F444477

General Info

Members Datasets Scaffolds Average Seq Length
440 222 880 130

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0271101|Ga0451577_0271101_859_1329
Length 156
Sequence MRLQSPKNTDIYVFFVSMPRQNGTLTMQRTNYASGAKWEDIVGYSRAVRVGNLVEVTGTVAVNDQQELVGGDSAYEQTLFILQKIEKILARAGAGLQDVVRTRMFVTDIARWEEYGKAHGAFFRDIRPCTTMVEVSRLIDPVFLIEIEATAIIPEN

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
175 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
181 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
182 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
186 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
189 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
190 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
191 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
192 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
193 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
196 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
197 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
201 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
202 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
203 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
204 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
205 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
206 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
207 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
208 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 0.91
Rhizosphere 96.36
Stem 0
Stem Tuber 0
Unclassified 21.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0271101 3300042876 Bacteria 1537
2 LJQas_1005536 3300000549 Bacteria 1599
3 Ga0065714_10310519 3300005288 Bacteria 679
4 Ga0065704_10010349 3300005289 Bacteria 2131
5 Ga0065712_10069395 3300005290 Bacteria 7387
6 Ga0065712_10424820 3300005290 Bacteria 708
7 Ga0065707_10082779 3300005295 Bacteria 12179
8 Ga0065707_10096233 3300005295 Bacteria 3284
9 Ga0065707_10129303 3300005295 Bacteria 1950
10 Ga0065707_10229669 3300005295 Bacteria 1193
11 Ga0070676_10005476 3300005328 Bacteria 6760
12 Ga0070676_10363438 3300005328 Bacteria 998
13 Ga0070683_102327071 3300005329 Unclassified 514
14 Ga0070690_100157698 3300005330 Unclassified 1553
15 Ga0070670_100002147 3300005331 Bacteria 16194
16 Ga0070670_100140392 3300005331 Bacteria 2089
17 Ga0070670_100779149 3300005331 Unclassified 863
18 Ga0070670_101115157 3300005331 Unclassified 720
19 Ga0070670_102107869 3300005331 Bacteria 520
20 Ga0070677_10027910 3300005333 Bacteria 2129
21 Ga0068869_100004838 3300005334 Bacteria 8409
22 Ga0068869_100163298 3300005334 Bacteria 1735
23 Ga0068869_100165565 3300005334 Bacteria 1724
24 Ga0070666_10641769 3300005335 Unclassified 776
25 Ga0070682_100159191 3300005337 Bacteria 1558
26 Ga0070682_100297942 3300005337 Bacteria 1182
27 Ga0070682_101194757 3300005337 Unclassified 641
28 Ga0068868_100001123 3300005338 Bacteria 18309
29 Ga0070660_100415943 3300005339 Bacteria 1113
30 Ga0070689_100100670 3300005340 Bacteria 2287
31 Ga0070689_100700159 3300005340 Bacteria 884
32 Ga0070687_100314293 3300005343 Bacteria 998
33 Ga0070661_100781011 3300005344 Unclassified 783
34 Ga0070668_100322302 3300005347 Unclassified 1301
35 Ga0070668_100981050 3300005347 Unclassified 759
36 Ga0070669_100156524 3300005353 Bacteria 1767
37 Ga0070669_100690461 3300005353 Bacteria 861
38 Ga0070669_101811986 3300005353 Bacteria 533
39 Ga0070671_100423195 3300005355 Unclassified 1141
40 Ga0070671_100486522 3300005355 Bacteria 1061
41 Ga0070674_100200517 3300005356 Bacteria 1541
42 Ga0070674_100298256 3300005356 Bacteria 1284
43 Ga0070673_100066774 3300005364 Bacteria 2874
44 Ga0070673_100219501 3300005364 Bacteria 1645
45 Ga0070673_100510126 3300005364 Unclassified 1089
46 Ga0070673_100593578 3300005364 Unclassified 1010
47 Ga0070701_10175204 3300005438 Bacteria 1252
48 Ga0070701_10562051 3300005438 Bacteria 750
49 Ga0070705_100649617 3300005440 Unclassified 822
50 Ga0070700_100280513 3300005441 Bacteria 1208
51 Ga0070663_100375183 3300005455 Bacteria 1157
52 Ga0070678_100238080 3300005456 Unclassified 1520
53 Ga0070662_100026382 3300005457 Bacteria 4024
54 Ga0070662_100065645 3300005457 Bacteria 2660
55 Ga0070662_101461901 3300005457 Bacteria 589
56 Ga0068867_100018835 3300005459 Bacteria 4911
57 Ga0068867_100095985 3300005459 Bacteria 2256
58 Ga0068867_100522496 3300005459 Bacteria 1024
59 Ga0070685_10016083 3300005466 Bacteria 3980
60 Ga0070707_100865442 3300005468 Unclassified 868
61 Ga0070698_100000282 3300005471 Bacteria 51827
62 Ga0070698_100001103 3300005471 Bacteria 29751
63 Ga0070698_100006847 3300005471 Bacteria 12348
64 Ga0068853_100386784 3300005539 Bacteria 1307
65 Ga0068853_101846199 3300005539 Bacteria 586
66 Ga0068853_102027563 3300005539 Bacteria 558
67 Ga0070672_100210441 3300005543 Unclassified 1628
68 Ga0070672_100276977 3300005543 Unclassified 1417
69 Ga0070672_100719379 3300005543 Unclassified 875
70 Ga0070672_101839723 3300005543 Unclassified 545
71 Ga0070686_100353878 3300005544 Bacteria 1104
72 Ga0070695_100910464 3300005545 Bacteria 711
73 Ga0070696_101089772 3300005546 Unclassified 671
74 Ga0070664_100206489 3300005564 Bacteria 1754
75 Ga0070664_100939591 3300005564 Bacteria 811
76 Ga0068857_101192393 3300005577 Bacteria 737
77 Ga0068859_100034396 3300005617 Bacteria 5086
78 Ga0068859_100422279 3300005617 Bacteria 1429
79 Ga0068859_100522820 3300005617 Bacteria 1281
80 Ga0068859_100663740 3300005617 Bacteria 1134
81 Ga0068859_103179247 3300005617 Unclassified 500
82 Ga0068864_100002659 3300005618 Bacteria 14761
83 Ga0068864_100068073 3300005618 Bacteria 3092
84 Ga0068864_101351367 3300005618 Bacteria 714
85 Ga0068861_100001502 3300005719 Bacteria 14807
86 Ga0068861_100230233 3300005719 Bacteria 1571
87 Ga0068861_100383432 3300005719 Bacteria 1242
88 Ga0068861_100950465 3300005719 Bacteria 817
89 Ga0068851_10295507 3300005834 Bacteria 930
90 Ga0068851_10892138 3300005834 Unclassified 557
91 Ga0068851_11066816 3300005834 Unclassified 512
92 Ga0068870_10412030 3300005840 Bacteria 882
93 Ga0068870_10520270 3300005840 Bacteria 796
94 Ga0068870_10786882 3300005840 Bacteria 663
95 Ga0068863_100200104 3300005841 Bacteria 1921
96 Ga0068863_100304855 3300005841 Unclassified 1545
97 Ga0068863_100542675 3300005841 Bacteria 1147
98 Ga0068858_100365843 3300005842 Bacteria 1382
99 Ga0068858_100619408 3300005842 Bacteria 1051
100 Ga0068860_100826227 3300005843 Unclassified 941
101 Ga0068860_101644056 3300005843 Archaea 664
102 Ga0068860_101789347 3300005843 Bacteria 636
103 Ga0068862_100441494 3300005844 Bacteria 1225
104 Ga0068862_101974136 3300005844 Bacteria 594
105 Ga0068862_102351749 3300005844 Bacteria 545
106 Ga0075427_10036043 3300006194 Bacteria 824
107 Ga0075366_10084901 3300006195 Bacteria 1893
108 Ga0097621_100005119 3300006237 Bacteria 9211
109 Ga0097621_100096067 3300006237 Bacteria 2486
110 Ga0097621_100149524 3300006237 Bacteria 2002
111 Ga0097621_100159877 3300006237 Unclassified 1936
112 Ga0097621_101041652 3300006237 Bacteria 766
113 Ga0068871_100066568 3300006358 Bacteria 2953
114 Ga0075428_100033491 3300006844 Bacteria 5673
115 Ga0075428_100158384 3300006844 Bacteria 2458
116 Ga0075428_100236354 3300006844 Unclassified 1972
117 Ga0075428_100711805 3300006844 Bacteria 1069
118 Ga0075428_100846086 3300006844 Bacteria 971
119 Ga0075430_100026948 3300006846 Bacteria 4887
120 Ga0075430_100055676 3300006846 Bacteria 3326
121 Ga0075430_101343523 3300006846 Unclassified 588
122 Ga0075431_100102780 3300006847 Bacteria 2949
123 Ga0075431_100374095 3300006847 Bacteria 1430
124 Ga0075431_100494753 3300006847 Unclassified 1214
125 Ga0075431_100706931 3300006847 Bacteria 985
126 Ga0075431_100724729 3300006847 Unclassified 971
127 Ga0075434_100455316 3300006871 Bacteria 1301
128 Ga0075434_101543363 3300006871 Bacteria 673
129 Ga0075429_100000261 3300006880 Bacteria 36762
130 Ga0075429_100050628 3300006880 Unclassified 3614
131 Ga0075429_100539202 3300006880 Bacteria 1022
132 Ga0075429_100687843 3300006880 Bacteria 896
133 Ga0068865_100474277 3300006881 Bacteria 1039
134 Ga0068865_100503745 3300006881 Unclassified 1010
135 Ga0068865_101166909 3300006881 Bacteria 681
136 Ga0097620_100034396 3300006931 Bacteria 5086
137 Ga0097620_100422299 3300006931 Bacteria 1429
138 Ga0097620_100522827 3300006931 Bacteria 1281
139 Ga0097620_100663747 3300006931 Bacteria 1134
140 Ga0097620_103181121 3300006931 Unclassified 500
141 Ga0105240_10607382 3300009093 Bacteria 1203
142 Ga0105240_11394775 3300009093 Bacteria 737
143 Ga0105240_12044904 3300009093 Unclassified 595
144 Ga0111539_10064971 3300009094 Bacteria 4315
145 Ga0111539_10665061 3300009094 Unclassified 1213
146 Ga0111539_10671140 3300009094 Unclassified 1207
147 Ga0111539_10767735 3300009094 Bacteria 1122
148 Ga0114129_10264911 3300009147 Bacteria 2301
149 Ga0114129_10433129 3300009147 Bacteria 1727
150 Ga0105243_10530286 3300009148 Unclassified 1121
151 Ga0105242_10059633 3300009176 Bacteria 3132
152 Ga0105242_10277045 3300009176 Bacteria 1522
153 Ga0105242_10965898 3300009176 Bacteria 857
154 Ga0105248_10701519 3300009177 Bacteria 1142
155 Ga0105249_10000635 3300009553 Bacteria 32011
156 Ga0105249_10052701 3300009553 Unclassified 3716
157 Ga0105249_10772775 3300009553 Unclassified 1023
158 Ga0105249_10988392 3300009553 Bacteria 910
159 Ga0105249_11963044 3300009553 Bacteria 658
160 Ga0099796_10099448 3300010159 Unclassified 1092
161 Ga0105246_10136955 3300011119 Bacteria 1836
162 Ga0105246_12425191 3300011119 Unclassified 515
163 Ga0157373_10194416 3300013100 Bacteria 1430
164 Ga0157369_10652389 3300013105 Bacteria 1085
165 Ga0157378_10014044 3300013297 Bacteria 7011
166 Ga0157378_10015554 3300013297 Bacteria 6664
167 Ga0157378_10226488 3300013297 Bacteria 1779
168 Ga0157378_10287810 3300013297 Bacteria 1586
169 Ga0163162_10002830 3300013306 Bacteria 16503
170 Ga0163162_10063356 3300013306 Bacteria 3740
171 Ga0163162_10077963 3300013306 Bacteria 3378
172 Ga0163162_10100451 3300013306 Bacteria 2984
173 Ga0163162_12019012 3300013306 Unclassified 661
174 Ga0157372_10185587 3300013307 Bacteria 2408
175 Ga0157372_10321918 3300013307 Unclassified 1800
176 Ga0157372_10595751 3300013307 Bacteria 1288
177 Ga0157375_10033658 3300013308 Bacteria 4872
178 Ga0157375_10047979 3300013308 Bacteria 4175
179 Ga0157375_10325020 3300013308 Bacteria 1703
180 Ga0157375_10533694 3300013308 Bacteria 1336
181 Ga0157375_10576537 3300013308 Bacteria 1286
182 Ga0157375_10586068 3300013308 Bacteria 1275
183 Ga0163163_10365147 3300014325 Unclassified 1500
184 Ga0163163_10929424 3300014325 Bacteria 933
185 Ga0163163_11416184 3300014325 Bacteria 757
186 Ga0163163_11663046 3300014325 Bacteria 699
187 Ga0157380_10093409 3300014326 Bacteria 2487
188 Ga0157380_10102469 3300014326 Bacteria 2387
189 Ga0157380_10102780 3300014326 Bacteria 2383
190 Ga0157380_10261125 3300014326 Unclassified 1573
191 Ga0157380_11863957 3300014326 Bacteria 661
192 Ga0157377_10225912 3300014745 Bacteria 1201
193 Ga0157377_10337527 3300014745 Bacteria 1007
194 Ga0157376_10013459 3300014969 Bacteria 6103
195 Ga0157376_10068023 3300014969 Bacteria 3015
196 Ga0163161_10053047 3300017792 Bacteria 2940
197 Ga0163161_10073554 3300017792 Bacteria 2504
198 Ga0163161_10373571 3300017792 Bacteria 1138
199 Ga0163161_10603829 3300017792 Bacteria 905
200 Ga0207666_1014382 3300025271 Bacteria 1118
201 Ga0207697_10189893 3300025315 Unclassified 902
202 Ga0207697_10265744 3300025315 Bacteria 760
203 Ga0207656_10255454 3300025321 Bacteria 859
204 Ga0207682_10013215 3300025893 Bacteria 3219
205 Ga0207642_10008516 3300025899 Bacteria 3523
206 Ga0207688_10574430 3300025901 Bacteria 709
207 Ga0207688_10751853 3300025901 Bacteria 617
208 Ga0207685_10363379 3300025905 Bacteria 733
209 Ga0207645_10029888 3300025907 Bacteria 3512
210 Ga0207645_10077405 3300025907 Bacteria 2131
211 Ga0207645_10736785 3300025907 Bacteria 670
212 Ga0207643_10647037 3300025908 Bacteria 682
213 Ga0207662_10068829 3300025918 Bacteria 2138
214 Ga0207662_10111437 3300025918 Unclassified 1706
215 Ga0207657_10087426 3300025919 Bacteria 2607
216 Ga0207646_11257226 3300025922 Unclassified 648
217 Ga0207681_10159681 3300025923 Bacteria 1698
218 Ga0207681_10694327 3300025923 Bacteria 846
219 Ga0207681_11586716 3300025923 Bacteria 548
220 Ga0207650_10035800 3300025925 Bacteria 3608
221 Ga0207650_10068612 3300025925 Bacteria 2663
222 Ga0207650_10167371 3300025925 Bacteria 1745
223 Ga0207650_10476908 3300025925 Unclassified 1041
224 Ga0207650_10972729 3300025925 Unclassified 722
225 Ga0207659_10634405 3300025926 Unclassified 912
226 Ga0207659_11777010 3300025926 Unclassified 524
227 Ga0207644_10132353 3300025931 Bacteria 1911
228 Ga0207644_10140239 3300025931 Bacteria 1861
229 Ga0207644_10343532 3300025931 Bacteria 1211
230 Ga0207644_11141965 3300025931 Bacteria 655
231 Ga0207706_10010648 3300025933 Bacteria 8399
232 Ga0207706_10019282 3300025933 Bacteria 6134
233 Ga0207686_10000372 3300025934 Bacteria 31309
234 Ga0207686_10350477 3300025934 Bacteria 1111
235 Ga0207709_11678925 3300025935 Unclassified 528
236 Ga0207670_10006924 3300025936 Bacteria 6310
237 Ga0207670_10900254 3300025936 Bacteria 741
238 Ga0207669_10426318 3300025937 Bacteria 1045
239 Ga0207669_11277003 3300025937 Bacteria 623
240 Ga0207704_10084231 3300025938 Unclassified 2066
241 Ga0207704_11372365 3300025938 Bacteria 605
242 Ga0207691_10066743 3300025940 Unclassified 3254
243 Ga0207691_10083887 3300025940 Bacteria 2861
244 Ga0207711_11067374 3300025941 Bacteria 748
245 Ga0207689_10111471 3300025942 Bacteria 2249
246 Ga0207689_10704852 3300025942 Bacteria 851
247 Ga0207679_10834308 3300025945 Unclassified 841
248 Ga0207679_10887669 3300025945 Bacteria 815
249 Ga0207651_10406729 3300025960 Unclassified 1159
250 Ga0207651_10637604 3300025960 Bacteria 934
251 Ga0207651_10660620 3300025960 Unclassified 918
252 Ga0207651_10787429 3300025960 Bacteria 842
253 Ga0207712_10001470 3300025961 Bacteria 16071
254 Ga0207712_10013437 3300025961 Bacteria 5247
255 Ga0207712_10088938 3300025961 Unclassified 2269
256 Ga0207712_10322304 3300025961 Bacteria 1275
257 Ga0207668_10186694 3300025972 Bacteria 1639
258 Ga0207668_10463643 3300025972 Unclassified 1084
259 Ga0207658_10150963 3300025986 Bacteria 1893
260 Ga0207658_10157297 3300025986 Bacteria 1859
261 Ga0207677_10000816 3300026023 Bacteria 17807
262 Ga0207677_10473563 3300026023 Bacteria 1077
263 Ga0207703_10549990 3300026035 Bacteria 1088
264 Ga0207703_11984902 3300026035 Bacteria 558
265 Ga0207639_10346275 3300026041 Bacteria 1326
266 Ga0207639_10390746 3300026041 Bacteria 1251
267 Ga0207639_10603003 3300026041 Unclassified 1013
268 Ga0207678_10143542 3300026067 Bacteria 2038
269 Ga0207708_10129356 3300026075 Bacteria 1973
270 Ga0207641_10002324 3300026088 Bacteria 17635
271 Ga0207641_10023847 3300026088 Bacteria 5043
272 Ga0207641_10196227 3300026088 Bacteria 1858
273 Ga0207641_10220612 3300026088 Bacteria 1758
274 Ga0207641_10283331 3300026088 Unclassified 1559
275 Ga0207641_11447090 3300026088 Unclassified 688
276 Ga0207641_11497362 3300026088 Bacteria 676
277 Ga0207648_10013448 3300026089 Bacteria 7615
278 Ga0207648_10069280 3300026089 Bacteria 3074
279 Ga0207648_10343551 3300026089 Bacteria 1344
280 Ga0207648_10641533 3300026089 Unclassified 981
281 Ga0207676_10008363 3300026095 Bacteria 7355
282 Ga0207676_10055008 3300026095 Bacteria 3121
283 Ga0207676_10437080 3300026095 Unclassified 1231
284 Ga0207674_10223157 3300026116 Bacteria 1833
285 Ga0207674_11340846 3300026116 Unclassified 685
286 Ga0207675_100009007 3300026118 Bacteria 9365
287 Ga0207675_100428433 3300026118 Bacteria 1307
288 Ga0207675_100665937 3300026118 Bacteria 1048
289 Ga0207683_10019223 3300026121 Bacteria 5832
290 Ga0207683_11046716 3300026121 Unclassified 757
291 Ga0207698_10270342 3300026142 Bacteria 1567
292 Ga0207698_10544885 3300026142 Unclassified 1136
293 Ga0207698_11107988 3300026142 Bacteria 804
294 Ga0207428_10818215 3300027907 Bacteria 661
295 Ga0268265_10414953 3300028380 Bacteria 1248
296 Ga0268265_10498413 3300028380 Bacteria 1147
297 Ga0268265_11552332 3300028380 Bacteria 666
298 Ga0268264_10104552 3300028381 Bacteria 2468
299 Ga0268264_12202342 3300028381 Unclassified 559
300 Ga0265327_10211346 3300031251 Bacteria 875
301 Ga0265316_10786133 3300031344 Bacteria 668
302 Ga0307513_10741385 3300031456 Bacteria 688
303 Ga0265313_10011933 3300031595 Bacteria 5360
304 Ga0307405_12054377 3300031731 Unclassified 512
305 Ga0307410_11541938 3300031852 Bacteria 586
306 Ga0307414_10046302 3300032004 Bacteria 2985
307 Ga0307411_10158444 3300032005 Bacteria 1692
308 Ga0307411_11147350 3300032005 Bacteria 702
309 Ga0373933_0031057 3300035724 Bacteria 3097
310 Ga0373937_0129441 3300036401 Bacteria 2357
311 Ga0436364_0239634 3300037853 Bacteria 1326
312 Ga0436361_0619131 3300039447 Bacteria 36149
313 Ga0436363_1409231 3300039450 Bacteria 1215
314 Ga0451807_0441096 3300041486 Unclassified 620
315 Ga0451807_0783376 3300041486 Unclassified 1772
316 Ga0451807_1567040 3300041486 Bacteria 1964
317 Ga0451851_1051485 3300041507 Bacteria 762
318 Ga0451853_0331824 3300041512 Bacteria 905
319 Ga0439441_006118 3300042001 Bacteria 1896
320 Ga0439441_085560 3300042001 Bacteria 692
321 Ga0439441_160615 3300042001 Bacteria 533
322 Ga0439450_087801 3300042008 Bacteria 779
323 Ga0439435_0180174 3300042436 Bacteria 690
324 Ga0439435_0198318 3300042436 Bacteria 661
325 Ga0451577_0000201 3300042876 Bacteria 124889
326 Ga0451577_0612495 3300042876 Bacteria 988
327 Ga0466972_0400317 3300044658 Bacteria 643
328 Ga0453683_0000406 3300044673 Bacteria 50333
329 Ga0453683_0025329 3300044673 Bacteria 3770
330 Ga0453683_0062387 3300044673 Unclassified 2330
331 Ga0453683_0369499 3300044673 Unclassified 922
332 Ga0453684_0000038 3300044712 Bacteria 706970
333 Ga0453684_0055363 3300044712 Bacteria 5157
334 Ga0453684_0170314 3300044712 Bacteria 2567
335 Ga0453684_0418275 3300044712 Unclassified 1498
336 Ga0453684_0515935 3300044712 Bacteria 1321
337 Ga0453684_0657851 3300044712 Bacteria 1143
338 Ga0453684_0832938 3300044712 Bacteria 993
339 Ga0466960_0096663 3300044901 Bacteria 1514
340 Ga0451576_0022150 3300045051 Bacteria 6894
341 Ga0495603_0195349 3300046455 Unclassified 1170
342 Ga0495603_0837515 3300046455 Unclassified 524
343 Ga0495653_0345027 3300046463 Bacteria 959
344 Ga0495580_0391006 3300046472 Bacteria 939
345 Ga0495582_0585422 3300046473 Bacteria 646
346 Ga0495664_0136968 3300046477 Bacteria 1484
347 Ga0495664_0175514 3300046477 Bacteria 1300
348 Ga0495618_0196055 3300046514 Bacteria 1279
349 Ga0495628_0001016 3300046516 Bacteria 25610
350 Ga0495628_0027888 3300046516 Bacteria 4591
351 Ga0495630_0137506 3300046517 Bacteria 1857
352 Ga0495630_1144508 3300046517 Bacteria 589
353 Ga0495630_1336958 3300046517 Bacteria 540
354 Ga0495643_0217352 3300046522 Bacteria 908
355 Ga0495587_0244629 3300046536 Bacteria 1009
356 Ga0495598_0018344 3300046537 Bacteria 1818
357 Ga0495598_0098168 3300046537 Bacteria 965
358 Ga0495621_0032460 3300046539 Bacteria 1795
359 Ga0495668_0002554 3300046616 Bacteria 14799
360 Ga0495634_0009802 3300046642 Bacteria 7051
361 Ga0495635_0851001 3300046663 Bacteria 586
362 Ga0495635_1004049 3300046663 Unclassified 531
363 Ga0495657_0831657 3300046675 Bacteria 527
364 Ga0495672_0114984 3300047320 Bacteria 1438
365 Ga0495672_0144220 3300047320 Bacteria 1241
366 Ga0495680_0161943 3300047322 Bacteria 1624
367 Ga0495680_0339747 3300047322 Bacteria 1048
368 Ga0495675_0249041 3300047444 Bacteria 1068
369 Ga0495684_0003281 3300047471 Bacteria 12713
370 Ga0495684_0411548 3300047471 Unclassified 947
371 Ga0495684_0634226 3300047471 Unclassified 717
372 Ga0495686_0017792 3300047472 Bacteria 4783
373 Ga0495686_0026464 3300047472 Bacteria 3794
374 Ga0495602_0146260 3300048088 Bacteria 1864
375 Ga0496114_0362702 3300048917 Bacteria 1282
376 Ga0501298_002627 3300049521 Bacteria 2735
377 Ga0501300_038628 3300049523 Unclassified 716
378 Ga0501076_1400716 3300049592 Bacteria 574
379 Ga0501198_077619 3300049649 Bacteria 638
380 Ga0501201_000165 3300049651 Bacteria 5738
381 Ga0501202_010440 3300049652 Bacteria 1723
382 Ga0501207_002418 3300049654 Bacteria 2407
383 Ga0501208_024258 3300049655 Unclassified 1022
384 Ga0501216_107731 3300049660 Unclassified 622
385 Ga0501217_009160 3300049661 Bacteria 2148
386 Ga0501223_001832 3300049663 Bacteria 4805
387 Ga0501224_001013 3300049664 Bacteria 3640
388 Ga0501228_003513 3300049666 Bacteria 1295
389 Ga0501235_001196 3300049669 Bacteria 5453
390 Ga0501236_000253 3300049670 Bacteria 5712
391 Ga0501240_034654 3300049673 Bacteria 820
392 Ga0501242_001437 3300049674 Bacteria 2386
393 Ga0501243_003655 3300049675 Bacteria 2289
394 Ga0501250_001917 3300049680 Bacteria 1807
395 Ga0501252_003497 3300049682 Unclassified 1623
396 Ga0501252_005924 3300049682 Bacteria 1344
397 Ga0501257_000967 3300049686 Bacteria 5784
398 Ga0501257_027556 3300049686 Bacteria 1360
399 Ga0501259_003317 3300049688 Bacteria 2571
400 Ga0501259_014763 3300049688 Bacteria 1327
401 Ga0501260_009485 3300049689 Unclassified 968
402 Ga0501261_009884 3300049690 Unclassified 1249
403 Ga0501221_006977 3300049704 Bacteria 1924
404 Ga0501225_0005194 3300049705 Bacteria 3833
405 Ga0501234_001850 3300049707 Bacteria 3343
406 Ga0501245_003705 3300049708 Bacteria 2084
407 Ga0501245_006189 3300049708 Bacteria 1669
408 Ga0501232_025080 3300049757 Bacteria 795
409 Ga0501264_000044 3300049761 Bacteria 17523
410 Ga0501268_009337 3300049765 Bacteria 1505
411 Ga0501268_013468 3300049765 Bacteria 1321
412 Ga0501270_009050 3300049767 Bacteria 1276
413 Ga0501271_063725 3300049768 Bacteria 522
414 Ga0501272_028937 3300049769 Bacteria 697
415 Ga0501212_000999 3300049851 Bacteria 3037
416 nmdc:mga0k408_58647_c1 3300050493 Bacteria 2236
417 nmdc:mga0k408_860556_c1 3300050493 Unclassified 527
418 nmdc:mga05p37_948910_c1 3300050507 Bacteria 921
419 nmdc:mga05p37_965706_c1 3300050507 Unclassified 910
420 nmdc:mga09592_15033_c1 3300050508 Bacteria 6323
421 nmdc:mga09592_28711_c1 3300050508 Unclassified 4623
422 nmdc:mga09592_464331_c1 3300050508 Bacteria 1092
423 nmdc:mga09592_647710_c1 3300050508 Bacteria 902
424 nmdc:mga0qj67_45968_c1 3300050509 Bacteria 3445
425 nmdc:mga0qj67_65222_c1 3300050509 Bacteria 2899
426 nmdc:mga06r32_253883_c1 3300050510 Unclassified 1746
427 nmdc:mga06r32_292022_c1 3300050510 Bacteria 1617
428 nmdc:mga06r32_294648_c1 3300050510 Bacteria 1609
429 nmdc:mga06r32_741413_c1 3300050510 Bacteria 946
430 nmdc:mga06r32_915346_c1 3300050510 Unclassified 833
431 nmdc:mga08y16_1273376_c1 3300050511 Unclassified 703
432 nmdc:mga0n895_1051364_c1 3300050512 Bacteria 793
433 nmdc:mga0n895_1347691_c1 3300050512 Bacteria 683
434 nmdc:mga0a205_15297_c1 3300050515 Bacteria 7169
435 Ga0495601_0825761 3300053077 Unclassified 588
436 Ga0495619_0217380 3300053085 Bacteria 1324
437 Ga0500644_0221806 3300053088 Bacteria 789
438 Ga0500568_0000142 3300053139 Bacteria 64049
439 Ga0500604_0002938 3300053151 Bacteria 4601
440 Ga0500616_0046421 3300053153 Bacteria 2309
441 Ga0451577_0271101
442 LJQas_1005536
443 Ga0065714_10310519
444 Ga0065704_10010349
445 Ga0065712_10069395
446 Ga0065712_10424820
447 Ga0065707_10082779
448 Ga0065707_10096233
449 Ga0065707_10129303
450 Ga0065707_10229669
451 Ga0070676_10005476
452 Ga0070676_10363438
453 Ga0070683_102327071
454 Ga0070690_100157698
455 Ga0070670_100002147
456 Ga0070670_100140392
457 Ga0070670_100779149
458 Ga0070670_101115157
459 Ga0070670_102107869
460 Ga0070677_10027910
461 Ga0068869_100004838
462 Ga0068869_100163298
463 Ga0068869_100165565
464 Ga0070666_10641769
465 Ga0070682_100159191
466 Ga0070682_100297942
467 Ga0070682_101194757
468 Ga0068868_100001123
469 Ga0070660_100415943
470 Ga0070689_100100670
471 Ga0070689_100700159
472 Ga0070687_100314293
473 Ga0070661_100781011
474 Ga0070668_100322302
475 Ga0070668_100981050
476 Ga0070669_100156524
477 Ga0070669_100690461
478 Ga0070669_101811986
479 Ga0070671_100423195
480 Ga0070671_100486522
481 Ga0070674_100200517
482 Ga0070674_100298256
483 Ga0070673_100066774
484 Ga0070673_100219501
485 Ga0070673_100510126
486 Ga0070673_100593578
487 Ga0070701_10175204
488 Ga0070701_10562051
489 Ga0070705_100649617
490 Ga0070700_100280513
491 Ga0070663_100375183
492 Ga0070678_100238080
493 Ga0070662_100026382
494 Ga0070662_100065645
495 Ga0070662_101461901
496 Ga0068867_100018835
497 Ga0068867_100095985
498 Ga0068867_100522496
499 Ga0070685_10016083
500 Ga0070707_100865442
501 Ga0070698_100000282
502 Ga0070698_100001103
503 Ga0070698_100006847
504 Ga0068853_100386784
505 Ga0068853_101846199
506 Ga0068853_102027563
507 Ga0070672_100210441
508 Ga0070672_100276977
509 Ga0070672_100719379
510 Ga0070672_101839723
511 Ga0070686_100353878
512 Ga0070695_100910464
513 Ga0070696_101089772
514 Ga0070664_100206489
515 Ga0070664_100939591
516 Ga0068857_101192393
517 Ga0068859_100034396
518 Ga0068859_100422279
519 Ga0068859_100522820
520 Ga0068859_100663740
521 Ga0068859_103179247
522 Ga0068864_100002659
523 Ga0068864_100068073
524 Ga0068864_101351367
525 Ga0068861_100001502
526 Ga0068861_100230233
527 Ga0068861_100383432
528 Ga0068861_100950465
529 Ga0068851_10295507
530 Ga0068851_10892138
531 Ga0068851_11066816
532 Ga0068870_10412030
533 Ga0068870_10520270
534 Ga0068870_10786882
535 Ga0068863_100200104
536 Ga0068863_100304855
537 Ga0068863_100542675
538 Ga0068858_100365843
539 Ga0068858_100619408
540 Ga0068860_100826227
541 Ga0068860_101644056
542 Ga0068860_101789347
543 Ga0068862_100441494
544 Ga0068862_101974136
545 Ga0068862_102351749
546 Ga0075427_10036043
547 Ga0075366_10084901
548 Ga0097621_100005119
549 Ga0097621_100096067
550 Ga0097621_100149524
551 Ga0097621_100159877
552 Ga0097621_101041652
553 Ga0068871_100066568
554 Ga0075428_100033491
555 Ga0075428_100158384
556 Ga0075428_100236354
557 Ga0075428_100711805
558 Ga0075428_100846086
559 Ga0075430_100026948
560 Ga0075430_100055676
561 Ga0075430_101343523
562 Ga0075431_100102780
563 Ga0075431_100374095
564 Ga0075431_100494753
565 Ga0075431_100706931
566 Ga0075431_100724729
567 Ga0075434_100455316
568 Ga0075434_101543363
569 Ga0075429_100000261
570 Ga0075429_100050628
571 Ga0075429_100539202
572 Ga0075429_100687843
573 Ga0068865_100474277
574 Ga0068865_100503745
575 Ga0068865_101166909
576 Ga0097620_100034396
577 Ga0097620_100422299
578 Ga0097620_100522827
579 Ga0097620_100663747
580 Ga0097620_103181121
581 Ga0105240_10607382
582 Ga0105240_11394775
583 Ga0105240_12044904
584 Ga0111539_10064971
585 Ga0111539_10665061
586 Ga0111539_10671140
587 Ga0111539_10767735
588 Ga0114129_10264911
589 Ga0114129_10433129
590 Ga0105243_10530286
591 Ga0105242_10059633
592 Ga0105242_10277045
593 Ga0105242_10965898
594 Ga0105248_10701519
595 Ga0105249_10000635
596 Ga0105249_10052701
597 Ga0105249_10772775
598 Ga0105249_10988392
599 Ga0105249_11963044
600 Ga0099796_10099448
601 Ga0105246_10136955
602 Ga0105246_12425191
603 Ga0157373_10194416
604 Ga0157369_10652389
605 Ga0157378_10014044
606 Ga0157378_10015554
607 Ga0157378_10226488
608 Ga0157378_10287810
609 Ga0163162_10002830
610 Ga0163162_10063356
611 Ga0163162_10077963
612 Ga0163162_10100451
613 Ga0163162_12019012
614 Ga0157372_10185587
615 Ga0157372_10321918
616 Ga0157372_10595751
617 Ga0157375_10033658
618 Ga0157375_10047979
619 Ga0157375_10325020
620 Ga0157375_10533694
621 Ga0157375_10576537
622 Ga0157375_10586068
623 Ga0163163_10365147
624 Ga0163163_10929424
625 Ga0163163_11416184
626 Ga0163163_11663046
627 Ga0157380_10093409
628 Ga0157380_10102469
629 Ga0157380_10102780
630 Ga0157380_10261125
631 Ga0157380_11863957
632 Ga0157377_10225912
633 Ga0157377_10337527
634 Ga0157376_10013459
635 Ga0157376_10068023
636 Ga0163161_10053047
637 Ga0163161_10073554
638 Ga0163161_10373571
639 Ga0163161_10603829
640 Ga0207666_1014382
641 Ga0207697_10189893
642 Ga0207697_10265744
643 Ga0207656_10255454
644 Ga0207682_10013215
645 Ga0207642_10008516
646 Ga0207688_10574430
647 Ga0207688_10751853
648 Ga0207685_10363379
649 Ga0207645_10029888
650 Ga0207645_10077405
651 Ga0207645_10736785
652 Ga0207643_10647037
653 Ga0207662_10068829
654 Ga0207662_10111437
655 Ga0207657_10087426
656 Ga0207646_11257226
657 Ga0207681_10159681
658 Ga0207681_10694327
659 Ga0207681_11586716
660 Ga0207650_10035800
661 Ga0207650_10068612
662 Ga0207650_10167371
663 Ga0207650_10476908
664 Ga0207650_10972729
665 Ga0207659_10634405
666 Ga0207659_11777010
667 Ga0207644_10132353
668 Ga0207644_10140239
669 Ga0207644_10343532
670 Ga0207644_11141965
671 Ga0207706_10010648
672 Ga0207706_10019282
673 Ga0207686_10000372
674 Ga0207686_10350477
675 Ga0207709_11678925
676 Ga0207670_10006924
677 Ga0207670_10900254
678 Ga0207669_10426318
679 Ga0207669_11277003
680 Ga0207704_10084231
681 Ga0207704_11372365
682 Ga0207691_10066743
683 Ga0207691_10083887
684 Ga0207711_11067374
685 Ga0207689_10111471
686 Ga0207689_10704852
687 Ga0207679_10834308
688 Ga0207679_10887669
689 Ga0207651_10406729
690 Ga0207651_10637604
691 Ga0207651_10660620
692 Ga0207651_10787429
693 Ga0207712_10001470
694 Ga0207712_10013437
695 Ga0207712_10088938
696 Ga0207712_10322304
697 Ga0207668_10186694
698 Ga0207668_10463643
699 Ga0207658_10150963
700 Ga0207658_10157297
701 Ga0207677_10000816
702 Ga0207677_10473563
703 Ga0207703_10549990
704 Ga0207703_11984902
705 Ga0207639_10346275
706 Ga0207639_10390746
707 Ga0207639_10603003
708 Ga0207678_10143542
709 Ga0207708_10129356
710 Ga0207641_10002324
711 Ga0207641_10023847
712 Ga0207641_10196227
713 Ga0207641_10220612
714 Ga0207641_10283331
715 Ga0207641_11447090
716 Ga0207641_11497362
717 Ga0207648_10013448
718 Ga0207648_10069280
719 Ga0207648_10343551
720 Ga0207648_10641533
721 Ga0207676_10008363
722 Ga0207676_10055008
723 Ga0207676_10437080
724 Ga0207674_10223157
725 Ga0207674_11340846
726 Ga0207675_100009007
727 Ga0207675_100428433
728 Ga0207675_100665937
729 Ga0207683_10019223
730 Ga0207683_11046716
731 Ga0207698_10270342
732 Ga0207698_10544885
733 Ga0207698_11107988
734 Ga0207428_10818215
735 Ga0268265_10414953
736 Ga0268265_10498413
737 Ga0268265_11552332
738 Ga0268264_10104552
739 Ga0268264_12202342
740 Ga0265327_10211346
741 Ga0265316_10786133
742 Ga0307513_10741385
743 Ga0265313_10011933
744 Ga0307405_12054377
745 Ga0307410_11541938
746 Ga0307414_10046302
747 Ga0307411_10158444
748 Ga0307411_11147350
749 Ga0373933_0031057
750 Ga0373937_0129441
751 Ga0436364_0239634
752 Ga0436361_0619131
753 Ga0436363_1409231
754 Ga0451807_0441096
755 Ga0451807_0783376
756 Ga0451807_1567040
757 Ga0451851_1051485
758 Ga0451853_0331824
759 Ga0439441_006118
760 Ga0439441_085560
761 Ga0439441_160615
762 Ga0439450_087801
763 Ga0439435_0180174
764 Ga0439435_0198318
765 Ga0451577_0000201
766 Ga0451577_0612495
767 Ga0466972_0400317
768 Ga0453683_0000406
769 Ga0453683_0025329
770 Ga0453683_0062387
771 Ga0453683_0369499
772 Ga0453684_0000038
773 Ga0453684_0055363
774 Ga0453684_0170314
775 Ga0453684_0418275
776 Ga0453684_0515935
777 Ga0453684_0657851
778 Ga0453684_0832938
779 Ga0466960_0096663
780 Ga0451576_0022150
781 Ga0495603_0195349
782 Ga0495603_0837515
783 Ga0495653_0345027
784 Ga0495580_0391006
785 Ga0495582_0585422
786 Ga0495664_0136968
787 Ga0495664_0175514
788 Ga0495618_0196055
789 Ga0495628_0001016
790 Ga0495628_0027888
791 Ga0495630_0137506
792 Ga0495630_1144508
793 Ga0495630_1336958
794 Ga0495643_0217352
795 Ga0495587_0244629
796 Ga0495598_0018344
797 Ga0495598_0098168
798 Ga0495621_0032460
799 Ga0495668_0002554
800 Ga0495634_0009802
801 Ga0495635_0851001
802 Ga0495635_1004049
803 Ga0495657_0831657
804 Ga0495672_0114984
805 Ga0495672_0144220
806 Ga0495680_0161943
807 Ga0495680_0339747
808 Ga0495675_0249041
809 Ga0495684_0003281
810 Ga0495684_0411548
811 Ga0495684_0634226
812 Ga0495686_0017792
813 Ga0495686_0026464
814 Ga0495602_0146260
815 Ga0496114_0362702
816 Ga0501298_002627
817 Ga0501300_038628
818 Ga0501076_1400716
819 Ga0501198_077619
820 Ga0501201_000165
821 Ga0501202_010440
822 Ga0501207_002418
823 Ga0501208_024258
824 Ga0501216_107731
825 Ga0501217_009160
826 Ga0501223_001832
827 Ga0501224_001013
828 Ga0501228_003513
829 Ga0501235_001196
830 Ga0501236_000253
831 Ga0501240_034654
832 Ga0501242_001437
833 Ga0501243_003655
834 Ga0501250_001917
835 Ga0501252_003497
836 Ga0501252_005924
837 Ga0501257_000967
838 Ga0501257_027556
839 Ga0501259_003317
840 Ga0501259_014763
841 Ga0501260_009485
842 Ga0501261_009884
843 Ga0501221_006977
844 Ga0501225_0005194
845 Ga0501234_001850
846 Ga0501245_003705
847 Ga0501245_006189
848 Ga0501232_025080
849 Ga0501264_000044
850 Ga0501268_009337
851 Ga0501268_013468
852 Ga0501270_009050
853 Ga0501271_063725
854 Ga0501272_028937
855 Ga0501212_000999
856 nmdc:mga0k408_58647_c1
857 nmdc:mga0k408_860556_c1
858 nmdc:mga05p37_948910_c1
859 nmdc:mga05p37_965706_c1
860 nmdc:mga09592_15033_c1
861 nmdc:mga09592_28711_c1
862 nmdc:mga09592_464331_c1
863 nmdc:mga09592_647710_c1
864 nmdc:mga0qj67_45968_c1
865 nmdc:mga0qj67_65222_c1
866 nmdc:mga06r32_253883_c1
867 nmdc:mga06r32_292022_c1
868 nmdc:mga06r32_294648_c1
869 nmdc:mga06r32_741413_c1
870 nmdc:mga06r32_915346_c1
871 nmdc:mga08y16_1273376_c1
872 nmdc:mga0n895_1051364_c1
873 nmdc:mga0n895_1347691_c1
874 nmdc:mga0a205_15297_c1
875 Ga0495601_0825761
876 Ga0495619_0217380
877 Ga0500644_0221806
878 Ga0500568_0000142
879 Ga0500604_0002938
880 Ga0500616_0046421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

34

153

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.975 3 128
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9669 3 128
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9517 19 128
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9486 19 127
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.948 19 127
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.975 3 128 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9669 3 128 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9542 19 128 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9517 19 128 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9489 18 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7Y2D979-F1-model_v4 RidA family protein 1.004 24 128
AF-A0A7V9JWY7-F1-model_v4 RidA family protein 1.001 20 128
AF-A0A7V9FIM0-F1-model_v4 RidA family protein 0.995 3 128
AF-A0A2P6C2N5-F1-model_v4 deleted 0.995 3 128
AF-A0A845U4Z4-F1-model_v4 RidA family protein 0.9936 3 128

Map