteria 2645
359 Ga0207428_10028437 3300027907 Bacteria 4645
360 Ga0268266_10354746 3300028379 Bacteria 1379
361 Ga0268265_10079788 3300028380 Bacteria 2579
362 Ga0268265_10240004 3300028380 Unclassified 1599
363 Ga0268264_10007189 3300028381 Bacteria 9326
364 Ga0268264_10022789 3300028381 Bacteria 5110
365 Ga0268264_10038121 3300028381 Bacteria 3965
366 Ga0268264_10373637 3300028381 Bacteria 1363
367 Ga0265338_10033333 3300028800 Bacteria 5000
368 Ga0265327_10002207 3300031251 Bacteria 21298
369 Ga0265327_10016689 3300031251 Bacteria 4648
370 Ga0265316_10299092 3300031344 Bacteria 1172
371 Ga0307408_100052780 3300031548 Bacteria 2934
372 Ga0265314_10258724 3300031711 Bacteria 995
373 Ga0307410_10065140 3300031852 Bacteria 2506
374 Ga0373934_0004961 3300035086 Bacteria 4933
375 Ga0373953_0040921 3300035117 Unclassified 1843
376 Ga0373943_0039065 3300035170 Bacteria 2285
377 Ga0373924_0083288 3300035410 Bacteria 1362
378 Ga0373927_0369806 3300035695 Bacteria 945
379 Ga0373947_0036843 3300035725 Unclassified 2901
380 Ga0373947_0098078 3300035725 Bacteria 1838
381 Ga0373937_0041159 3300036401 Unclassified 4215
382 Ga0373937_0089398 3300036401 Unclassified 2852
383 Ga0373925_0257302 3300037068 Bacteria 1402
384 Ga0395899_0000006 3300037312 Bacteria 666341
385 Ga0395899_0044931 3300037312 Bacteria 3290
386 Ga0395900_0235388 3300037418 Bacteria 1840
387 Ga0395900_0547254 3300037418 Bacteria 1102
388 Ga0395905_0000051 3300037471 Bacteria 223416
389 Ga0395905_0056947 3300037471 Bacteria 3656
390 Ga0395901_0009775 3300038443 Bacteria 9727
391 Ga0439439_0017226 3300041406 Unclassified 1775
392 Ga0451839_1631544 3300041496 Bacteria 1612
393 Ga0439441_000204 3300042001 Bacteria 5484
394 Ga0450898_002065 3300042134 Bacteria 2761
395 Ga0439446_0049942 3300042156 Unclassified 1248
396 Ga0451577_0000547 3300042876 Bacteria 61495
397 Ga0453684_0000039 3300044712 Bacteria 697730
398 Ga0453684_0190646 3300044712 Bacteria 2398
399 Ga0451576_0000003 3300045051 Bacteria 1550573
400 Ga0451576_0112097 3300045051 Bacteria 2839
401 Ga0495592_0069671 3300046454 Unclassified 2564
402 Ga0495653_0169573 3300046463 Bacteria 1508
403 Ga0495584_0054833 3300046491 Unclassified 2006
404 Ga0495608_0144606 3300046511 Bacteria 1517
405 Ga0495628_0157624 3300046516 Unclassified 1726
406 Ga0495630_0047907 3300046517 Bacteria 3198
407 Ga0495587_0086712 3300046536 Unclassified 1812
408 Ga0495621_0017969 3300046539 Bacteria 2292
409 Ga0495634_0010659 3300046642 Bacteria 6729
410 Ga0495659_0027300 3300046664 Bacteria 1969
411 Ga0495657_0106952 3300046675 Bacteria 1776
412 Ga0495604_0031570 3300047317 Bacteria 4201
413 Ga0495674_0113503 3300047319 Unclassified 2295
414 Ga0495680_0109711 3300047322 Unclassified 2046
415 Ga0495684_0024579 3300047471 Bacteria 4637
416 Ga0495686_0011271 3300047472 Bacteria 6302
417 Ga0496105_0297543 3300048908 Bacteria 1298
418 Ga0496105_0311471 3300048908 Bacteria 1264
419 Ga0496109_0016881 3300048912 Bacteria 6388
420 Ga0496112_0026428 3300048915 Bacteria 5585
421 Ga0496114_0418886 3300048917 Unclassified 1186
422 Ga0501031_0009178 3300049568 Bacteria 6429
423 Ga0501034_0000111 3300049571 Bacteria 150159
424 Ga0501036_0008624 3300049572 Bacteria 8365
425 Ga0501038_0112976 3300049574 Unclassified 2248
426 Ga0501043_0080327 3300049579 Bacteria 2562
427 Ga0501046_0106836 3300049580 Bacteria 2142
428 Ga0501035_0080407 3300049822 Bacteria 2878
429 Ga0501044_0008970 3300049823 Bacteria 10935
430 nmdc:mga09592_215511_c1 3300050508 Unclassified 1664
431 nmdc:mga09592_44571_c1 3300050508 Bacteria 3735
432 nmdc:mga06r32_50183_c1 3300050510 Bacteria 3991
433 nmdc:mga08y16_104540_c1 3300050511 Bacteria 2948
434 nmdc:mga08y16_376181_c1 3300050511 Bacteria 1456
435 nmdc:mga0n895_70054_c1 3300050512 Bacteria 3475
436 Ga0500641_0018976 3300053096 Unclassified 2594
437 Ga0500568_0000198 3300053139 Bacteria 52712
438 Ga0500568_0041685 3300053139 Bacteria 1844
439 Ga0500616_0001160 3300053153 Bacteria 26903
440 Ga0500611_000027 3300053727 Bacteria 93704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100171981 Ga0068867_1001719812 256
2 3300013306 Ga0163162_10017585 Ga0163162_100175853 256
3 3300026089 Ga0207648_10277130 Ga0207648_102771302 256
4 3300005718 Ga0068866_10038504 Ga0068866_100385043 260
5 3300035086 Ga0373934_0004961 Ga0373934_0004961_88_1041 260
6 3300035117 Ga0373953_0040921 Ga0373953_0040921_570_1523 260
7 3300035170 Ga0373943_0039065 Ga0373943_0039065_716_1669 260
8 3300035410 Ga0373924_0083288 Ga0373924_0083288_337_1290 260
9 3300036401 Ga0373937_0041159 Ga0373937_0041159_1672_2625 260
10 3300046454 Ga0495592_0069671 Ga0495592_0069671_802_1755 260
11 3300046463 Ga0495653_0169573 Ga0495653_0169573_278_1231 260
12 3300046511 Ga0495608_0144606 Ga0495608_0144606_519_1472 260
13 3300046516 Ga0495628_0157624 Ga0495628_0157624_633_1586 260
14 3300046517 Ga0495630_0047907 Ga0495630_0047907_1306_2259 260
15 3300046536 Ga0495587_0086712 Ga0495587_0086712_216_1169 260
16 3300046642 Ga0495634_0010659 Ga0495634_0010659_5235_6188 260
17 3300046675 Ga0495657_0106952 Ga0495657_0106952_805_1758 260
18 3300047317 Ga0495604_0031570 Ga0495604_0031570_2799_3752 260
19 3300047319 Ga0495674_0113503 Ga0495674_0113503_1076_2029 260
20 3300047322 Ga0495680_0109711 Ga0495680_0109711_95_1048 260
21 3300047471 Ga0495684_0024579 Ga0495684_0024579_920_1873 260
22 3300006237 Ga0097621_100003042 Ga0097621_1000030422 265
23 3300013297 Ga0157378_10059655 Ga0157378_100596552 265
24 3300013306 Ga0163162_10107126 Ga0163162_101071262 265
25 3300017792 Ga0163161_10113608 Ga0163161_101136082 265
26 3300048908 Ga0496105_0311471 Ga0496105_0311471_300_1253 265
27 3300005330 Ga0070690_100046222 Ga0070690_1000462222 268
28 3300005335 Ga0070666_10015559 Ga0070666_100155593 268
29 3300005344 Ga0070661_100076732 Ga0070661_1000767322 268
30 3300005355 Ga0070671_100156258 Ga0070671_1001562582 268
31 3300005456 Ga0070678_100020422 Ga0070678_1000204222 268
32 3300005457 Ga0070662_100001394 Ga0070662_10000139413 268
33 3300005614 Ga0068856_100273409 Ga0068856_1002734091 268
34 3300005834 Ga0068851_10025672 Ga0068851_100256722 268
35 3300005842 Ga0068858_100090607 Ga0068858_1000906072 268
36 3300009174 Ga0105241_10187769 Ga0105241_101877692 268
37 3300009176 Ga0105242_10097456 Ga0105242_100974562 268
38 3300010375 Ga0105239_10409828 Ga0105239_104098281 268
39 3300013296 Ga0157374_10000952 Ga0157374_100009529 268
40 3300013308 Ga0157375_10009356 Ga0157375_100093562 268
41 3300014325 Ga0163163_10096627 Ga0163163_100966272 268
42 3300014969 Ga0157376_10022265 Ga0157376_100222654 268
43 3300025321 Ga0207656_10058568 Ga0207656_100585682 268
44 3300025903 Ga0207680_10153535 Ga0207680_101535352 268
45 3300025920 Ga0207649_10056627 Ga0207649_100566272 268
46 3300025931 Ga0207644_10060219 Ga0207644_100602192 268
47 3300025933 Ga0207706_10002395 Ga0207706_100023954 268
48 3300026121 Ga0207683_10031231 Ga0207683_100312311 268
49 3300048908 Ga0496105_0297543 Ga0496105_0297543_317_1270 268
50 3300048917 Ga0496114_0418886 Ga0496114_0418886_45_998 268
51 3300009101 Ga0105247_10129364 Ga0105247_101293641 269
52 3300031251 Ga0265327_10002207 Ga0265327_100022079 277
53 3300049571 Ga0501034_0000111 Ga0501034_0000111_140365_141321 277
54 3300005548 Ga0070665_100469211 Ga0070665_1004692111 279
55 3300038443 Ga0395901_0009775 Ga0395901_0009775_2482_3363 280
56 3300005293 Ga0065715_10186949 Ga0065715_101869492 281
57 3300005364 Ga0070673_100210853 Ga0070673_1002108532 281
58 3300005456 Ga0070678_100117722 Ga0070678_1001177222 281
59 3300005467 Ga0070706_100019430 Ga0070706_1000194306 281
60 3300005518 Ga0070699_100077066 Ga0070699_1000770662 281
61 3300005564 Ga0070664_100451110 Ga0070664_1004511101 281
62 3300005617 Ga0068859_100005728 Ga0068859_1000057285 281
63 3300005618 Ga0068864_100012605 Ga0068864_1000126055 281
64 3300005844 Ga0068862_100035485 Ga0068862_1000354854 281
65 3300006175 Ga0070712_100349025 Ga0070712_1003490252 281
66 3300006931 Ga0097620_100005728 Ga0097620_1000057285 281
67 3300026095 Ga0207676_10014772 Ga0207676_100147721 281
68 iso_pu_bacteria 2890804823 2890808048 281
69 3300005328 Ga0070676_10149076 Ga0070676_101490762 282
70 3300005331 Ga0070670_100009960 Ga0070670_1000099604 282
71 3300005356 Ga0070674_100053307 Ga0070674_1000533072 282
72 3300005367 Ga0070667_100052237 Ga0070667_1000522374 282
73 3300005471 Ga0070698_100107463 Ga0070698_1001074632 282
74 3300005543 Ga0070672_100327557 Ga0070672_1003275572 282
75 3300005577 Ga0068857_100158003 Ga0068857_1001580032 282
76 3300005843 Ga0068860_100021871 Ga0068860_1000218713 282
77 3300005843 Ga0068860_100058042 Ga0068860_1000580425 282
78 3300006195 Ga0075366_10067475 Ga0075366_100674752 282
79 3300009148 Ga0105243_10053450 Ga0105243_100534502 282
80 3300009176 Ga0105242_10076929 Ga0105242_100769292 282
81 3300009553 Ga0105249_10000971 Ga0105249_1000097115 282
82 3300009553 Ga0105249_10002746 Ga0105249_100027467 282
83 3300013100 Ga0157373_10282427 Ga0157373_102824272 282
84 3300013297 Ga0157378_10369928 Ga0157378_103699282 282
85 3300013306 Ga0163162_10025548 Ga0163162_100255484 282
86 3300014325 Ga0163163_10163122 Ga0163163_101631221 282
87 3300025899 Ga0207642_10010060 Ga0207642_100100604 282
88 3300025925 Ga0207650_10038936 Ga0207650_100389362 282
89 3300025935 Ga0207709_10048603 Ga0207709_100486032 282
90 3300025940 Ga0207691_10036619 Ga0207691_100366194 282
91 3300025961 Ga0207712_10014288 Ga0207712_100142884 282
92 3300025986 Ga0207658_10138185 Ga0207658_101381852 282
93 3300026089 Ga0207648_10002814 Ga0207648_1000281412 282
94 3300026116 Ga0207674_10069232 Ga0207674_100692323 282
95 3300026118 Ga0207675_100360184 Ga0207675_1003601842 282
96 3300028381 Ga0268264_10007189 Ga0268264_100071895 282
97 3300028381 Ga0268264_10022789 Ga0268264_100227893 282
98 3300031548 Ga0307408_100052780 Ga0307408_1000527802 282
99 3300031852 Ga0307410_10065140 Ga0307410_100651403 282
100 3300041406 Ga0439439_0017226 Ga0439439_0017226_441_1394 282
101 3300042134 Ga0450898_002065 Ga0450898_002065_166_1137 282
102 3300042156 Ga0439446_0049942 Ga0439446_0049942_25_978 282
103 3300053096 Ga0500641_0018976 Ga0500641_0018976_918_1871 282
104 3300053727 Ga0500611_000027 Ga0500611_000027_45323_46276 282
105 3300005290 Ga0065712_10076727 Ga0065712_100767272 283
106 3300005328 Ga0070676_10027303 Ga0070676_100273033 283
107 3300005334 Ga0068869_100075503 Ga0068869_1000755033 283
108 3300005334 Ga0068869_100290387 Ga0068869_1002903871 283
109 3300005338 Ga0068868_100007333 Ga0068868_1000073333 283
110 3300005340 Ga0070689_100287010 Ga0070689_1002870101 283
111 3300005347 Ga0070668_100090666 Ga0070668_1000906662 283
112 3300005364 Ga0070673_100020053 Ga0070673_1000200534 283
113 3300005364 Ga0070673_100249185 Ga0070673_1002491851 283
114 3300005365 Ga0070688_100107509 Ga0070688_1001075092 283
115 3300005367 Ga0070667_100152937 Ga0070667_1001529372 283
116 3300005459 Ga0068867_100060841 Ga0068867_1000608413 283
117 3300005466 Ga0070685_10296265 Ga0070685_102962651 283
118 3300005539 Ga0068853_100170999 Ga0068853_1001709992 283
119 3300005544 Ga0070686_100124915 Ga0070686_1001249152 283
120 3300005618 Ga0068864_100346571 Ga0068864_1003465712 283
121 3300005718 Ga0068866_10207052 Ga0068866_102070522 283
122 3300005719 Ga0068861_100326630 Ga0068861_1003266302 283
123 3300005719 Ga0068861_100575965 Ga0068861_1005759651 283
124 3300005841 Ga0068863_100028270 Ga0068863_1000282704 283
125 3300005841 Ga0068863_100037437 Ga0068863_1000374373 283
126 3300005843 Ga0068860_100365340 Ga0068860_1003653402 283
127 3300005843 Ga0068860_100370281 Ga0068860_1003702812 283
128 3300005844 Ga0068862_100255842 Ga0068862_1002558421 283
129 3300006237 Ga0097621_100068130 Ga0097621_1000681302 283
130 3300006237 Ga0097621_100125327 Ga0097621_1001253272 283
131 3300006358 Ga0068871_100190297 Ga0068871_1001902972 283
132 3300006844 Ga0075428_100047315 Ga0075428_1000473155 283
133 3300006847 Ga0075431_100109372 Ga0075431_1001093723 283
134 3300006880 Ga0075429_100003120 Ga0075429_1000031207 283
135 3300006881 Ga0068865_100076511 Ga0068865_1000765112 283
136 3300009093 Ga0105240_10462819 Ga0105240_104628191 283
137 3300009101 Ga0105247_10163146 Ga0105247_101631462 283
138 3300009176 Ga0105242_10016088 Ga0105242_100160882 283
139 3300009176 Ga0105242_10048857 Ga0105242_100488573 283
140 3300009176 Ga0105242_10174979 Ga0105242_101749792 283
141 3300009176 Ga0105242_10274794 Ga0105242_102747942 283
142 3300009553 Ga0105249_10005140 Ga0105249_100051408 283
143 3300009553 Ga0105249_10017276 Ga0105249_100172765 283
144 3300009553 Ga0105249_10098240 Ga0105249_100982402 283
145 3300011119 Ga0105246_10060938 Ga0105246_100609382 283
146 3300013306 Ga0163162_10261665 Ga0163162_102616653 283
147 3300013308 Ga0157375_10037227 Ga0157375_100372274 283
148 3300014326 Ga0157380_10068136 Ga0157380_100681361 283
149 3300014968 Ga0157379_10327120 Ga0157379_103271201 283
150 3300014969 Ga0157376_10013658 Ga0157376_100136582 283
151 3300025899 Ga0207642_10171300 Ga0207642_101713002 283
152 3300025900 Ga0207710_10164109 Ga0207710_101641092 283
153 3300025907 Ga0207645_10000093 Ga0207645_1000009347 283
154 3300025918 Ga0207662_10016819 Ga0207662_100168193 283
155 3300025923 Ga0207681_10143743 Ga0207681_101437432 283
156 3300025933 Ga0207706_10011531 Ga0207706_100115313 283
157 3300025934 Ga0207686_10002843 Ga0207686_100028432 283
158 3300025934 Ga0207686_10240384 Ga0207686_102403842 283
159 3300025937 Ga0207669_10044369 Ga0207669_100443692 283
160 3300025942 Ga0207689_10004426 Ga0207689_100044264 283
161 3300025942 Ga0207689_10027239 Ga0207689_100272393 283
162 3300025960 Ga0207651_10027230 Ga0207651_100272302 283
163 3300025960 Ga0207651_10110457 Ga0207651_101104572 283
164 3300025961 Ga0207712_10025041 Ga0207712_100250413 283
165 3300025961 Ga0207712_10047531 Ga0207712_100475312 283
166 3300025961 Ga0207712_10141870 Ga0207712_101418702 283
167 3300026023 Ga0207677_10012659 Ga0207677_100126592 283
168 3300026035 Ga0207703_10352508 Ga0207703_103525082 283
169 3300026088 Ga0207641_10005179 Ga0207641_100051797 283
170 3300026088 Ga0207641_10011490 Ga0207641_100114902 283
171 3300026088 Ga0207641_10012722 Ga0207641_100127225 283
172 3300026088 Ga0207641_10119596 Ga0207641_101195962 283
173 3300026089 Ga0207648_10001844 Ga0207648_1000184422 283
174 3300026118 Ga0207675_100007097 Ga0207675_1000070976 283
175 3300026121 Ga0207683_10000788 Ga0207683_1000078812 283
176 3300026142 Ga0207698_10483133 Ga0207698_104831331 283
177 3300028380 Ga0268265_10240004 Ga0268265_102400042 283
178 3300028381 Ga0268264_10373637 Ga0268264_103736371 283
179 3300028800 Ga0265338_10033333 Ga0265338_100333334 283
180 3300031344 Ga0265316_10299092 Ga0265316_102990922 283
181 3300036401 Ga0373937_0089398 Ga0373937_0089398_844_1797 283
182 3300047472 Ga0495686_0011271 Ga0495686_0011271_5081_6034 283
183 3300050508 nmdc:mga09592_44571_c1 nmdc:mga09592_44571_c1_1874_2827 283
184 3300050511 nmdc:mga08y16_376181_c1 nmdc:mga08y16_376181_c1_152_1105 283
185 3300053139 Ga0500568_0000198 Ga0500568_0000198_46704_47654 283
186 3300003323 rootH1_10289428 rootH1_102894281 284
187 3300005290 Ga0065712_10002165 Ga0065712_100021653 284
188 3300005334 Ga0068869_100111086 Ga0068869_1001110861 284
189 3300005353 Ga0070669_100001860 Ga0070669_1000018606 284
190 3300005354 Ga0070675_100013409 Ga0070675_1000134096 284
191 3300005365 Ga0070688_100003487 Ga0070688_1000034875 284
192 3300005367 Ga0070667_100380400 Ga0070667_1003804001 284
193 3300005438 Ga0070701_10053951 Ga0070701_100539512 284
194 3300005441 Ga0070700_100074727 Ga0070700_1000747271 284
195 3300005543 Ga0070672_100249117 Ga0070672_1002491172 284
196 3300005564 Ga0070664_100146862 Ga0070664_1001468623 284
197 3300005577 Ga0068857_100013254 Ga0068857_1000132541 284
198 3300005578 Ga0068854_100016433 Ga0068854_1000164332 284
199 3300005719 Ga0068861_100071960 Ga0068861_1000719602 284
200 3300005840 Ga0068870_10015176 Ga0068870_100151762 284
201 3300005844 Ga0068862_100003226 Ga0068862_1000032265 284
202 3300009094 Ga0111539_10006109 Ga0111539_100061092 284
203 3300009553 Ga0105249_10006953 Ga0105249_100069535 284
204 3300009553 Ga0105249_10033134 Ga0105249_100331342 284
205 3300014326 Ga0157380_10000516 Ga0157380_1000051613 284
206 3300025923 Ga0207681_10023850 Ga0207681_100238502 284
207 3300025933 Ga0207706_10023508 Ga0207706_100235082 284
208 3300025940 Ga0207691_10276016 Ga0207691_102760161 284
209 3300025960 Ga0207651_10050697 Ga0207651_100506973 284
210 3300025961 Ga0207712_10097582 Ga0207712_100975822 284
211 3300025981 Ga0207640_10047738 Ga0207640_100477381 284
212 3300026075 Ga0207708_10233253 Ga0207708_102332532 284
213 3300026118 Ga0207675_100007348 Ga0207675_1000073488 284
214 3300027907 Ga0207428_10028437 Ga0207428_100284372 284
215 3300050511 nmdc:mga08y16_104540_c1 nmdc:mga08y16_104540_c1_329_1282 284
216 3300006173 Ga0070716_100112362 Ga0070716_1001123622 285
217 3300026078 Ga0207702_10070466 Ga0207702_100704663 285
218 3300031711 Ga0265314_10258724 Ga0265314_102587241 285
219 3300037312 Ga0395899_0000006 Ga0395899_0000006_611399_612280 285
220 3300037312 Ga0395899_0044931 Ga0395899_0044931_1886_2767 285
221 3300037418 Ga0395900_0235388 Ga0395900_0235388_232_1113 285
222 3300037418 Ga0395900_0547254 Ga0395900_0547254_70_951 285
223 3300037471 Ga0395905_0000051 Ga0395905_0000051_48445_49326 285
224 3300037471 Ga0395905_0056947 Ga0395905_0056947_693_1574 285
225 3300042876 Ga0451577_0000547 Ga0451577_0000547_17766_18647 285
226 3300044712 Ga0453684_0000039 Ga0453684_0000039_378074_378955 285
227 3300046539 Ga0495621_0017969 Ga0495621_0017969_272_1225 285
228 3300031251 Ga0265327_10016689 Ga0265327_100166893 286
229 3300045051 Ga0451576_0000003 Ga0451576_0000003_573519_574403 286
230 3300053153 Ga0500616_0001160 Ga0500616_0001160_10806_11675 286
231 3300005468 Ga0070707_100000440 Ga0070707_10000044039 287
232 3300025922 Ga0207646_10001162 Ga0207646_1000116228 287
233 3300025926 Ga0207659_10122121 Ga0207659_101221212 287
234 3300005617 Ga0068859_100183611 Ga0068859_1001836112 288
235 3300005843 Ga0068860_100242342 Ga0068860_1002423423 288
236 3300006931 Ga0097620_100183618 Ga0097620_1001836182 288
237 3300009176 Ga0105242_10037315 Ga0105242_100373152 288
238 3300013297 Ga0157378_10306843 Ga0157378_103068432 288
239 3300025934 Ga0207686_10143639 Ga0207686_101436392 288
240 3300025942 Ga0207689_10025449 Ga0207689_100254494 288
241 3300005440 Ga0070705_100034206 Ga0070705_1000342063 289
242 3300009176 Ga0105242_10024135 Ga0105242_100241352 289
243 3300025934 Ga0207686_10005531 Ga0207686_100055314 289
244 3300035725 Ga0373947_0098078 Ga0373947_0098078_591_1484 289
245 2162886006 SwRhRL3b_contig_1084371 SwRhRL3b_0887.00001710 290
246 2162886006 SwRhRL3b_contig_599329 SwRhRL3b_0383.00001760 290
247 2162886006 SwRhRL3b_contig_805396 SwRhRL3b_0783.00000830 290
248 2162886006 SwRhRL3b_contig_955947 SwRhRL3b_0656.00000480 290
249 3300005289 Ga0065704_10086894 Ga0065704_100868942 290
250 3300005290 Ga0065712_10084322 Ga0065712_100843222 290
251 3300005295 Ga0065707_10002579 Ga0065707_100025796 290
252 3300005329 Ga0070683_100012844 Ga0070683_1000128444 290
253 3300005329 Ga0070683_100027068 Ga0070683_1000270682 290
254 3300005330 Ga0070690_100087538 Ga0070690_1000875382 290
255 3300005331 Ga0070670_100010832 Ga0070670_1000108324 290
256 3300005331 Ga0070670_100042699 Ga0070670_1000426992 290
257 3300005331 Ga0070670_100048830 Ga0070670_1000488303 290
258 3300005331 Ga0070670_100055667 Ga0070670_1000556673 290
259 3300005334 Ga0068869_100002728 Ga0068869_1000027282 290
260 3300005334 Ga0068869_100043647 Ga0068869_1000436473 290
261 3300005337 Ga0070682_100000005 Ga0070682_100000005292 290
262 3300005337 Ga0070682_100116539 Ga0070682_1001165392 290
263 3300005338 Ga0068868_100043735 Ga0068868_1000437353 290
264 3300005338 Ga0068868_100051193 Ga0068868_1000511934 290
265 3300005339 Ga0070660_100024552 Ga0070660_1000245525 290
266 3300005339 Ga0070660_100170861 Ga0070660_1001708611 290
267 3300005340 Ga0070689_100009269 Ga0070689_1000092695 290
268 3300005343 Ga0070687_100055536 Ga0070687_1000555362 290
269 3300005344 Ga0070661_100014434 Ga0070661_1000144344 290
270 3300005344 Ga0070661_100021724 Ga0070661_1000217242 290
271 3300005344 Ga0070661_100236136 Ga0070661_1002361361 290
272 3300005347 Ga0070668_100109686 Ga0070668_1001096862 290
273 3300005353 Ga0070669_100113890 Ga0070669_1001138902 290
274 3300005354 Ga0070675_100038168 Ga0070675_1000381684 290
275 3300005356 Ga0070674_100058492 Ga0070674_1000584921 290
276 3300005356 Ga0070674_100253947 Ga0070674_1002539471 290
277 3300005364 Ga0070673_100134783 Ga0070673_1001347831 290
278 3300005364 Ga0070673_100216090 Ga0070673_1002160902 290
279 3300005365 Ga0070688_100009062 Ga0070688_1000090622 290
280 3300005366 Ga0070659_100006466 Ga0070659_1000064662 290
281 3300005366 Ga0070659_100018162 Ga0070659_1000181622 290
282 3300005367 Ga0070667_100015753 Ga0070667_1000157535 290
283 3300005434 Ga0070709_10139417 Ga0070709_101394171 290
284 3300005438 Ga0070701_10227335 Ga0070701_102273351 290
285 3300005439 Ga0070711_100002174 Ga0070711_1000021748 290
286 3300005456 Ga0070678_100378474 Ga0070678_1003784741 290
287 3300005457 Ga0070662_100007840 Ga0070662_1000078402 290
288 3300005457 Ga0070662_100008182 Ga0070662_1000081827 290
289 3300005457 Ga0070662_100091169 Ga0070662_1000911693 290
290 3300005457 Ga0070662_100121777 Ga0070662_1001217771 290
291 3300005458 Ga0070681_10275012 Ga0070681_102750122 290
292 3300005459 Ga0068867_100127621 Ga0068867_1001276211 290
293 3300005466 Ga0070685_10001218 Ga0070685_1000121810 290
294 3300005466 Ga0070685_10004973 Ga0070685_100049735 290
295 3300005466 Ga0070685_10082978 Ga0070685_100829781 290
296 3300005471 Ga0070698_100004094 Ga0070698_10000409411 290
297 3300005471 Ga0070698_100024716 Ga0070698_1000247162 290
298 3300005535 Ga0070684_100004426 Ga0070684_1000044265 290
299 3300005535 Ga0070684_100007516 Ga0070684_1000075165 290
300 3300005535 Ga0070684_100009945 Ga0070684_1000099455 290
301 3300005535 Ga0070684_100213766 Ga0070684_1002137662 290
302 3300005535 Ga0070684_100242411 Ga0070684_1002424112 290
303 3300005539 Ga0068853_100008512 Ga0068853_1000085123 290
304 3300005539 Ga0068853_100013323 Ga0068853_1000133234 290
305 3300005539 Ga0068853_100423681 Ga0068853_1004236812 290
306 3300005548 Ga0070665_100174876 Ga0070665_1001748762 290
307 3300005564 Ga0070664_100009584 Ga0070664_1000095844 290
308 3300005564 Ga0070664_100017212 Ga0070664_1000172122 290
309 3300005564 Ga0070664_100019394 Ga0070664_1000193944 290
310 3300005564 Ga0070664_100091342 Ga0070664_1000913422 290
311 3300005564 Ga0070664_100236411 Ga0070664_1002364112 290
312 3300005564 Ga0070664_100486527 Ga0070664_1004865271 290
313 3300005577 Ga0068857_100093131 Ga0068857_1000931311 290
314 3300005577 Ga0068857_100224660 Ga0068857_1002246602 290
315 3300005616 Ga0068852_100001054 Ga0068852_1000010549 290
316 3300005616 Ga0068852_100044794 Ga0068852_1000447942 290
317 3300005616 Ga0068852_100049435 Ga0068852_1000494352 290
318 3300005617 Ga0068859_100339660 Ga0068859_1003396602 290
319 3300005617 Ga0068859_100404847 Ga0068859_1004048472 290
320 3300005618 Ga0068864_100006385 Ga0068864_1000063858 290
321 3300005618 Ga0068864_100109785 Ga0068864_1001097852 290
322 3300005719 Ga0068861_100020707 Ga0068861_1000207075 290
323 3300005834 Ga0068851_10028001 Ga0068851_100280013 290
324 3300005840 Ga0068870_10157796 Ga0068870_101577961 290
325 3300005841 Ga0068863_100113192 Ga0068863_1001131923 290
326 3300005841 Ga0068863_100150196 Ga0068863_1001501963 290
327 3300005841 Ga0068863_100229170 Ga0068863_1002291701 290
328 3300005842 Ga0068858_100069273 Ga0068858_1000692732 290
329 3300005842 Ga0068858_100422125 Ga0068858_1004221252 290
330 3300005844 Ga0068862_100143478 Ga0068862_1001434782 290
331 3300005985 Ga0081539_10021815 Ga0081539_100218152 290
332 3300006358 Ga0068871_100351993 Ga0068871_1003519931 290
333 3300006844 Ga0075428_100014094 Ga0075428_1000140942 290
334 3300006846 Ga0075430_100003532 Ga0075430_1000035328 290
335 3300006847 Ga0075431_100008504 Ga0075431_10000850411 290
336 3300006871 Ga0075434_100229844 Ga0075434_1002298442 290
337 3300006880 Ga0075429_100055649 Ga0075429_1000556492 290
338 3300006931 Ga0097620_100339668 Ga0097620_1003396682 290
339 3300006931 Ga0097620_100404848 Ga0097620_1004048482 290
340 3300007788 Ga0099795_10061854 Ga0099795_100618542 290
341 3300009094 Ga0111539_10166599 Ga0111539_101665991 290
342 3300009147 Ga0114129_10286792 Ga0114129_102867922 290
343 3300009177 Ga0105248_10455362 Ga0105248_104553622 290
344 3300009553 Ga0105249_10056967 Ga0105249_100569672 290
345 3300011119 Ga0105246_10051458 Ga0105246_100514582 290
346 3300013100 Ga0157373_10027085 Ga0157373_100270852 290
347 3300013102 Ga0157371_10020257 Ga0157371_100202574 290
348 3300013105 Ga0157369_10651438 Ga0157369_106514381 290
349 3300013297 Ga0157378_10367979 Ga0157378_103679792 290
350 3300013297 Ga0157378_10512751 Ga0157378_105127511 290
351 3300013306 Ga0163162_10010731 Ga0163162_100107316 290
352 3300013306 Ga0163162_10028437 Ga0163162_100284375 290
353 3300013307 Ga0157372_10001022 Ga0157372_100010229 290
354 3300013307 Ga0157372_10014191 Ga0157372_100141914 290
355 3300013308 Ga0157375_10040774 Ga0157375_100407744 290
356 3300013308 Ga0157375_10318691 Ga0157375_103186912 290
357 3300013308 Ga0157375_10332749 Ga0157375_103327492 290
358 3300014325 Ga0163163_10004860 Ga0163163_100048605 290
359 3300014325 Ga0163163_10028022 Ga0163163_100280224 290
360 3300014326 Ga0157380_10005433 Ga0157380_100054337 290
361 3300014745 Ga0157377_10011000 Ga0157377_100110003 290
362 3300014745 Ga0157377_10043367 Ga0157377_100433673 290
363 3300014969 Ga0157376_10063096 Ga0157376_100630962 290
364 3300017792 Ga0163161_10111263 Ga0163161_101112632 290
365 3300017792 Ga0163161_10131798 Ga0163161_101317982 290
366 3300025903 Ga0207680_10011314 Ga0207680_100113144 290
367 3300025904 Ga0207647_10000279 Ga0207647_100002799 290
368 3300025904 Ga0207647_10046543 Ga0207647_100465432 290
369 3300025907 Ga0207645_10009301 Ga0207645_100093017 290
370 3300025908 Ga0207643_10068123 Ga0207643_100681231 290
371 3300025916 Ga0207663_10015285 Ga0207663_100152851 290
372 3300025920 Ga0207649_10011162 Ga0207649_100111623 290
373 3300025920 Ga0207649_10176531 Ga0207649_101765312 290
374 3300025925 Ga0207650_10002993 Ga0207650_1000299310 290
375 3300025925 Ga0207650_10030188 Ga0207650_100301883 290
376 3300025926 Ga0207659_10079614 Ga0207659_100796142 290
377 3300025931 Ga0207644_10083573 Ga0207644_100835732 290
378 3300025932 Ga0207690_10012265 Ga0207690_100122654 290
379 3300025932 Ga0207690_10076290 Ga0207690_100762902 290
380 3300025933 Ga0207706_10008204 Ga0207706_100082044 290
381 3300025933 Ga0207706_10113600 Ga0207706_101136003 290
382 3300025933 Ga0207706_10156993 Ga0207706_101569932 290
383 3300025936 Ga0207670_10016033 Ga0207670_100160331 290
384 3300025936 Ga0207670_10022814 Ga0207670_100228142 290
385 3300025940 Ga0207691_10179210 Ga0207691_101792102 290
386 3300025942 Ga0207689_10007188 Ga0207689_100071885 290
387 3300025942 Ga0207689_10326812 Ga0207689_103268122 290
388 3300025944 Ga0207661_10003477 Ga0207661_100034773 290
389 3300025944 Ga0207661_10032447 Ga0207661_100324474 290
390 3300025944 Ga0207661_10041007 Ga0207661_100410074 290
391 3300025945 Ga0207679_10004830 Ga0207679_100048305 290
392 3300025945 Ga0207679_10010463 Ga0207679_100104632 290
393 3300025960 Ga0207651_10011344 Ga0207651_100113445 290
394 3300025960 Ga0207651_10183750 Ga0207651_101837501 290
395 3300025986 Ga0207658_10343384 Ga0207658_103433842 290
396 3300026023 Ga0207677_10025726 Ga0207677_100257263 290
397 3300026023 Ga0207677_10027783 Ga0207677_100277833 290
398 3300026035 Ga0207703_10015589 Ga0207703_100155893 290
399 3300026041 Ga0207639_10008997 Ga0207639_100089974 290
400 3300026041 Ga0207639_10014313 Ga0207639_100143134 290
401 3300026067 Ga0207678_10108214 Ga0207678_101082142 290
402 3300026075 Ga0207708_10250445 Ga0207708_102504451 290
403 3300026088 Ga0207641_10039386 Ga0207641_100393864 290
404 3300026089 Ga0207648_10280628 Ga0207648_102806282 290
405 3300026095 Ga0207676_10008139 Ga0207676_100081394 290
406 3300026095 Ga0207676_10185499 Ga0207676_101854992 290
407 3300026116 Ga0207674_10009670 Ga0207674_100096704 290
408 3300026116 Ga0207674_10010788 Ga0207674_100107884 290
409 3300026116 Ga0207674_10134661 Ga0207674_101346612 290
410 3300026116 Ga0207674_10215149 Ga0207674_102151492 290
411 3300026118 Ga0207675_100128274 Ga0207675_1001282743 290
412 3300026118 Ga0207675_100351441 Ga0207675_1003514412 290
413 3300026142 Ga0207698_10011803 Ga0207698_100118034 290
414 3300026142 Ga0207698_10139734 Ga0207698_101397342 290
415 3300027471 Ga0209995_1003069 Ga0209995_10030692 290
416 3300027876 Ga0209974_10014269 Ga0209974_100142692 290
417 3300028379 Ga0268266_10354746 Ga0268266_103547461 290
418 3300028380 Ga0268265_10079788 Ga0268265_100797882 290
419 3300028381 Ga0268264_10038121 Ga0268264_100381213 290
420 3300035695 Ga0373927_0369806 Ga0373927_0369806_46_918 290
421 3300035725 Ga0373947_0036843 Ga0373947_0036843_258_1130 290
422 3300037068 Ga0373925_0257302 Ga0373925_0257302_212_1084 290
423 3300041496 Ga0451839_1631544 Ga0451839_1631544_54_1007 290
424 3300042001 Ga0439441_000204 Ga0439441_000204_2901_3854 290
425 3300044712 Ga0453684_0190646 Ga0453684_0190646_77_1030 290
426 3300045051 Ga0451576_0112097 Ga0451576_0112097_1358_2311 290
427 3300046491 Ga0495584_0054833 Ga0495584_0054833_28_900 290
428 3300046664 Ga0495659_0027300 Ga0495659_0027300_616_1488 290
429 3300048912 Ga0496109_0016881 Ga0496109_0016881_4341_5213 290
430 3300048915 Ga0496112_0026428 Ga0496112_0026428_2690_3562 290
431 3300049568 Ga0501031_0009178 Ga0501031_0009178_1770_2720 290
432 3300049572 Ga0501036_0008624 Ga0501036_0008624_7313_8263 290
433 3300049574 Ga0501038_0112976 Ga0501038_0112976_598_1548 290
434 3300049579 Ga0501043_0080327 Ga0501043_0080327_1548_2519 290
435 3300049580 Ga0501046_0106836 Ga0501046_0106836_996_1946 290
436 3300049822 Ga0501035_0080407 Ga0501035_0080407_137_1087 290
437 3300049823 Ga0501044_0008970 Ga0501044_0008970_3067_4017 290
438 3300050508 nmdc:mga09592_215511_c1 nmdc:mga09592_215511_c1_385_1338 290
439 3300050510 nmdc:mga06r32_50183_c1 nmdc:mga06r32_50183_c1_1567_2520 290
440 3300050512 nmdc:mga0n895_70054_c1 nmdc:mga0n895_70054_c1_346_1299 290
441 3300053139 Ga0500568_0041685 Ga0500568_0041685_747_1700 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

76

337

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go4-assembly4.cif.gz_G crystal structure of pnpe in complex with nicotinamide adenine dinucleotide 0.9509 14 258
4ywe-assembly1.cif.gz_D crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.9473 15 258
4ywe-assembly2.cif.gz_H crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.9457 15 258
4o6r-assembly1.cif.gz_D crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia 0.9439 14 258
4go3-assembly4.cif.gz_E crystal structure of pnpe from pseudomonas sp. wbc-3 0.9436 12 258
ID Description Score Start End Superfamily
af_F1QGP1_508_771_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.957 10 259 3.40.605.10
af_O33340_2_231_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9472 30 259 3.40.605.10
af_B4G044_25_486_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9454 29 258 3.40.605.10
af_A0A0R0ESV8_56_300_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.944 14 234 3.40.605.10
af_P37685_40_498_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9436 29 258 1.10.520.10
ID Description Score Start End GO Terms
AF-A0A7Y4QMI7-F1-model_v4 Aldehyde dehydrogenase family protein 0.976 4 290 GO:0016491
AF-A0A136N837-F1-model_v4 Aldehyde dehydrogenase 0.9727 5 290 GO:0016491
AF-A0A2H0PD75-F1-model_v4 Aldehyde dehydrogenase 0.9705 7 290 GO:0016491
AF-A0A2T2S9B9-F1-model_v4 Aldehyde dehydrogenase 0.9688 39 290 GO:0016491
AF-A0A3C1Q195-F1-model_v4 Aldehyde dehydrogenase 0.9683 6 247 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map