F444228

General Info

Members Datasets Scaffolds Average Seq Length
439 244 438 189

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10285032|Ga0307513_102850322
Length 215
Sequence LLKNYFSGGAAGLLFLKKSIKYGFVKVEHNEKALLLGLARNDKKAVETIYRENYTMVQSLIINNNGSADDAKDVFQEAMIVLYEKARSGTFELNCLVKTYIYSVSRRLWLKRLQQSSRYSGDIGHAENVVPVEEDIEDHIQRDAEFEMMDKAINNLGEPCKSLLTAFYLQKQNMQEIALSFGYTNAENAKTQKYKCLMRLKKIFFTHYKNGAGDE

Samples

Sample ID Description Type Environment
1 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
156 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
157 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
204 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
205 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
206 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
214 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
215 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
220 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
225 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
226 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
227 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
228 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 1.14
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c004433 3300000043 Bacteria 1332
2 ARSoilOldRDRAFT_c004955 3300000044 Bacteria 1123
3 JGI24749J21850_1017256 3300002076 Bacteria 1015
4 JGI24751J29686_10003924 3300002459 Bacteria 3004
5 JGI24751J29686_10005979 3300002459 Bacteria 2481
6 rootH2_10003541 3300003320 Bacteria 18770
7 rootL2_10081164 3300003322 Bacteria 1960
8 rootL2_10088173 3300003322 Bacteria 2502
9 Ga0065712_10073069 3300005290 Bacteria 4513
10 Ga0065715_10439045 3300005293 Bacteria 838
11 Ga0065707_10003327 3300005295 Bacteria 5453
12 Ga0065707_10026270 3300005295 Bacteria 1227
13 Ga0070676_10730802 3300005328 Bacteria 725
14 Ga0070683_100071654 3300005329 Bacteria 3233
15 Ga0070683_100145962 3300005329 Unclassified 2242
16 Ga0070690_100034387 3300005330 Unclassified 3176
17 Ga0070690_100049469 3300005330 Bacteria 2680
18 Ga0070670_100036587 3300005331 Bacteria 4224
19 Ga0070670_100080392 3300005331 Bacteria 2801
20 Ga0068869_100137379 3300005334 Unclassified 1884
21 Ga0068869_100157718 3300005334 Bacteria 1765
22 Ga0070666_10020827 3300005335 Bacteria 4243
23 Ga0070666_10740094 3300005335 Bacteria 722
24 Ga0068868_100001540 3300005338 Bacteria 15748
25 Ga0068868_100004208 3300005338 Bacteria 10068
26 Ga0068868_100242595 3300005338 Unclassified 1514
27 Ga0070689_100001483 3300005340 Bacteria 14964
28 Ga0070689_100008364 3300005340 Bacteria 7286
29 Ga0070689_100046302 3300005340 Unclassified 3351
30 Ga0070689_100227318 3300005340 Bacteria 1533
31 Ga0070691_10017336 3300005341 Unclassified 3313
32 Ga0070691_10147830 3300005341 Bacteria 1202
33 Ga0070687_100102612 3300005343 Bacteria 1604
34 Ga0070661_100041644 3300005344 Bacteria 3351
35 Ga0070668_100033045 3300005347 Bacteria 3938
36 Ga0070668_100340221 3300005347 Bacteria 1267
37 Ga0070669_100000458 3300005353 Bacteria 30951
38 Ga0070669_100077070 3300005353 Bacteria 2476
39 Ga0070675_100093750 3300005354 Bacteria 2518
40 Ga0070675_100273568 3300005354 Bacteria 1483
41 Ga0070674_100454139 3300005356 Bacteria 1058
42 Ga0070674_100568176 3300005356 Bacteria 954
43 Ga0070673_100005119 3300005364 Bacteria 8362
44 Ga0070673_100384693 3300005364 Unclassified 1251
45 Ga0070673_100876478 3300005364 Bacteria 832
46 Ga0070673_101599306 3300005364 Unclassified 616
47 Ga0070688_100000687 3300005365 Bacteria 16799
48 Ga0070688_100041313 3300005365 Bacteria 2830
49 Ga0070688_100044335 3300005365 Bacteria 2744
50 Ga0070688_100274520 3300005365 Unclassified 1209
51 Ga0070659_100030490 3300005366 Bacteria 4174
52 Ga0070659_100292286 3300005366 Bacteria 1357
53 Ga0070667_100794776 3300005367 Bacteria 878
54 Ga0070700_100079291 3300005441 Bacteria 2116
55 Ga0070700_100098974 3300005441 Bacteria 1918
56 Ga0070663_100145029 3300005455 Unclassified 1816
57 Ga0070678_100066003 3300005456 Bacteria 2689
58 Ga0070662_100014264 3300005457 Bacteria 5305
59 Ga0070662_100075038 3300005457 Bacteria 2503
60 Ga0070662_100147241 3300005457 Bacteria 1830
61 Ga0070681_10014654 3300005458 Bacteria 7798
62 Ga0068867_100055427 3300005459 Bacteria 2931
63 Ga0068867_100111565 3300005459 Bacteria 2101
64 Ga0068867_100233444 3300005459 Bacteria 1488
65 Ga0070685_10023259 3300005466 Bacteria 3391
66 Ga0070685_10097419 3300005466 Unclassified 1791
67 Ga0070685_10552679 3300005466 Bacteria 822
68 Ga0070698_100685702 3300005471 Bacteria 966
69 Ga0070679_101047930 3300005530 Bacteria 760
70 Ga0070684_100007763 3300005535 Bacteria 8363
71 Ga0070684_100029812 3300005535 Bacteria 4628
72 Ga0068853_100001585 3300005539 Bacteria 16590
73 Ga0068853_100005622 3300005539 Bacteria 9849
74 Ga0070672_100025613 3300005543 Bacteria 4379
75 Ga0070672_100270153 3300005543 Unclassified 1436
76 Ga0070672_100281764 3300005543 Bacteria 1405
77 Ga0070686_100129478 3300005544 Bacteria 1743
78 Ga0070704_100538748 3300005549 Bacteria 1018
79 Ga0068855_100171423 3300005563 Unclassified 2458
80 Ga0068855_100637998 3300005563 Bacteria 1145
81 Ga0068855_100787107 3300005563 Bacteria 1012
82 Ga0070664_100009504 3300005564 Bacteria 7883
83 Ga0070664_100101558 3300005564 Bacteria 2501
84 Ga0070664_100661729 3300005564 Unclassified 971
85 Ga0068857_100030730 3300005577 Bacteria 4745
86 Ga0068857_100232392 3300005577 Unclassified 1687
87 Ga0068854_100034866 3300005578 Bacteria 3519
88 Ga0068854_100048652 3300005578 Bacteria 3026
89 Ga0068856_100257542 3300005614 Bacteria 1760
90 Ga0068859_100041535 3300005617 Unclassified 4619
91 Ga0068859_100092592 3300005617 Bacteria 3074
92 Ga0068859_100177777 3300005617 Unclassified 2210
93 Ga0068859_100368563 3300005617 Bacteria 1532
94 Ga0068864_100012297 3300005618 Bacteria 7074
95 Ga0068864_100027484 3300005618 Unclassified 4806
96 Ga0068864_100051263 3300005618 Bacteria 3554
97 Ga0068864_100410571 3300005618 Unclassified 1288
98 Ga0068866_10122371 3300005718 Bacteria 1468
99 Ga0068861_100000225 3300005719 Bacteria 30713
100 Ga0068861_100658708 3300005719 Bacteria 968
101 Ga0068851_10110625 3300005834 Bacteria 1466
102 Ga0068870_10019966 3300005840 Bacteria 3256
103 Ga0068863_100002125 3300005841 Bacteria 19657
104 Ga0068863_100658704 3300005841 Bacteria 1039
105 Ga0068858_100034683 3300005842 Bacteria 4680
106 Ga0068860_100000046 3300005843 Bacteria 214800
107 Ga0068860_100883173 3300005843 Bacteria 910
108 Ga0068862_100016616 3300005844 Bacteria 6127
109 Ga0068862_100532918 3300005844 Bacteria 1119
110 Ga0068862_101541209 3300005844 Unclassified 671
111 Ga0081540_1014264 3300005983 Bacteria 5102
112 Ga0075366_10003238 3300006195 Bacteria 8556
113 Ga0075366_10009711 3300006195 Bacteria 5378
114 Ga0075366_10147356 3300006195 Bacteria 1425
115 Ga0075366_10178241 3300006195 Bacteria 1290
116 Ga0097621_100131313 3300006237 Bacteria 2132
117 Ga0068871_100658295 3300006358 Bacteria 957
118 Ga0068871_100727544 3300006358 Bacteria 911
119 Ga0068865_100299936 3300006881 Bacteria 1286
120 Ga0068865_100619428 3300006881 Bacteria 917
121 Ga0097620_100041533 3300006931 Unclassified 4619
122 Ga0097620_100092588 3300006931 Bacteria 3074
123 Ga0097620_100177782 3300006931 Unclassified 2210
124 Ga0097620_100368532 3300006931 Bacteria 1532
125 Ga0105240_10175593 3300009093 Bacteria 2533
126 Ga0105240_10288473 3300009093 Bacteria 1882
127 Ga0111539_10006834 3300009094 Bacteria 14661
128 Ga0105247_10398246 3300009101 Unclassified 980
129 Ga0105242_10042160 3300009176 Bacteria 3684
130 Ga0105242_10797314 3300009176 Bacteria 935
131 Ga0105237_10000563 3300009545 Bacteria 51816
132 Ga0105237_10020194 3300009545 Bacteria 6875
133 Ga0105237_10031794 3300009545 Bacteria 5346
134 Ga0105237_10034848 3300009545 Bacteria 5093
135 Ga0105238_10390705 3300009551 Bacteria 1383
136 Ga0105249_10002924 3300009553 Bacteria 14735
137 Ga0105249_10020253 3300009553 Bacteria 5945
138 Ga0105249_10207200 3300009553 Bacteria 1922
139 Ga0105249_10230809 3300009553 Bacteria 1825
140 Ga0105249_10860095 3300009553 Unclassified 972
141 Ga0105239_10000048 3300010375 Bacteria 177855
142 Ga0105239_10003203 3300010375 Bacteria 20233
143 Ga0105239_10078746 3300010375 Bacteria 3627
144 Ga0105239_11361628 3300010375 Bacteria 819
145 Ga0105239_12305392 3300010375 Bacteria 626
146 Ga0105246_10354742 3300011119 Unclassified 1203
147 Ga0157373_10136021 3300013100 Unclassified 1728
148 Ga0157370_10077001 3300013104 Bacteria 3142
149 Ga0157370_10598502 3300013104 Unclassified 1009
150 Ga0157374_10031789 3300013296 Bacteria 4801
151 Ga0157374_10064428 3300013296 Bacteria 3439
152 Ga0157374_10072106 3300013296 Bacteria 3258
153 Ga0157374_10082273 3300013296 Bacteria 3057
154 Ga0157374_10127736 3300013296 Bacteria 2458
155 Ga0157378_10002969 3300013297 Bacteria 15088
156 Ga0163162_10001998 3300013306 Bacteria 19189
157 Ga0163162_10002326 3300013306 Bacteria 17832
158 Ga0163162_10017671 3300013306 Bacteria 6978
159 Ga0163162_10130927 3300013306 Bacteria 2617
160 Ga0163162_10236379 3300013306 Unclassified 1958
161 Ga0157372_10002035 3300013307 Bacteria 21994
162 Ga0157372_10048249 3300013307 Bacteria 4733
163 Ga0157372_10086188 3300013307 Bacteria 3563
164 Ga0157372_10113422 3300013307 Bacteria 3106
165 Ga0157372_11355704 3300013307 Bacteria 820
166 Ga0157375_10075816 3300013308 Bacteria 3388
167 Ga0157375_10192005 3300013308 Bacteria 2197
168 Ga0157375_10414316 3300013308 Bacteria 1513
169 Ga0157375_10417578 3300013308 Bacteria 1508
170 Ga0157375_10518735 3300013308 Unclassified 1355
171 Ga0157375_11720379 3300013308 Bacteria 743
172 Ga0163163_10010371 3300014325 Bacteria 8372
173 Ga0163163_10172079 3300014325 Bacteria 2212
174 Ga0163163_10377909 3300014325 Bacteria 1474
175 Ga0163163_10694297 3300014325 Bacteria 1081
176 Ga0163163_11376813 3300014325 Bacteria 767
177 Ga0157380_10002418 3300014326 Bacteria 12574
178 Ga0157380_10002439 3300014326 Bacteria 12531
179 Ga0157380_10205208 3300014326 Bacteria 1752
180 Ga0157380_10632717 3300014326 Bacteria 1064
181 Ga0157380_10755370 3300014326 Bacteria 984
182 Ga0157377_10000289 3300014745 Bacteria 23989
183 Ga0157377_10065882 3300014745 Bacteria 2082
184 Ga0157377_10766375 3300014745 Unclassified 708
185 Ga0157379_10030191 3300014968 Unclassified 4823
186 Ga0157379_10147844 3300014968 Unclassified 2119
187 Ga0157379_10526962 3300014968 Bacteria 1097
188 Ga0157376_10002300 3300014969 Bacteria 12901
189 Ga0157376_10295722 3300014969 Bacteria 1531
190 Ga0157376_11274525 3300014969 Bacteria 764
191 Ga0207697_10070868 3300025315 Bacteria 1461
192 Ga0207697_10094300 3300025315 Bacteria 1270
193 Ga0207656_10110528 3300025321 Bacteria 1269
194 Ga0207656_10274294 3300025321 Bacteria 830
195 Ga0207680_10025175 3300025903 Bacteria 3280
196 Ga0207680_10648731 3300025903 Bacteria 756
197 Ga0207647_10081764 3300025904 Bacteria 1935
198 Ga0207647_10090040 3300025904 Bacteria 1831
199 Ga0207645_10007158 3300025907 Bacteria 7912
200 Ga0207643_10049870 3300025908 Bacteria 2373
201 Ga0207643_10242930 3300025908 Bacteria 1107
202 Ga0207705_10361394 3300025909 Unclassified 1120
203 Ga0207707_10139010 3300025912 Bacteria 2124
204 Ga0207695_10000023 3300025913 Bacteria 657903
205 Ga0207695_10000229 3300025913 Bacteria 149313
206 Ga0207695_10002425 3300025913 Bacteria 27622
207 Ga0207695_10016531 3300025913 Bacteria 8626
208 Ga0207695_10834910 3300025913 Bacteria 801
209 Ga0207671_10003761 3300025914 Bacteria 14941
210 Ga0207671_10004878 3300025914 Bacteria 12608
211 Ga0207671_10048967 3300025914 Unclassified 3127
212 Ga0207662_10146328 3300025918 Bacteria 1500
213 Ga0207662_10654569 3300025918 Bacteria 734
214 Ga0207649_10024736 3300025920 Bacteria 3494
215 Ga0207649_10424744 3300025920 Unclassified 999
216 Ga0207681_10014054 3300025923 Bacteria 4963
217 Ga0207694_10091143 3300025924 Bacteria 2406
218 Ga0207650_10003002 3300025925 Bacteria 11627
219 Ga0207650_10038885 3300025925 Bacteria 3477
220 Ga0207650_10121963 3300025925 Bacteria 2030
221 Ga0207650_10352611 3300025925 Bacteria 1211
222 Ga0207650_10393583 3300025925 Bacteria 1146
223 Ga0207650_10489201 3300025925 Bacteria 1027
224 Ga0207659_10189861 3300025926 Bacteria 1634
225 Ga0207659_10759149 3300025926 Bacteria 832
226 Ga0207644_10072811 3300025931 Bacteria 2518
227 Ga0207644_11033121 3300025931 Bacteria 690
228 Ga0207690_10234692 3300025932 Bacteria 1410
229 Ga0207706_10133193 3300025933 Bacteria 2186
230 Ga0207706_10183725 3300025933 Bacteria 1836
231 Ga0207709_10318949 3300025935 Bacteria 1162
232 Ga0207670_10011769 3300025936 Bacteria 5092
233 Ga0207670_10024788 3300025936 Bacteria 3755
234 Ga0207691_10039066 3300025940 Bacteria 4392
235 Ga0207691_10154582 3300025940 Unclassified 2015
236 Ga0207691_10342742 3300025940 Unclassified 1279
237 Ga0207691_10351653 3300025940 Bacteria 1261
238 Ga0207691_10499992 3300025940 Bacteria 1033
239 Ga0207689_10220798 3300025942 Bacteria 1566
240 Ga0207661_10000927 3300025944 Bacteria 19231
241 Ga0207661_10107897 3300025944 Unclassified 2349
242 Ga0207661_10135257 3300025944 Unclassified 2116
243 Ga0207679_10012298 3300025945 Bacteria 5577
244 Ga0207679_10441991 3300025945 Unclassified 1152
245 Ga0207679_10547000 3300025945 Bacteria 1038
246 Ga0207667_10123299 3300025949 Unclassified 2670
247 Ga0207651_10225882 3300025960 Bacteria 1517
248 Ga0207651_10846702 3300025960 Bacteria 812
249 Ga0207712_10030807 3300025961 Bacteria 3608
250 Ga0207712_10065768 3300025961 Bacteria 2589
251 Ga0207712_10168189 3300025961 Bacteria 1711
252 Ga0207712_10274486 3300025961 Bacteria 1373
253 Ga0207668_10180227 3300025972 Bacteria 1665
254 Ga0207640_10020131 3300025981 Bacteria 3957
255 Ga0207640_10039229 3300025981 Bacteria 2996
256 Ga0207658_10759948 3300025986 Bacteria 878
257 Ga0207677_10010001 3300026023 Bacteria 5353
258 Ga0207677_10035021 3300026023 Bacteria 3256
259 Ga0207677_10211260 3300026023 Unclassified 1550
260 Ga0207639_10010461 3300026041 Bacteria 6427
261 Ga0207639_10051489 3300026041 Bacteria 3132
262 Ga0207639_10560170 3300026041 Bacteria 1050
263 Ga0207639_10942541 3300026041 Unclassified 808
264 Ga0207678_10037820 3300026067 Bacteria 4196
265 Ga0207708_10085873 3300026075 Bacteria 2421
266 Ga0207708_10106564 3300026075 Bacteria 2173
267 Ga0207708_11264777 3300026075 Bacteria 646
268 Ga0207702_11228656 3300026078 Bacteria 743
269 Ga0207641_10109066 3300026088 Bacteria 2451
270 Ga0207648_10006809 3300026089 Bacteria 11325
271 Ga0207648_10069923 3300026089 Bacteria 3059
272 Ga0207648_10112212 3300026089 Bacteria 2394
273 Ga0207676_10022185 3300026095 Bacteria 4668
274 Ga0207676_10025336 3300026095 Bacteria 4401
275 Ga0207676_10226578 3300026095 Bacteria 1668
276 Ga0207676_10560033 3300026095 Bacteria 1093
277 Ga0207674_10002719 3300026116 Bacteria 22062
278 Ga0207674_10025545 3300026116 Bacteria 6296
279 Ga0207674_10107588 3300026116 Unclassified 2765
280 Ga0207674_10122656 3300026116 Bacteria 2565
281 Ga0207675_100000386 3300026118 Bacteria 42305
282 Ga0207675_100137443 3300026118 Bacteria 2320
283 Ga0207675_100174518 3300026118 Unclassified 2056
284 Ga0207675_100431302 3300026118 Bacteria 1303
285 Ga0207683_10092086 3300026121 Bacteria 2701
286 Ga0207428_10027645 3300027907 Bacteria 4720
287 Ga0268265_10266885 3300028380 Unclassified 1525
288 Ga0268265_10420324 3300028380 Bacteria 1241
289 Ga0268265_10668502 3300028380 Bacteria 1000
290 Ga0268264_10000041 3300028381 Bacteria 372501
291 Ga0268264_10005933 3300028381 Bacteria 10340
292 Ga0268264_10111791 3300028381 Bacteria 2394
293 Ga0268264_10468339 3300028381 Unclassified 1224
294 Ga0307511_10000285 3300030521 Bacteria 53256
295 Ga0265327_10048446 3300031251 Bacteria 2235
296 Ga0307513_10285032 3300031456 Bacteria 1427
297 Ga0307509_10015768 3300031507 Bacteria 8791
298 Ga0307516_10000577 3300031730 Bacteria 49482
299 Ga0307413_10007405 3300031824 Bacteria 5097
300 Ga0307410_10010058 3300031852 Bacteria 5341
301 Ga0307410_10259695 3300031852 Unclassified 1354
302 Ga0307406_10058684 3300031901 Bacteria 2474
303 Ga0307416_100069246 3300032002 Bacteria 2919
304 Ga0307416_100503876 3300032002 Bacteria 1276
305 Ga0307414_10414693 3300032004 Bacteria 1173
306 Ga0307415_100156123 3300032126 Bacteria 1762
307 Ga0307510_10000805 3300033180 Bacteria 32598
308 Ga0373957_0102365 3300035120 Bacteria 1147
309 Ga0373946_0200926 3300035171 Unclassified 955
310 Ga0373933_0212812 3300035724 Bacteria 1239
311 Ga0373947_0154227 3300035725 Bacteria 1481
312 Ga0373937_0027905 3300036401 Bacteria 5107
313 Ga0373925_0286067 3300037068 Bacteria 1329
314 Ga0395900_0580259 3300037418 Bacteria 1063
315 Ga0395898_0068889 3300037466 Bacteria 3424
316 Ga0439461_0010508 3300041410 Bacteria 1701
317 Ga0451807_2709964 3300041486 Bacteria 786
318 Ga0451843_0344114 3300041509 Bacteria 2088
319 Ga0439457_005952 3300042014 Bacteria 3015
320 Ga0450897_007686 3300042128 Bacteria 988
321 Ga0450894_004960 3300042131 Bacteria 1720
322 Ga0450899_005125 3300042135 Bacteria 1407
323 Ga0439434_0074662 3300042435 Bacteria 1070
324 Ga0450893_0029653 3300042532 Bacteria 971
325 Ga0466969_0000182 3300044656 Bacteria 33828
326 Ga0466972_0003013 3300044658 Bacteria 8349
327 Ga0466966_0014856 3300044684 Bacteria 5151
328 Ga0453684_0117232 3300044712 Bacteria 3223
329 Ga0466971_0088119 3300044719 Bacteria 1419
330 Ga0466970_0180950 3300044765 Bacteria 1170
331 Ga0466959_0000056 3300045049 Bacteria 78465
332 Ga0466959_0001399 3300045049 Bacteria 14766
333 Ga0495638_0189848 3300046460 Unclassified 1166
334 Ga0495638_0221314 3300046460 Bacteria 1058
335 Ga0495638_0279694 3300046460 Bacteria 907
336 Ga0495580_0639584 3300046472 Bacteria 700
337 Ga0495606_0050751 3300046507 Bacteria 2711
338 Ga0495608_0125173 3300046511 Bacteria 1646
339 Ga0495628_0241722 3300046516 Unclassified 1350
340 Ga0495630_0014413 3300046517 Bacteria 5760
341 Ga0495643_0019504 3300046522 Bacteria 3922
342 Ga0495648_0001994 3300046524 Bacteria 19331
343 Ga0495587_0271126 3300046536 Bacteria 952
344 Ga0495667_0251073 3300046559 Bacteria 1126
345 Ga0495624_0195153 3300046690 Bacteria 1231
346 Ga0495600_0121764 3300046809 Bacteria 1697
347 Ga0495672_0025644 3300047320 Bacteria 3768
348 Ga0495672_0316397 3300047320 Bacteria 734
349 Ga0495680_0228631 3300047322 Bacteria 1325
350 Ga0495687_000001 3300047443 Bacteria 1215582
351 Ga0495684_0283950 3300047471 Bacteria 1193
352 Ga0495686_0000004 3300047472 Bacteria 869019
353 Ga0495686_0012413 3300047472 Bacteria 5960
354 Ga0496104_0563328 3300048907 Unclassified 1050
355 Ga0496110_0039739 3300048913 Bacteria 4097
356 Ga0496110_0337817 3300048913 Unclassified 1372
357 Ga0496111_0711500 3300048914 Unclassified 730
358 Ga0501298_089445 3300049521 Unclassified 688
359 Ga0501299_000376 3300049522 Bacteria 5270
360 Ga0501034_0004706 3300049571 Bacteria 15108
361 Ga0501034_0332998 3300049571 Bacteria 1449
362 Ga0501036_0064960 3300049572 Bacteria 3088
363 Ga0501037_0028037 3300049573 Bacteria 4160
364 Ga0501038_0092841 3300049574 Bacteria 2527
365 Ga0501039_0146562 3300049575 Bacteria 1855
366 Ga0501043_0039339 3300049579 Bacteria 3716
367 Ga0501046_0046221 3300049580 Bacteria 3456
368 Ga0501046_0137945 3300049580 Bacteria 1847
369 Ga0501047_0056300 3300049581 Bacteria 3802
370 Ga0501047_0268228 3300049581 Bacteria 1553
371 Ga0501047_0358231 3300049581 Bacteria 1295
372 Ga0501048_0084535 3300049582 Bacteria 2238
373 Ga0501048_0142781 3300049582 Bacteria 1693
374 Ga0501048_0284831 3300049582 Bacteria 1175
375 Ga0501067_0016375 3300049583 Unclassified 4097
376 Ga0501067_0029635 3300049583 Bacteria 3033
377 Ga0501070_0165165 3300049586 Unclassified 1824
378 Ga0501070_0285348 3300049586 Bacteria 1346
379 Ga0501071_0628832 3300049587 Unclassified 826
380 Ga0501073_0014462 3300049589 Bacteria 5733
381 Ga0501074_0014645 3300049590 Bacteria 5704
382 Ga0501198_000760 3300049649 Unclassified 4029
383 Ga0501201_000177 3300049651 Bacteria 5604
384 Ga0501202_000044 3300049652 Bacteria 12530
385 Ga0501202_006758 3300049652 Unclassified 2060
386 Ga0501207_023131 3300049654 Bacteria 1007
387 Ga0501217_004903 3300049661 Unclassified 2773
388 Ga0501217_063946 3300049661 Bacteria 989
389 Ga0501217_080554 3300049661 Bacteria 900
390 Ga0501222_027603 3300049662 Bacteria 773
391 Ga0501223_033699 3300049663 Bacteria 996
392 Ga0501223_033871 3300049663 Bacteria 993
393 Ga0501227_035121 3300049665 Bacteria 1219
394 Ga0501233_001446 3300049668 Bacteria 4050
395 Ga0501233_048702 3300049668 Unclassified 1020
396 Ga0501235_003225 3300049669 Bacteria 3518
397 Ga0501235_006083 3300049669 Bacteria 2625
398 Ga0501238_010095 3300049671 Bacteria 1258
399 Ga0501242_003591 3300049674 Bacteria 1685
400 Ga0501243_002282 3300049675 Unclassified 2797
401 Ga0501259_018194 3300049688 Bacteria 1225
402 Ga0501221_001236 3300049704 Bacteria 4228
403 Ga0501225_0010110 3300049705 Bacteria 2677
404 Ga0501225_0059096 3300049705 Unclassified 1077
405 Ga0501234_000133 3300049707 Bacteria 9804
406 Ga0501245_014839 3300049708 Bacteria 1166
407 Ga0501079_0352890 3300049741 Bacteria 1152
408 Ga0501080_0011972 3300049742 Bacteria 7945
409 Ga0501080_0476076 3300049742 Unclassified 1117
410 Ga0501083_0038260 3300049744 Unclassified 3262
411 Ga0501083_0074161 3300049744 Bacteria 2261
412 Ga0501083_0301822 3300049744 Unclassified 1041
413 Ga0501083_0563157 3300049744 Unclassified 741
414 Ga0501266_020789 3300049763 Bacteria 895
415 Ga0501270_017022 3300049767 Bacteria 1059
416 Ga0501274_006474 3300049771 Bacteria 1011
417 Ga0501279_017103 3300049775 Bacteria 1014
418 Ga0501280_007643 3300049776 Unclassified 1510
419 Ga0501035_0074366 3300049822 Bacteria 3006
420 Ga0501044_0048057 3300049823 Bacteria 4410
421 Ga0501044_0079225 3300049823 Bacteria 3329
422 nmdc:mga0k408_14082_c1 3300050493 Bacteria 4398
423 nmdc:mga0k408_149588_c1 3300050493 Bacteria 1390
424 nmdc:mga0k408_8840_c1 3300050493 Bacteria 5419
425 nmdc:mga09592_469177_c1 3300050508 Bacteria 1085
426 nmdc:mga08y16_13394_c1 3300050511 Bacteria 8626
427 nmdc:mga0n895_220022_c1 3300050512 Bacteria 1928
428 Ga0500646_0137361 3300053090 Bacteria 799
429 Ga0500556_0252068 3300053104 Bacteria 695
430 Ga0500642_0002202 3300053130 Bacteria 5668
431 Ga0500568_0000306 3300053139 Bacteria 39150
432 Ga0500573_0103955 3300053140 Bacteria 1596
433 Ga0500588_0004060 3300053146 Bacteria 3141
434 Ga0500588_0029642 3300053146 Bacteria 1562
435 Ga0500622_0000900 3300053156 Bacteria 25309
436 Ga0500611_000028 3300053727 Bacteria 93696
437 Ga0501082_0087577 3300060353 Bacteria 2687
438 Ga0466962_0037097 3300061719 Bacteria 2333

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_11228656 Ga0207702_112286561 173
2 3300005843 Ga0068860_100000046 Ga0068860_100000046107 177
3 3300005844 Ga0068862_100532918 Ga0068862_1005329182 177
4 3300009553 Ga0105249_10230809 Ga0105249_102308092 177
5 3300013306 Ga0163162_10001998 Ga0163162_100019984 177
6 3300025961 Ga0207712_10274486 Ga0207712_102744861 177
7 3300028380 Ga0268265_10668502 Ga0268265_106685021 177
8 3300028381 Ga0268264_10000041 Ga0268264_10000041220 177
9 3300031730 Ga0307516_10000577 Ga0307516_1000057726 177
10 3300047443 Ga0495687_000001 Ga0495687_000001_269156_269713 177
11 3300037418 Ga0395900_0580259 Ga0395900_0580259_256_795 179
12 3300005329 Ga0070683_100071654 Ga0070683_1000716543 181
13 3300005334 Ga0068869_100137379 Ga0068869_1001373791 181
14 3300005338 Ga0068868_100242595 Ga0068868_1002425951 181
15 3300005340 Ga0070689_100008364 Ga0070689_1000083643 181
16 3300005344 Ga0070661_100041644 Ga0070661_1000416444 181
17 3300005354 Ga0070675_100093750 Ga0070675_1000937502 181
18 3300005364 Ga0070673_100384693 Ga0070673_1003846931 181
19 3300005365 Ga0070688_100044335 Ga0070688_1000443352 181
20 3300005455 Ga0070663_100145029 Ga0070663_1001450292 181
21 3300005466 Ga0070685_10097419 Ga0070685_100974191 181
22 3300005535 Ga0070684_100029812 Ga0070684_1000298127 181
23 3300005543 Ga0070672_100270153 Ga0070672_1002701531 181
24 3300005564 Ga0070664_100101558 Ga0070664_1001015583 181
25 3300005577 Ga0068857_100232392 Ga0068857_1002323921 181
26 3300005617 Ga0068859_100177777 Ga0068859_1001777771 181
27 3300005618 Ga0068864_100012297 Ga0068864_1000122974 181
28 3300005841 Ga0068863_100658704 Ga0068863_1006587041 181
29 3300006931 Ga0097620_100177782 Ga0097620_1001777821 181
30 3300009553 Ga0105249_10860095 Ga0105249_108600951 181
31 3300011119 Ga0105246_10354742 Ga0105246_103547422 181
32 3300013296 Ga0157374_10031789 Ga0157374_100317894 181
33 3300013308 Ga0157375_10075816 Ga0157375_100758163 181
34 3300014325 Ga0163163_10010371 Ga0163163_100103718 181
35 3300014968 Ga0157379_10147844 Ga0157379_101478442 181
36 3300025315 Ga0207697_10070868 Ga0207697_100708683 181
37 3300025936 Ga0207670_10024788 Ga0207670_100247884 181
38 3300025940 Ga0207691_10342742 Ga0207691_103427421 181
39 3300025944 Ga0207661_10107897 Ga0207661_101078971 181
40 3300026023 Ga0207677_10211260 Ga0207677_102112602 181
41 3300026041 Ga0207639_10942541 Ga0207639_109425412 181
42 3300026067 Ga0207678_10037820 Ga0207678_100378203 181
43 3300026095 Ga0207676_10025336 Ga0207676_100253365 181
44 3300026116 Ga0207674_10107588 Ga0207674_101075881 181
45 3300028381 Ga0268264_10468339 Ga0268264_104683392 181
46 3300042014 Ga0439457_005952 Ga0439457_005952_2149_2694 181
47 3300042128 Ga0450897_007686 Ga0450897_007686_29_574 181
48 3300048913 Ga0496110_0337817 Ga0496110_0337817_685_1260 181
49 3300003322 rootL2_10088173 rootL2_100881732 185
50 3300005335 Ga0070666_10020827 Ga0070666_100208273 185
51 3300005335 Ga0070666_10740094 Ga0070666_107400941 185
52 3300005341 Ga0070691_10017336 Ga0070691_100173361 185
53 3300005539 Ga0068853_100001585 Ga0068853_1000015854 185
54 3300005563 Ga0068855_100171423 Ga0068855_1001714233 185
55 3300005983 Ga0081540_1014264 Ga0081540_10142645 185
56 3300009093 Ga0105240_10175593 Ga0105240_101755933 185
57 3300009545 Ga0105237_10000563 Ga0105237_1000056339 185
58 3300009545 Ga0105237_10020194 Ga0105237_100201941 185
59 3300009545 Ga0105237_10034848 Ga0105237_100348484 185
60 3300010375 Ga0105239_10003203 Ga0105239_1000320315 185
61 3300010375 Ga0105239_10078746 Ga0105239_100787464 185
62 3300013307 Ga0157372_11355704 Ga0157372_113557041 185
63 3300013308 Ga0157375_10414316 Ga0157375_104143162 185
64 3300014968 Ga0157379_10526962 Ga0157379_105269622 185
65 3300025903 Ga0207680_10025175 Ga0207680_100251753 185
66 3300025903 Ga0207680_10648731 Ga0207680_106487311 185
67 3300025904 Ga0207647_10081764 Ga0207647_100817642 185
68 3300025913 Ga0207695_10000023 Ga0207695_1000002336 185
69 3300025913 Ga0207695_10000229 Ga0207695_10000229105 185
70 3300025913 Ga0207695_10002425 Ga0207695_1000242513 185
71 3300025913 Ga0207695_10016531 Ga0207695_100165319 185
72 3300025913 Ga0207695_10834910 Ga0207695_108349102 185
73 3300025914 Ga0207671_10003761 Ga0207671_100037618 185
74 3300025914 Ga0207671_10004878 Ga0207671_100048783 185
75 3300025914 Ga0207671_10048967 Ga0207671_100489672 185
76 3300025924 Ga0207694_10091143 Ga0207694_100911433 185
77 3300025949 Ga0207667_10123299 Ga0207667_101232993 185
78 3300026041 Ga0207639_10051489 Ga0207639_100514894 185
79 3300026041 Ga0207639_10560170 Ga0207639_105601702 185
80 3300028381 Ga0268264_10005933 Ga0268264_1000593310 185
81 3300030521 Ga0307511_10000285 Ga0307511_1000028531 185
82 3300044719 Ga0466971_0088119 Ga0466971_0088119_461_1018 185
83 3300045049 Ga0466959_0001399 Ga0466959_0001399_2186_2743 185
84 3300046460 Ga0495638_0189848 Ga0495638_0189848_466_1023 185
85 3300046524 Ga0495648_0001994 Ga0495648_0001994_11416_11973 185
86 3300047472 Ga0495686_0000004 Ga0495686_0000004_483514_484116 185
87 3300053130 Ga0500642_0002202 Ga0500642_0002202_2612_3169 185
88 3300053140 Ga0500573_0103955 Ga0500573_0103955_730_1320 185
89 3300053146 Ga0500588_0004060 Ga0500588_0004060_1260_1817 185
90 3300053156 Ga0500622_0000900 Ga0500622_0000900_24163_24720 185
91 3300061719 Ga0466962_0037097 Ga0466962_0037097_1154_1711 185
92 3300003320 rootH2_10003541 rootH2_1000354112 186
93 3300013307 Ga0157372_10086188 Ga0157372_100861881 186
94 3300014969 Ga0157376_10002300 Ga0157376_1000230016 186
95 iso_pu_bacteria 2911138879 2911140291 186
96 3300005347 Ga0070668_100340221 Ga0070668_1003402212 187
97 3300005353 Ga0070669_100077070 Ga0070669_1000770704 187
98 3300005364 Ga0070673_101599306 Ga0070673_1015993061 187
99 3300005365 Ga0070688_100041313 Ga0070688_1000413135 187
100 3300005458 Ga0070681_10014654 Ga0070681_100146547 187
101 3300005466 Ga0070685_10552679 Ga0070685_105526791 187
102 3300005543 Ga0070672_100281764 Ga0070672_1002817643 187
103 3300014325 Ga0163163_11376813 Ga0163163_113768132 187
104 3300014326 Ga0157380_10002439 Ga0157380_100024399 187
105 3300025908 Ga0207643_10242930 Ga0207643_102429301 187
106 3300025912 Ga0207707_10139010 Ga0207707_101390103 187
107 3300025925 Ga0207650_10038885 Ga0207650_100388854 187
108 3300025926 Ga0207659_10759149 Ga0207659_107591491 187
109 3300025940 Ga0207691_10499992 Ga0207691_104999922 187
110 3300032002 Ga0307416_100503876 Ga0307416_1005038762 187
111 3300032004 Ga0307414_10414693 Ga0307414_104146932 187
112 3300033180 Ga0307510_10000805 Ga0307510_1000080512 187
113 3300046507 Ga0495606_0050751 Ga0495606_0050751_876_1484 187
114 3300049522 Ga0501299_000376 Ga0501299_000376_105_668 187
115 3300049571 Ga0501034_0332998 Ga0501034_0332998_832_1395 187
116 3300049580 Ga0501046_0137945 Ga0501046_0137945_89_652 187
117 3300049581 Ga0501047_0358231 Ga0501047_0358231_603_1166 187
118 3300049582 Ga0501048_0142781 Ga0501048_0142781_255_818 187
119 3300049583 Ga0501067_0016375 Ga0501067_0016375_1209_1772 187
120 3300049586 Ga0501070_0165165 Ga0501070_0165165_27_590 187
121 3300049587 Ga0501071_0628832 Ga0501071_0628832_130_693 187
122 3300049649 Ga0501198_000760 Ga0501198_000760_133_696 187
123 3300049651 Ga0501201_000177 Ga0501201_000177_104_667 187
124 3300049652 Ga0501202_000044 Ga0501202_000044_3189_3752 187
125 3300049654 Ga0501207_023131 Ga0501207_023131_105_668 187
126 3300049661 Ga0501217_063946 Ga0501217_063946_276_839 187
127 3300049661 Ga0501217_080554 Ga0501217_080554_123_686 187
128 3300049662 Ga0501222_027603 Ga0501222_027603_103_666 187
129 3300049663 Ga0501223_033699 Ga0501223_033699_347_910 187
130 3300049665 Ga0501227_035121 Ga0501227_035121_334_897 187
131 3300049668 Ga0501233_001446 Ga0501233_001446_340_903 187
132 3300049669 Ga0501235_003225 Ga0501235_003225_1114_1677 187
133 3300049674 Ga0501242_003591 Ga0501242_003591_830_1393 187
134 3300049675 Ga0501243_002282 Ga0501243_002282_342_905 187
135 3300049688 Ga0501259_018194 Ga0501259_018194_328_891 187
136 3300049704 Ga0501221_001236 Ga0501221_001236_1573_2136 187
137 3300049705 Ga0501225_0010110 Ga0501225_0010110_1882_2445 187
138 3300049707 Ga0501234_000133 Ga0501234_000133_2713_3276 187
139 3300049708 Ga0501245_014839 Ga0501245_014839_82_645 187
140 3300049742 Ga0501080_0476076 Ga0501080_0476076_24_587 187
141 3300049744 Ga0501083_0301822 Ga0501083_0301822_27_590 187
142 3300049744 Ga0501083_0563157 Ga0501083_0563157_152_715 187
143 3300049763 Ga0501266_020789 Ga0501266_020789_158_721 187
144 3300049775 Ga0501279_017103 Ga0501279_017103_176_739 187
145 3300049776 Ga0501280_007643 Ga0501280_007643_776_1339 187
146 3300049823 Ga0501044_0079225 Ga0501044_0079225_1813_2376 187
147 3300053090 Ga0500646_0137361 Ga0500646_0137361_194_757 187
148 3300005295 Ga0065707_10026270 Ga0065707_100262702 188
149 3300005330 Ga0070690_100049469 Ga0070690_1000494693 188
150 3300005441 Ga0070700_100098974 Ga0070700_1000989743 188
151 3300009093 Ga0105240_10288473 Ga0105240_102884731 188
152 3300009545 Ga0105237_10031794 Ga0105237_100317943 188
153 3300009551 Ga0105238_10390705 Ga0105238_103907051 188
154 3300010375 Ga0105239_10000048 Ga0105239_10000048157 188
155 3300013306 Ga0163162_10017671 Ga0163162_100176717 188
156 3300013307 Ga0157372_10002035 Ga0157372_100020354 188
157 3300025321 Ga0207656_10274294 Ga0207656_102742941 188
158 3300025904 Ga0207647_10090040 Ga0207647_100900402 188
159 3300026075 Ga0207708_10085873 Ga0207708_100858733 188
160 3300031251 Ga0265327_10048446 Ga0265327_100484463 188
161 3300031824 Ga0307413_10007405 Ga0307413_1000740510 188
162 3300031852 Ga0307410_10010058 Ga0307410_100100586 188
163 3300031852 Ga0307410_10259695 Ga0307410_102596952 188
164 3300031901 Ga0307406_10058684 Ga0307406_100586845 188
165 3300032002 Ga0307416_100069246 Ga0307416_1000692465 188
166 3300032126 Ga0307415_100156123 Ga0307415_1001561234 188
167 3300037466 Ga0395898_0068889 Ga0395898_0068889_894_1481 188
168 3300049521 Ga0501298_089445 Ga0501298_089445_19_585 188
169 3300049652 Ga0501202_006758 Ga0501202_006758_19_585 188
170 3300049661 Ga0501217_004903 Ga0501217_004903_636_1202 188
171 3300049663 Ga0501223_033871 Ga0501223_033871_270_836 188
172 3300049668 Ga0501233_048702 Ga0501233_048702_59_625 188
173 3300049669 Ga0501235_006083 Ga0501235_006083_1794_2360 188
174 3300049671 Ga0501238_010095 Ga0501238_010095_50_616 188
175 3300049705 Ga0501225_0059096 Ga0501225_0059096_415_981 188
176 3300049767 Ga0501270_017022 Ga0501270_017022_245_811 188
177 3300049771 Ga0501274_006474 Ga0501274_006474_20_586 188
178 3300050508 nmdc:mga09592_469177_c1 nmdc:mga09592_469177_c1_481_1047 188
179 3300002459 JGI24751J29686_10003924 JGI24751J29686_100039244 189
180 3300002459 JGI24751J29686_10005979 JGI24751J29686_100059793 189
181 3300003322 rootL2_10081164 rootL2_100811641 189
182 3300005334 Ga0068869_100157718 Ga0068869_1001577182 189
183 3300005356 Ga0070674_100568176 Ga0070674_1005681762 189
184 3300005367 Ga0070667_100794776 Ga0070667_1007947761 189
185 3300005456 Ga0070678_100066003 Ga0070678_1000660032 189
186 3300005459 Ga0068867_100055427 Ga0068867_1000554272 189
187 3300005530 Ga0070679_101047930 Ga0070679_1010479301 189
188 3300005563 Ga0068855_100637998 Ga0068855_1006379982 189
189 3300005563 Ga0068855_100787107 Ga0068855_1007871072 189
190 3300005618 Ga0068864_100027484 Ga0068864_1000274843 189
191 3300005718 Ga0068866_10122371 Ga0068866_101223712 189
192 3300005843 Ga0068860_100883173 Ga0068860_1008831731 189
193 3300006195 Ga0075366_10009711 Ga0075366_100097114 189
194 3300006195 Ga0075366_10147356 Ga0075366_101473562 189
195 3300006195 Ga0075366_10178241 Ga0075366_101782411 189
196 3300006881 Ga0068865_100299936 Ga0068865_1002999362 189
197 3300009176 Ga0105242_10042160 Ga0105242_100421603 189
198 3300009553 Ga0105249_10002924 Ga0105249_1000292410 189
199 3300010375 Ga0105239_12305392 Ga0105239_123053921 189
200 3300013104 Ga0157370_10598502 Ga0157370_105985022 189
201 3300013296 Ga0157374_10127736 Ga0157374_101277363 189
202 3300013307 Ga0157372_10048249 Ga0157372_100482493 189
203 3300013308 Ga0157375_10518735 Ga0157375_105187352 189
204 3300014325 Ga0163163_10694297 Ga0163163_106942972 189
205 3300014326 Ga0157380_10755370 Ga0157380_107553702 189
206 3300014969 Ga0157376_10295722 Ga0157376_102957222 189
207 3300014969 Ga0157376_11274525 Ga0157376_112745252 189
208 3300025907 Ga0207645_10007158 Ga0207645_100071583 189
209 3300025909 Ga0207705_10361394 Ga0207705_103613942 189
210 3300025925 Ga0207650_10352611 Ga0207650_103526111 189
211 3300025925 Ga0207650_10489201 Ga0207650_104892012 189
212 3300025935 Ga0207709_10318949 Ga0207709_103189492 189
213 3300025940 Ga0207691_10154582 Ga0207691_101545822 189
214 3300025940 Ga0207691_10351653 Ga0207691_103516532 189
215 3300025960 Ga0207651_10225882 Ga0207651_102258822 189
216 3300025961 Ga0207712_10030807 Ga0207712_100308073 189
217 3300025986 Ga0207658_10759948 Ga0207658_107599482 189
218 3300026089 Ga0207648_10006809 Ga0207648_100068098 189
219 3300026095 Ga0207676_10022185 Ga0207676_100221854 189
220 3300026118 Ga0207675_100137443 Ga0207675_1001374433 189
221 3300026118 Ga0207675_100174518 Ga0207675_1001745181 189
222 3300026121 Ga0207683_10092086 Ga0207683_100920864 189
223 3300028380 Ga0268265_10420324 Ga0268265_104203243 189
224 3300028381 Ga0268264_10111791 Ga0268264_101117911 189
225 3300031507 Ga0307509_10015768 Ga0307509_1001576810 189
226 3300041486 Ga0451807_2709964 Ga0451807_2709964_99_668 189
227 3300044656 Ga0466969_0000182 Ga0466969_0000182_32703_33323 189
228 3300044658 Ga0466972_0003013 Ga0466972_0003013_5173_5745 189
229 3300044684 Ga0466966_0014856 Ga0466966_0014856_207_827 189
230 3300044765 Ga0466970_0180950 Ga0466970_0180950_66_686 189
231 3300045049 Ga0466959_0000056 Ga0466959_0000056_30511_31131 189
232 3300046460 Ga0495638_0279694 Ga0495638_0279694_144_713 189
233 3300047320 Ga0495672_0316397 Ga0495672_0316397_142_711 189
234 3300049571 Ga0501034_0004706 Ga0501034_0004706_1046_1615 189
235 3300049572 Ga0501036_0064960 Ga0501036_0064960_922_1491 189
236 3300049573 Ga0501037_0028037 Ga0501037_0028037_1221_1790 189
237 3300049574 Ga0501038_0092841 Ga0501038_0092841_794_1363 189
238 3300049575 Ga0501039_0146562 Ga0501039_0146562_199_768 189
239 3300049579 Ga0501043_0039339 Ga0501043_0039339_940_1509 189
240 3300049580 Ga0501046_0046221 Ga0501046_0046221_454_1023 189
241 3300049581 Ga0501047_0056300 Ga0501047_0056300_2378_2950 189
242 3300049581 Ga0501047_0268228 Ga0501047_0268228_789_1358 189
243 3300049582 Ga0501048_0084535 Ga0501048_0084535_822_1391 189
244 3300049582 Ga0501048_0284831 Ga0501048_0284831_503_1075 189
245 3300049583 Ga0501067_0029635 Ga0501067_0029635_713_1282 189
246 3300049586 Ga0501070_0285348 Ga0501070_0285348_679_1248 189
247 3300049589 Ga0501073_0014462 Ga0501073_0014462_270_839 189
248 3300049590 Ga0501074_0014645 Ga0501074_0014645_757_1326 189
249 3300049741 Ga0501079_0352890 Ga0501079_0352890_12_581 189
250 3300049742 Ga0501080_0011972 Ga0501080_0011972_194_763 189
251 3300049744 Ga0501083_0038260 Ga0501083_0038260_2325_2894 189
252 3300049822 Ga0501035_0074366 Ga0501035_0074366_1001_1570 189
253 3300049823 Ga0501044_0048057 Ga0501044_0048057_1728_2297 189
254 3300050493 nmdc:mga0k408_149588_c1 nmdc:mga0k408_149588_c1_570_1139 189
255 3300050493 nmdc:mga0k408_8840_c1 nmdc:mga0k408_8840_c1_2772_3341 189
256 3300053104 Ga0500556_0252068 Ga0500556_0252068_88_660 189
257 3300053139 Ga0500568_0000306 Ga0500568_0000306_34973_35542 189
258 3300053146 Ga0500588_0029642 Ga0500588_0029642_888_1466 189
259 3300053727 Ga0500611_000028 Ga0500611_000028_22854_23423 189
260 3300060353 Ga0501082_0087577 Ga0501082_0087577_844_1413 189
261 3300005331 Ga0070670_100080392 Ga0070670_1000803922 190
262 3300005338 Ga0068868_100001540 Ga0068868_1000015405 190
263 3300005341 Ga0070691_10147830 Ga0070691_101478302 190
264 3300005834 Ga0068851_10110625 Ga0068851_101106252 190
265 3300005841 Ga0068863_100002125 Ga0068863_10000212520 190
266 3300006195 Ga0075366_10003238 Ga0075366_100032384 190
267 3300006358 Ga0068871_100727544 Ga0068871_1007275442 190
268 3300013296 Ga0157374_10064428 Ga0157374_100644283 190
269 3300013297 Ga0157378_10002969 Ga0157378_1000296911 190
270 3300013308 Ga0157375_10417578 Ga0157375_104175782 190
271 3300014325 Ga0163163_10172079 Ga0163163_101720792 190
272 3300025321 Ga0207656_10110528 Ga0207656_101105282 190
273 3300025925 Ga0207650_10003002 Ga0207650_100030026 190
274 3300025931 Ga0207644_10072811 Ga0207644_100728111 190
275 3300026023 Ga0207677_10010001 Ga0207677_100100013 190
276 3300026088 Ga0207641_10109066 Ga0207641_101090663 190
277 3300026095 Ga0207676_10226578 Ga0207676_102265782 190
278 3300046460 Ga0495638_0221314 Ga0495638_0221314_176_748 190
279 3300047320 Ga0495672_0025644 Ga0495672_0025644_2239_2814 190
280 3300047472 Ga0495686_0012413 Ga0495686_0012413_4059_4631 190
281 3300049744 Ga0501083_0074161 Ga0501083_0074161_689_1261 190
282 3300050493 nmdc:mga0k408_14082_c1 nmdc:mga0k408_14082_c1_1383_1955 190
283 3300000043 ARcpr5yngRDRAFT_c004433 ARcpr5yngRDRAFT_0044331 191
284 3300000044 ARSoilOldRDRAFT_c004955 ARSoilOldRDRAFT_0049552 191
285 3300002076 JGI24749J21850_1017256 JGI24749J21850_10172562 191
286 3300005290 Ga0065712_10073069 Ga0065712_100730692 191
287 3300005293 Ga0065715_10439045 Ga0065715_104390452 191
288 3300005295 Ga0065707_10003327 Ga0065707_100033273 191
289 3300005328 Ga0070676_10730802 Ga0070676_107308021 191
290 3300005329 Ga0070683_100145962 Ga0070683_1001459622 191
291 3300005330 Ga0070690_100034387 Ga0070690_1000343873 191
292 3300005331 Ga0070670_100036587 Ga0070670_1000365872 191
293 3300005338 Ga0068868_100004208 Ga0068868_1000042081 191
294 3300005340 Ga0070689_100001483 Ga0070689_10000148313 191
295 3300005340 Ga0070689_100046302 Ga0070689_1000463021 191
296 3300005340 Ga0070689_100227318 Ga0070689_1002273182 191
297 3300005343 Ga0070687_100102612 Ga0070687_1001026123 191
298 3300005347 Ga0070668_100033045 Ga0070668_1000330453 191
299 3300005353 Ga0070669_100000458 Ga0070669_10000045825 191
300 3300005354 Ga0070675_100273568 Ga0070675_1002735682 191
301 3300005356 Ga0070674_100454139 Ga0070674_1004541392 191
302 3300005364 Ga0070673_100005119 Ga0070673_1000051196 191
303 3300005364 Ga0070673_100876478 Ga0070673_1008764781 191
304 3300005365 Ga0070688_100000687 Ga0070688_10000068715 191
305 3300005365 Ga0070688_100274520 Ga0070688_1002745201 191
306 3300005366 Ga0070659_100030490 Ga0070659_1000304903 191
307 3300005366 Ga0070659_100292286 Ga0070659_1002922862 191
308 3300005441 Ga0070700_100079291 Ga0070700_1000792913 191
309 3300005457 Ga0070662_100014264 Ga0070662_1000142642 191
310 3300005457 Ga0070662_100075038 Ga0070662_1000750383 191
311 3300005457 Ga0070662_100147241 Ga0070662_1001472412 191
312 3300005459 Ga0068867_100111565 Ga0068867_1001115652 191
313 3300005459 Ga0068867_100233444 Ga0068867_1002334442 191
314 3300005466 Ga0070685_10023259 Ga0070685_100232593 191
315 3300005471 Ga0070698_100685702 Ga0070698_1006857021 191
316 3300005535 Ga0070684_100007763 Ga0070684_1000077639 191
317 3300005539 Ga0068853_100005622 Ga0068853_1000056225 191
318 3300005543 Ga0070672_100025613 Ga0070672_1000256133 191
319 3300005544 Ga0070686_100129478 Ga0070686_1001294783 191
320 3300005549 Ga0070704_100538748 Ga0070704_1005387482 191
321 3300005564 Ga0070664_100009504 Ga0070664_1000095045 191
322 3300005564 Ga0070664_100661729 Ga0070664_1006617291 191
323 3300005577 Ga0068857_100030730 Ga0068857_1000307303 191
324 3300005578 Ga0068854_100034866 Ga0068854_1000348664 191
325 3300005578 Ga0068854_100048652 Ga0068854_1000486522 191
326 3300005614 Ga0068856_100257542 Ga0068856_1002575422 191
327 3300005617 Ga0068859_100041535 Ga0068859_1000415353 191
328 3300005617 Ga0068859_100092592 Ga0068859_1000925923 191
329 3300005617 Ga0068859_100368563 Ga0068859_1003685633 191
330 3300005618 Ga0068864_100051263 Ga0068864_1000512632 191
331 3300005618 Ga0068864_100410571 Ga0068864_1004105712 191
332 3300005719 Ga0068861_100000225 Ga0068861_1000002253 191
333 3300005719 Ga0068861_100658708 Ga0068861_1006587082 191
334 3300005840 Ga0068870_10019966 Ga0068870_100199664 191
335 3300005842 Ga0068858_100034683 Ga0068858_1000346833 191
336 3300005844 Ga0068862_100016616 Ga0068862_1000166163 191
337 3300005844 Ga0068862_101541209 Ga0068862_1015412091 191
338 3300006237 Ga0097621_100131313 Ga0097621_1001313132 191
339 3300006358 Ga0068871_100658295 Ga0068871_1006582952 191
340 3300006881 Ga0068865_100619428 Ga0068865_1006194282 191
341 3300006931 Ga0097620_100041533 Ga0097620_1000415333 191
342 3300006931 Ga0097620_100092588 Ga0097620_1000925883 191
343 3300006931 Ga0097620_100368532 Ga0097620_1003685323 191
344 3300009094 Ga0111539_10006834 Ga0111539_100068346 191
345 3300009101 Ga0105247_10398246 Ga0105247_103982462 191
346 3300009176 Ga0105242_10797314 Ga0105242_107973142 191
347 3300009553 Ga0105249_10020253 Ga0105249_100202536 191
348 3300009553 Ga0105249_10207200 Ga0105249_102072003 191
349 3300010375 Ga0105239_11361628 Ga0105239_113616281 191
350 3300013100 Ga0157373_10136021 Ga0157373_101360212 191
351 3300013104 Ga0157370_10077001 Ga0157370_100770012 191
352 3300013296 Ga0157374_10072106 Ga0157374_100721063 191
353 3300013296 Ga0157374_10082273 Ga0157374_100822734 191
354 3300013306 Ga0163162_10002326 Ga0163162_1000232620 191
355 3300013306 Ga0163162_10130927 Ga0163162_101309273 191
356 3300013306 Ga0163162_10236379 Ga0163162_102363793 191
357 3300013307 Ga0157372_10113422 Ga0157372_101134222 191
358 3300013308 Ga0157375_10192005 Ga0157375_101920053 191
359 3300013308 Ga0157375_11720379 Ga0157375_117203791 191
360 3300014325 Ga0163163_10377909 Ga0163163_103779092 191
361 3300014326 Ga0157380_10002418 Ga0157380_100024186 191
362 3300014326 Ga0157380_10205208 Ga0157380_102052082 191
363 3300014326 Ga0157380_10632717 Ga0157380_106327172 191
364 3300014745 Ga0157377_10000289 Ga0157377_1000028916 191
365 3300014745 Ga0157377_10065882 Ga0157377_100658822 191
366 3300014745 Ga0157377_10766375 Ga0157377_107663751 191
367 3300014968 Ga0157379_10030191 Ga0157379_100301914 191
368 3300025315 Ga0207697_10094300 Ga0207697_100943003 191
369 3300025908 Ga0207643_10049870 Ga0207643_100498703 191
370 3300025918 Ga0207662_10146328 Ga0207662_101463283 191
371 3300025918 Ga0207662_10654569 Ga0207662_106545691 191
372 3300025920 Ga0207649_10024736 Ga0207649_100247363 191
373 3300025920 Ga0207649_10424744 Ga0207649_104247441 191
374 3300025923 Ga0207681_10014054 Ga0207681_100140542 191
375 3300025925 Ga0207650_10121963 Ga0207650_101219633 191
376 3300025925 Ga0207650_10393583 Ga0207650_103935832 191
377 3300025926 Ga0207659_10189861 Ga0207659_101898613 191
378 3300025931 Ga0207644_11033121 Ga0207644_110331212 191
379 3300025932 Ga0207690_10234692 Ga0207690_102346921 191
380 3300025933 Ga0207706_10133193 Ga0207706_101331933 191
381 3300025933 Ga0207706_10183725 Ga0207706_101837252 191
382 3300025936 Ga0207670_10011769 Ga0207670_100117693 191
383 3300025940 Ga0207691_10039066 Ga0207691_100390664 191
384 3300025942 Ga0207689_10220798 Ga0207689_102207983 191
385 3300025944 Ga0207661_10000927 Ga0207661_1000092719 191
386 3300025944 Ga0207661_10135257 Ga0207661_101352573 191
387 3300025945 Ga0207679_10012298 Ga0207679_100122984 191
388 3300025945 Ga0207679_10441991 Ga0207679_104419912 191
389 3300025945 Ga0207679_10547000 Ga0207679_105470001 191
390 3300025960 Ga0207651_10846702 Ga0207651_108467021 191
391 3300025961 Ga0207712_10065768 Ga0207712_100657683 191
392 3300025961 Ga0207712_10168189 Ga0207712_101681892 191
393 3300025972 Ga0207668_10180227 Ga0207668_101802272 191
394 3300025981 Ga0207640_10020131 Ga0207640_100201313 191
395 3300025981 Ga0207640_10039229 Ga0207640_100392293 191
396 3300026023 Ga0207677_10035021 Ga0207677_100350214 191
397 3300026041 Ga0207639_10010461 Ga0207639_100104614 191
398 3300026075 Ga0207708_10106564 Ga0207708_101065642 191
399 3300026075 Ga0207708_11264777 Ga0207708_112647771 191
400 3300026089 Ga0207648_10069923 Ga0207648_100699232 191
401 3300026089 Ga0207648_10112212 Ga0207648_101122122 191
402 3300026095 Ga0207676_10560033 Ga0207676_105600331 191
403 3300026116 Ga0207674_10002719 Ga0207674_1000271922 191
404 3300026116 Ga0207674_10025545 Ga0207674_100255457 191
405 3300026116 Ga0207674_10122656 Ga0207674_101226562 191
406 3300026118 Ga0207675_100000386 Ga0207675_10000038614 191
407 3300026118 Ga0207675_100431302 Ga0207675_1004313022 191
408 3300027907 Ga0207428_10027645 Ga0207428_100276455 191
409 3300028380 Ga0268265_10266885 Ga0268265_102668853 191
410 3300031456 Ga0307513_10285032 Ga0307513_102850322 191
411 3300035120 Ga0373957_0102365 Ga0373957_0102365_419_994 191
412 3300035171 Ga0373946_0200926 Ga0373946_0200926_199_774 191
413 3300035724 Ga0373933_0212812 Ga0373933_0212812_591_1166 191
414 3300035725 Ga0373947_0154227 Ga0373947_0154227_209_784 191
415 3300036401 Ga0373937_0027905 Ga0373937_0027905_2535_3110 191
416 3300037068 Ga0373925_0286067 Ga0373925_0286067_518_1093 191
417 3300041410 Ga0439461_0010508 Ga0439461_0010508_619_1194 191
418 3300041509 Ga0451843_0344114 Ga0451843_0344114_47_622 191
419 3300042131 Ga0450894_004960 Ga0450894_004960_280_855 191
420 3300042135 Ga0450899_005125 Ga0450899_005125_147_722 191
421 3300042435 Ga0439434_0074662 Ga0439434_0074662_365_940 191
422 3300042532 Ga0450893_0029653 Ga0450893_0029653_297_872 191
423 3300044712 Ga0453684_0117232 Ga0453684_0117232_1397_1972 191
424 3300046472 Ga0495580_0639584 Ga0495580_0639584_103_678 191
425 3300046511 Ga0495608_0125173 Ga0495608_0125173_459_1034 191
426 3300046516 Ga0495628_0241722 Ga0495628_0241722_109_684 191
427 3300046517 Ga0495630_0014413 Ga0495630_0014413_3973_4548 191
428 3300046522 Ga0495643_0019504 Ga0495643_0019504_3123_3698 191
429 3300046536 Ga0495587_0271126 Ga0495587_0271126_280_855 191
430 3300046559 Ga0495667_0251073 Ga0495667_0251073_79_654 191
431 3300046690 Ga0495624_0195153 Ga0495624_0195153_128_703 191
432 3300046809 Ga0495600_0121764 Ga0495600_0121764_590_1165 191
433 3300047322 Ga0495680_0228631 Ga0495680_0228631_641_1216 191
434 3300047471 Ga0495684_0283950 Ga0495684_0283950_554_1129 191
435 3300048907 Ga0496104_0563328 Ga0496104_0563328_453_1028 191
436 3300048913 Ga0496110_0039739 Ga0496110_0039739_957_1532 191
437 3300048914 Ga0496111_0711500 Ga0496111_0711500_78_653 191
438 3300050511 nmdc:mga08y16_13394_c1 nmdc:mga08y16_13394_c1_7252_7833 191
439 3300050512 nmdc:mga0n895_220022_c1 nmdc:mga0n895_220022_c1_414_989 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

49

119

0.96

Feature Viewer

pLDDT pTM Quality
86.67 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map