F444228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 439 | 244 | 438 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10285032|Ga0307513_102850322 |
| Length | 215 |
| Sequence | LLKNYFSGGAAGLLFLKKSIKYGFVKVEHNEKALLLGLARNDKKAVETIYRENYTMVQSLIINNNGSADDAKDVFQEAMIVLYEKARSGTFELNCLVKTYIYSVSRRLWLKRLQQSSRYSGDIGHAENVVPVEEDIEDHIQRDAEFEMMDKAINNLGEPCKSLLTAFYLQKQNMQEIALSFGYTNAENAKTQKYKCLMRLKKIFFTHYKNGAGDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 134 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 135 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 143 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 144 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 152 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 154 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 155 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 156 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 157 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 158 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 159 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 160 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 165 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 188 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 204 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 205 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 207 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 208 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 209 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 211 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 214 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 216 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 218 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 225 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 227 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 232 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 236 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 237 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 238 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 239 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 240 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 241 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 242 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.64 |
| Nodule | 0 |
| Rhizoplane | 1.14 |
| Rhizosphere | 93.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5yngRDRAFT_c004433 | 3300000043 | Bacteria | 1332 |
| 2 | ARSoilOldRDRAFT_c004955 | 3300000044 | Bacteria | 1123 |
| 3 | JGI24749J21850_1017256 | 3300002076 | Bacteria | 1015 |
| 4 | JGI24751J29686_10003924 | 3300002459 | Bacteria | 3004 |
| 5 | JGI24751J29686_10005979 | 3300002459 | Bacteria | 2481 |
| 6 | rootH2_10003541 | 3300003320 | Bacteria | 18770 |
| 7 | rootL2_10081164 | 3300003322 | Bacteria | 1960 |
| 8 | rootL2_10088173 | 3300003322 | Bacteria | 2502 |
| 9 | Ga0065712_10073069 | 3300005290 | Bacteria | 4513 |
| 10 | Ga0065715_10439045 | 3300005293 | Bacteria | 838 |
| 11 | Ga0065707_10003327 | 3300005295 | Bacteria | 5453 |
| 12 | Ga0065707_10026270 | 3300005295 | Bacteria | 1227 |
| 13 | Ga0070676_10730802 | 3300005328 | Bacteria | 725 |
| 14 | Ga0070683_100071654 | 3300005329 | Bacteria | 3233 |
| 15 | Ga0070683_100145962 | 3300005329 | Unclassified | 2242 |
| 16 | Ga0070690_100034387 | 3300005330 | Unclassified | 3176 |
| 17 | Ga0070690_100049469 | 3300005330 | Bacteria | 2680 |
| 18 | Ga0070670_100036587 | 3300005331 | Bacteria | 4224 |
| 19 | Ga0070670_100080392 | 3300005331 | Bacteria | 2801 |
| 20 | Ga0068869_100137379 | 3300005334 | Unclassified | 1884 |
| 21 | Ga0068869_100157718 | 3300005334 | Bacteria | 1765 |
| 22 | Ga0070666_10020827 | 3300005335 | Bacteria | 4243 |
| 23 | Ga0070666_10740094 | 3300005335 | Bacteria | 722 |
| 24 | Ga0068868_100001540 | 3300005338 | Bacteria | 15748 |
| 25 | Ga0068868_100004208 | 3300005338 | Bacteria | 10068 |
| 26 | Ga0068868_100242595 | 3300005338 | Unclassified | 1514 |
| 27 | Ga0070689_100001483 | 3300005340 | Bacteria | 14964 |
| 28 | Ga0070689_100008364 | 3300005340 | Bacteria | 7286 |
| 29 | Ga0070689_100046302 | 3300005340 | Unclassified | 3351 |
| 30 | Ga0070689_100227318 | 3300005340 | Bacteria | 1533 |
| 31 | Ga0070691_10017336 | 3300005341 | Unclassified | 3313 |
| 32 | Ga0070691_10147830 | 3300005341 | Bacteria | 1202 |
| 33 | Ga0070687_100102612 | 3300005343 | Bacteria | 1604 |
| 34 | Ga0070661_100041644 | 3300005344 | Bacteria | 3351 |
| 35 | Ga0070668_100033045 | 3300005347 | Bacteria | 3938 |
| 36 | Ga0070668_100340221 | 3300005347 | Bacteria | 1267 |
| 37 | Ga0070669_100000458 | 3300005353 | Bacteria | 30951 |
| 38 | Ga0070669_100077070 | 3300005353 | Bacteria | 2476 |
| 39 | Ga0070675_100093750 | 3300005354 | Bacteria | 2518 |
| 40 | Ga0070675_100273568 | 3300005354 | Bacteria | 1483 |
| 41 | Ga0070674_100454139 | 3300005356 | Bacteria | 1058 |
| 42 | Ga0070674_100568176 | 3300005356 | Bacteria | 954 |
| 43 | Ga0070673_100005119 | 3300005364 | Bacteria | 8362 |
| 44 | Ga0070673_100384693 | 3300005364 | Unclassified | 1251 |
| 45 | Ga0070673_100876478 | 3300005364 | Bacteria | 832 |
| 46 | Ga0070673_101599306 | 3300005364 | Unclassified | 616 |
| 47 | Ga0070688_100000687 | 3300005365 | Bacteria | 16799 |
| 48 | Ga0070688_100041313 | 3300005365 | Bacteria | 2830 |
| 49 | Ga0070688_100044335 | 3300005365 | Bacteria | 2744 |
| 50 | Ga0070688_100274520 | 3300005365 | Unclassified | 1209 |
| 51 | Ga0070659_100030490 | 3300005366 | Bacteria | 4174 |
| 52 | Ga0070659_100292286 | 3300005366 | Bacteria | 1357 |
| 53 | Ga0070667_100794776 | 3300005367 | Bacteria | 878 |
| 54 | Ga0070700_100079291 | 3300005441 | Bacteria | 2116 |
| 55 | Ga0070700_100098974 | 3300005441 | Bacteria | 1918 |
| 56 | Ga0070663_100145029 | 3300005455 | Unclassified | 1816 |
| 57 | Ga0070678_100066003 | 3300005456 | Bacteria | 2689 |
| 58 | Ga0070662_100014264 | 3300005457 | Bacteria | 5305 |
| 59 | Ga0070662_100075038 | 3300005457 | Bacteria | 2503 |
| 60 | Ga0070662_100147241 | 3300005457 | Bacteria | 1830 |
| 61 | Ga0070681_10014654 | 3300005458 | Bacteria | 7798 |
| 62 | Ga0068867_100055427 | 3300005459 | Bacteria | 2931 |
| 63 | Ga0068867_100111565 | 3300005459 | Bacteria | 2101 |
| 64 | Ga0068867_100233444 | 3300005459 | Bacteria | 1488 |
| 65 | Ga0070685_10023259 | 3300005466 | Bacteria | 3391 |
| 66 | Ga0070685_10097419 | 3300005466 | Unclassified | 1791 |
| 67 | Ga0070685_10552679 | 3300005466 | Bacteria | 822 |
| 68 | Ga0070698_100685702 | 3300005471 | Bacteria | 966 |
| 69 | Ga0070679_101047930 | 3300005530 | Bacteria | 760 |
| 70 | Ga0070684_100007763 | 3300005535 | Bacteria | 8363 |
| 71 | Ga0070684_100029812 | 3300005535 | Bacteria | 4628 |
| 72 | Ga0068853_100001585 | 3300005539 | Bacteria | 16590 |
| 73 | Ga0068853_100005622 | 3300005539 | Bacteria | 9849 |
| 74 | Ga0070672_100025613 | 3300005543 | Bacteria | 4379 |
| 75 | Ga0070672_100270153 | 3300005543 | Unclassified | 1436 |
| 76 | Ga0070672_100281764 | 3300005543 | Bacteria | 1405 |
| 77 | Ga0070686_100129478 | 3300005544 | Bacteria | 1743 |
| 78 | Ga0070704_100538748 | 3300005549 | Bacteria | 1018 |
| 79 | Ga0068855_100171423 | 3300005563 | Unclassified | 2458 |
| 80 | Ga0068855_100637998 | 3300005563 | Bacteria | 1145 |
| 81 | Ga0068855_100787107 | 3300005563 | Bacteria | 1012 |
| 82 | Ga0070664_100009504 | 3300005564 | Bacteria | 7883 |
| 83 | Ga0070664_100101558 | 3300005564 | Bacteria | 2501 |
| 84 | Ga0070664_100661729 | 3300005564 | Unclassified | 971 |
| 85 | Ga0068857_100030730 | 3300005577 | Bacteria | 4745 |
| 86 | Ga0068857_100232392 | 3300005577 | Unclassified | 1687 |
| 87 | Ga0068854_100034866 | 3300005578 | Bacteria | 3519 |
| 88 | Ga0068854_100048652 | 3300005578 | Bacteria | 3026 |
| 89 | Ga0068856_100257542 | 3300005614 | Bacteria | 1760 |
| 90 | Ga0068859_100041535 | 3300005617 | Unclassified | 4619 |
| 91 | Ga0068859_100092592 | 3300005617 | Bacteria | 3074 |
| 92 | Ga0068859_100177777 | 3300005617 | Unclassified | 2210 |
| 93 | Ga0068859_100368563 | 3300005617 | Bacteria | 1532 |
| 94 | Ga0068864_100012297 | 3300005618 | Bacteria | 7074 |
| 95 | Ga0068864_100027484 | 3300005618 | Unclassified | 4806 |
| 96 | Ga0068864_100051263 | 3300005618 | Bacteria | 3554 |
| 97 | Ga0068864_100410571 | 3300005618 | Unclassified | 1288 |
| 98 | Ga0068866_10122371 | 3300005718 | Bacteria | 1468 |
| 99 | Ga0068861_100000225 | 3300005719 | Bacteria | 30713 |
| 100 | Ga0068861_100658708 | 3300005719 | Bacteria | 968 |
| 101 | Ga0068851_10110625 | 3300005834 | Bacteria | 1466 |
| 102 | Ga0068870_10019966 | 3300005840 | Bacteria | 3256 |
| 103 | Ga0068863_100002125 | 3300005841 | Bacteria | 19657 |
| 104 | Ga0068863_100658704 | 3300005841 | Bacteria | 1039 |
| 105 | Ga0068858_100034683 | 3300005842 | Bacteria | 4680 |
| 106 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 107 | Ga0068860_100883173 | 3300005843 | Bacteria | 910 |
| 108 | Ga0068862_100016616 | 3300005844 | Bacteria | 6127 |
| 109 | Ga0068862_100532918 | 3300005844 | Bacteria | 1119 |
| 110 | Ga0068862_101541209 | 3300005844 | Unclassified | 671 |
| 111 | Ga0081540_1014264 | 3300005983 | Bacteria | 5102 |
| 112 | Ga0075366_10003238 | 3300006195 | Bacteria | 8556 |
| 113 | Ga0075366_10009711 | 3300006195 | Bacteria | 5378 |
| 114 | Ga0075366_10147356 | 3300006195 | Bacteria | 1425 |
| 115 | Ga0075366_10178241 | 3300006195 | Bacteria | 1290 |
| 116 | Ga0097621_100131313 | 3300006237 | Bacteria | 2132 |
| 117 | Ga0068871_100658295 | 3300006358 | Bacteria | 957 |
| 118 | Ga0068871_100727544 | 3300006358 | Bacteria | 911 |
| 119 | Ga0068865_100299936 | 3300006881 | Bacteria | 1286 |
| 120 | Ga0068865_100619428 | 3300006881 | Bacteria | 917 |
| 121 | Ga0097620_100041533 | 3300006931 | Unclassified | 4619 |
| 122 | Ga0097620_100092588 | 3300006931 | Bacteria | 3074 |
| 123 | Ga0097620_100177782 | 3300006931 | Unclassified | 2210 |
| 124 | Ga0097620_100368532 | 3300006931 | Bacteria | 1532 |
| 125 | Ga0105240_10175593 | 3300009093 | Bacteria | 2533 |
| 126 | Ga0105240_10288473 | 3300009093 | Bacteria | 1882 |
| 127 | Ga0111539_10006834 | 3300009094 | Bacteria | 14661 |
| 128 | Ga0105247_10398246 | 3300009101 | Unclassified | 980 |
| 129 | Ga0105242_10042160 | 3300009176 | Bacteria | 3684 |
| 130 | Ga0105242_10797314 | 3300009176 | Bacteria | 935 |
| 131 | Ga0105237_10000563 | 3300009545 | Bacteria | 51816 |
| 132 | Ga0105237_10020194 | 3300009545 | Bacteria | 6875 |
| 133 | Ga0105237_10031794 | 3300009545 | Bacteria | 5346 |
| 134 | Ga0105237_10034848 | 3300009545 | Bacteria | 5093 |
| 135 | Ga0105238_10390705 | 3300009551 | Bacteria | 1383 |
| 136 | Ga0105249_10002924 | 3300009553 | Bacteria | 14735 |
| 137 | Ga0105249_10020253 | 3300009553 | Bacteria | 5945 |
| 138 | Ga0105249_10207200 | 3300009553 | Bacteria | 1922 |
| 139 | Ga0105249_10230809 | 3300009553 | Bacteria | 1825 |
| 140 | Ga0105249_10860095 | 3300009553 | Unclassified | 972 |
| 141 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 142 | Ga0105239_10003203 | 3300010375 | Bacteria | 20233 |
| 143 | Ga0105239_10078746 | 3300010375 | Bacteria | 3627 |
| 144 | Ga0105239_11361628 | 3300010375 | Bacteria | 819 |
| 145 | Ga0105239_12305392 | 3300010375 | Bacteria | 626 |
| 146 | Ga0105246_10354742 | 3300011119 | Unclassified | 1203 |
| 147 | Ga0157373_10136021 | 3300013100 | Unclassified | 1728 |
| 148 | Ga0157370_10077001 | 3300013104 | Bacteria | 3142 |
| 149 | Ga0157370_10598502 | 3300013104 | Unclassified | 1009 |
| 150 | Ga0157374_10031789 | 3300013296 | Bacteria | 4801 |
| 151 | Ga0157374_10064428 | 3300013296 | Bacteria | 3439 |
| 152 | Ga0157374_10072106 | 3300013296 | Bacteria | 3258 |
| 153 | Ga0157374_10082273 | 3300013296 | Bacteria | 3057 |
| 154 | Ga0157374_10127736 | 3300013296 | Bacteria | 2458 |
| 155 | Ga0157378_10002969 | 3300013297 | Bacteria | 15088 |
| 156 | Ga0163162_10001998 | 3300013306 | Bacteria | 19189 |
| 157 | Ga0163162_10002326 | 3300013306 | Bacteria | 17832 |
| 158 | Ga0163162_10017671 | 3300013306 | Bacteria | 6978 |
| 159 | Ga0163162_10130927 | 3300013306 | Bacteria | 2617 |
| 160 | Ga0163162_10236379 | 3300013306 | Unclassified | 1958 |
| 161 | Ga0157372_10002035 | 3300013307 | Bacteria | 21994 |
| 162 | Ga0157372_10048249 | 3300013307 | Bacteria | 4733 |
| 163 | Ga0157372_10086188 | 3300013307 | Bacteria | 3563 |
| 164 | Ga0157372_10113422 | 3300013307 | Bacteria | 3106 |
| 165 | Ga0157372_11355704 | 3300013307 | Bacteria | 820 |
| 166 | Ga0157375_10075816 | 3300013308 | Bacteria | 3388 |
| 167 | Ga0157375_10192005 | 3300013308 | Bacteria | 2197 |
| 168 | Ga0157375_10414316 | 3300013308 | Bacteria | 1513 |
| 169 | Ga0157375_10417578 | 3300013308 | Bacteria | 1508 |
| 170 | Ga0157375_10518735 | 3300013308 | Unclassified | 1355 |
| 171 | Ga0157375_11720379 | 3300013308 | Bacteria | 743 |
| 172 | Ga0163163_10010371 | 3300014325 | Bacteria | 8372 |
| 173 | Ga0163163_10172079 | 3300014325 | Bacteria | 2212 |
| 174 | Ga0163163_10377909 | 3300014325 | Bacteria | 1474 |
| 175 | Ga0163163_10694297 | 3300014325 | Bacteria | 1081 |
| 176 | Ga0163163_11376813 | 3300014325 | Bacteria | 767 |
| 177 | Ga0157380_10002418 | 3300014326 | Bacteria | 12574 |
| 178 | Ga0157380_10002439 | 3300014326 | Bacteria | 12531 |
| 179 | Ga0157380_10205208 | 3300014326 | Bacteria | 1752 |
| 180 | Ga0157380_10632717 | 3300014326 | Bacteria | 1064 |
| 181 | Ga0157380_10755370 | 3300014326 | Bacteria | 984 |
| 182 | Ga0157377_10000289 | 3300014745 | Bacteria | 23989 |
| 183 | Ga0157377_10065882 | 3300014745 | Bacteria | 2082 |
| 184 | Ga0157377_10766375 | 3300014745 | Unclassified | 708 |
| 185 | Ga0157379_10030191 | 3300014968 | Unclassified | 4823 |
| 186 | Ga0157379_10147844 | 3300014968 | Unclassified | 2119 |
| 187 | Ga0157379_10526962 | 3300014968 | Bacteria | 1097 |
| 188 | Ga0157376_10002300 | 3300014969 | Bacteria | 12901 |
| 189 | Ga0157376_10295722 | 3300014969 | Bacteria | 1531 |
| 190 | Ga0157376_11274525 | 3300014969 | Bacteria | 764 |
| 191 | Ga0207697_10070868 | 3300025315 | Bacteria | 1461 |
| 192 | Ga0207697_10094300 | 3300025315 | Bacteria | 1270 |
| 193 | Ga0207656_10110528 | 3300025321 | Bacteria | 1269 |
| 194 | Ga0207656_10274294 | 3300025321 | Bacteria | 830 |
| 195 | Ga0207680_10025175 | 3300025903 | Bacteria | 3280 |
| 196 | Ga0207680_10648731 | 3300025903 | Bacteria | 756 |
| 197 | Ga0207647_10081764 | 3300025904 | Bacteria | 1935 |
| 198 | Ga0207647_10090040 | 3300025904 | Bacteria | 1831 |
| 199 | Ga0207645_10007158 | 3300025907 | Bacteria | 7912 |
| 200 | Ga0207643_10049870 | 3300025908 | Bacteria | 2373 |
| 201 | Ga0207643_10242930 | 3300025908 | Bacteria | 1107 |
| 202 | Ga0207705_10361394 | 3300025909 | Unclassified | 1120 |
| 203 | Ga0207707_10139010 | 3300025912 | Bacteria | 2124 |
| 204 | Ga0207695_10000023 | 3300025913 | Bacteria | 657903 |
| 205 | Ga0207695_10000229 | 3300025913 | Bacteria | 149313 |
| 206 | Ga0207695_10002425 | 3300025913 | Bacteria | 27622 |
| 207 | Ga0207695_10016531 | 3300025913 | Bacteria | 8626 |
| 208 | Ga0207695_10834910 | 3300025913 | Bacteria | 801 |
| 209 | Ga0207671_10003761 | 3300025914 | Bacteria | 14941 |
| 210 | Ga0207671_10004878 | 3300025914 | Bacteria | 12608 |
| 211 | Ga0207671_10048967 | 3300025914 | Unclassified | 3127 |
| 212 | Ga0207662_10146328 | 3300025918 | Bacteria | 1500 |
| 213 | Ga0207662_10654569 | 3300025918 | Bacteria | 734 |
| 214 | Ga0207649_10024736 | 3300025920 | Bacteria | 3494 |
| 215 | Ga0207649_10424744 | 3300025920 | Unclassified | 999 |
| 216 | Ga0207681_10014054 | 3300025923 | Bacteria | 4963 |
| 217 | Ga0207694_10091143 | 3300025924 | Bacteria | 2406 |
| 218 | Ga0207650_10003002 | 3300025925 | Bacteria | 11627 |
| 219 | Ga0207650_10038885 | 3300025925 | Bacteria | 3477 |
| 220 | Ga0207650_10121963 | 3300025925 | Bacteria | 2030 |
| 221 | Ga0207650_10352611 | 3300025925 | Bacteria | 1211 |
| 222 | Ga0207650_10393583 | 3300025925 | Bacteria | 1146 |
| 223 | Ga0207650_10489201 | 3300025925 | Bacteria | 1027 |
| 224 | Ga0207659_10189861 | 3300025926 | Bacteria | 1634 |
| 225 | Ga0207659_10759149 | 3300025926 | Bacteria | 832 |
| 226 | Ga0207644_10072811 | 3300025931 | Bacteria | 2518 |
| 227 | Ga0207644_11033121 | 3300025931 | Bacteria | 690 |
| 228 | Ga0207690_10234692 | 3300025932 | Bacteria | 1410 |
| 229 | Ga0207706_10133193 | 3300025933 | Bacteria | 2186 |
| 230 | Ga0207706_10183725 | 3300025933 | Bacteria | 1836 |
| 231 | Ga0207709_10318949 | 3300025935 | Bacteria | 1162 |
| 232 | Ga0207670_10011769 | 3300025936 | Bacteria | 5092 |
| 233 | Ga0207670_10024788 | 3300025936 | Bacteria | 3755 |
| 234 | Ga0207691_10039066 | 3300025940 | Bacteria | 4392 |
| 235 | Ga0207691_10154582 | 3300025940 | Unclassified | 2015 |
| 236 | Ga0207691_10342742 | 3300025940 | Unclassified | 1279 |
| 237 | Ga0207691_10351653 | 3300025940 | Bacteria | 1261 |
| 238 | Ga0207691_10499992 | 3300025940 | Bacteria | 1033 |
| 239 | Ga0207689_10220798 | 3300025942 | Bacteria | 1566 |
| 240 | Ga0207661_10000927 | 3300025944 | Bacteria | 19231 |
| 241 | Ga0207661_10107897 | 3300025944 | Unclassified | 2349 |
| 242 | Ga0207661_10135257 | 3300025944 | Unclassified | 2116 |
| 243 | Ga0207679_10012298 | 3300025945 | Bacteria | 5577 |
| 244 | Ga0207679_10441991 | 3300025945 | Unclassified | 1152 |
| 245 | Ga0207679_10547000 | 3300025945 | Bacteria | 1038 |
| 246 | Ga0207667_10123299 | 3300025949 | Unclassified | 2670 |
| 247 | Ga0207651_10225882 | 3300025960 | Bacteria | 1517 |
| 248 | Ga0207651_10846702 | 3300025960 | Bacteria | 812 |
| 249 | Ga0207712_10030807 | 3300025961 | Bacteria | 3608 |
| 250 | Ga0207712_10065768 | 3300025961 | Bacteria | 2589 |
| 251 | Ga0207712_10168189 | 3300025961 | Bacteria | 1711 |
| 252 | Ga0207712_10274486 | 3300025961 | Bacteria | 1373 |
| 253 | Ga0207668_10180227 | 3300025972 | Bacteria | 1665 |
| 254 | Ga0207640_10020131 | 3300025981 | Bacteria | 3957 |
| 255 | Ga0207640_10039229 | 3300025981 | Bacteria | 2996 |
| 256 | Ga0207658_10759948 | 3300025986 | Bacteria | 878 |
| 257 | Ga0207677_10010001 | 3300026023 | Bacteria | 5353 |
| 258 | Ga0207677_10035021 | 3300026023 | Bacteria | 3256 |
| 259 | Ga0207677_10211260 | 3300026023 | Unclassified | 1550 |
| 260 | Ga0207639_10010461 | 3300026041 | Bacteria | 6427 |
| 261 | Ga0207639_10051489 | 3300026041 | Bacteria | 3132 |
| 262 | Ga0207639_10560170 | 3300026041 | Bacteria | 1050 |
| 263 | Ga0207639_10942541 | 3300026041 | Unclassified | 808 |
| 264 | Ga0207678_10037820 | 3300026067 | Bacteria | 4196 |
| 265 | Ga0207708_10085873 | 3300026075 | Bacteria | 2421 |
| 266 | Ga0207708_10106564 | 3300026075 | Bacteria | 2173 |
| 267 | Ga0207708_11264777 | 3300026075 | Bacteria | 646 |
| 268 | Ga0207702_11228656 | 3300026078 | Bacteria | 743 |
| 269 | Ga0207641_10109066 | 3300026088 | Bacteria | 2451 |
| 270 | Ga0207648_10006809 | 3300026089 | Bacteria | 11325 |
| 271 | Ga0207648_10069923 | 3300026089 | Bacteria | 3059 |
| 272 | Ga0207648_10112212 | 3300026089 | Bacteria | 2394 |
| 273 | Ga0207676_10022185 | 3300026095 | Bacteria | 4668 |
| 274 | Ga0207676_10025336 | 3300026095 | Bacteria | 4401 |
| 275 | Ga0207676_10226578 | 3300026095 | Bacteria | 1668 |
| 276 | Ga0207676_10560033 | 3300026095 | Bacteria | 1093 |
| 277 | Ga0207674_10002719 | 3300026116 | Bacteria | 22062 |
| 278 | Ga0207674_10025545 | 3300026116 | Bacteria | 6296 |
| 279 | Ga0207674_10107588 | 3300026116 | Unclassified | 2765 |
| 280 | Ga0207674_10122656 | 3300026116 | Bacteria | 2565 |
| 281 | Ga0207675_100000386 | 3300026118 | Bacteria | 42305 |
| 282 | Ga0207675_100137443 | 3300026118 | Bacteria | 2320 |
| 283 | Ga0207675_100174518 | 3300026118 | Unclassified | 2056 |
| 284 | Ga0207675_100431302 | 3300026118 | Bacteria | 1303 |
| 285 | Ga0207683_10092086 | 3300026121 | Bacteria | 2701 |
| 286 | Ga0207428_10027645 | 3300027907 | Bacteria | 4720 |
| 287 | Ga0268265_10266885 | 3300028380 | Unclassified | 1525 |
| 288 | Ga0268265_10420324 | 3300028380 | Bacteria | 1241 |
| 289 | Ga0268265_10668502 | 3300028380 | Bacteria | 1000 |
| 290 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 291 | Ga0268264_10005933 | 3300028381 | Bacteria | 10340 |
| 292 | Ga0268264_10111791 | 3300028381 | Bacteria | 2394 |
| 293 | Ga0268264_10468339 | 3300028381 | Unclassified | 1224 |
| 294 | Ga0307511_10000285 | 3300030521 | Bacteria | 53256 |
| 295 | Ga0265327_10048446 | 3300031251 | Bacteria | 2235 |
| 296 | Ga0307513_10285032 | 3300031456 | Bacteria | 1427 |
| 297 | Ga0307509_10015768 | 3300031507 | Bacteria | 8791 |
| 298 | Ga0307516_10000577 | 3300031730 | Bacteria | 49482 |
| 299 | Ga0307413_10007405 | 3300031824 | Bacteria | 5097 |
| 300 | Ga0307410_10010058 | 3300031852 | Bacteria | 5341 |
| 301 | Ga0307410_10259695 | 3300031852 | Unclassified | 1354 |
| 302 | Ga0307406_10058684 | 3300031901 | Bacteria | 2474 |
| 303 | Ga0307416_100069246 | 3300032002 | Bacteria | 2919 |
| 304 | Ga0307416_100503876 | 3300032002 | Bacteria | 1276 |
| 305 | Ga0307414_10414693 | 3300032004 | Bacteria | 1173 |
| 306 | Ga0307415_100156123 | 3300032126 | Bacteria | 1762 |
| 307 | Ga0307510_10000805 | 3300033180 | Bacteria | 32598 |
| 308 | Ga0373957_0102365 | 3300035120 | Bacteria | 1147 |
| 309 | Ga0373946_0200926 | 3300035171 | Unclassified | 955 |
| 310 | Ga0373933_0212812 | 3300035724 | Bacteria | 1239 |
| 311 | Ga0373947_0154227 | 3300035725 | Bacteria | 1481 |
| 312 | Ga0373937_0027905 | 3300036401 | Bacteria | 5107 |
| 313 | Ga0373925_0286067 | 3300037068 | Bacteria | 1329 |
| 314 | Ga0395900_0580259 | 3300037418 | Bacteria | 1063 |
| 315 | Ga0395898_0068889 | 3300037466 | Bacteria | 3424 |
| 316 | Ga0439461_0010508 | 3300041410 | Bacteria | 1701 |
| 317 | Ga0451807_2709964 | 3300041486 | Bacteria | 786 |
| 318 | Ga0451843_0344114 | 3300041509 | Bacteria | 2088 |
| 319 | Ga0439457_005952 | 3300042014 | Bacteria | 3015 |
| 320 | Ga0450897_007686 | 3300042128 | Bacteria | 988 |
| 321 | Ga0450894_004960 | 3300042131 | Bacteria | 1720 |
| 322 | Ga0450899_005125 | 3300042135 | Bacteria | 1407 |
| 323 | Ga0439434_0074662 | 3300042435 | Bacteria | 1070 |
| 324 | Ga0450893_0029653 | 3300042532 | Bacteria | 971 |
| 325 | Ga0466969_0000182 | 3300044656 | Bacteria | 33828 |
| 326 | Ga0466972_0003013 | 3300044658 | Bacteria | 8349 |
| 327 | Ga0466966_0014856 | 3300044684 | Bacteria | 5151 |
| 328 | Ga0453684_0117232 | 3300044712 | Bacteria | 3223 |
| 329 | Ga0466971_0088119 | 3300044719 | Bacteria | 1419 |
| 330 | Ga0466970_0180950 | 3300044765 | Bacteria | 1170 |
| 331 | Ga0466959_0000056 | 3300045049 | Bacteria | 78465 |
| 332 | Ga0466959_0001399 | 3300045049 | Bacteria | 14766 |
| 333 | Ga0495638_0189848 | 3300046460 | Unclassified | 1166 |
| 334 | Ga0495638_0221314 | 3300046460 | Bacteria | 1058 |
| 335 | Ga0495638_0279694 | 3300046460 | Bacteria | 907 |
| 336 | Ga0495580_0639584 | 3300046472 | Bacteria | 700 |
| 337 | Ga0495606_0050751 | 3300046507 | Bacteria | 2711 |
| 338 | Ga0495608_0125173 | 3300046511 | Bacteria | 1646 |
| 339 | Ga0495628_0241722 | 3300046516 | Unclassified | 1350 |
| 340 | Ga0495630_0014413 | 3300046517 | Bacteria | 5760 |
| 341 | Ga0495643_0019504 | 3300046522 | Bacteria | 3922 |
| 342 | Ga0495648_0001994 | 3300046524 | Bacteria | 19331 |
| 343 | Ga0495587_0271126 | 3300046536 | Bacteria | 952 |
| 344 | Ga0495667_0251073 | 3300046559 | Bacteria | 1126 |
| 345 | Ga0495624_0195153 | 3300046690 | Bacteria | 1231 |
| 346 | Ga0495600_0121764 | 3300046809 | Bacteria | 1697 |
| 347 | Ga0495672_0025644 | 3300047320 | Bacteria | 3768 |
| 348 | Ga0495672_0316397 | 3300047320 | Bacteria | 734 |
| 349 | Ga0495680_0228631 | 3300047322 | Bacteria | 1325 |
| 350 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 351 | Ga0495684_0283950 | 3300047471 | Bacteria | 1193 |
| 352 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 353 | Ga0495686_0012413 | 3300047472 | Bacteria | 5960 |
| 354 | Ga0496104_0563328 | 3300048907 | Unclassified | 1050 |
| 355 | Ga0496110_0039739 | 3300048913 | Bacteria | 4097 |
| 356 | Ga0496110_0337817 | 3300048913 | Unclassified | 1372 |
| 357 | Ga0496111_0711500 | 3300048914 | Unclassified | 730 |
| 358 | Ga0501298_089445 | 3300049521 | Unclassified | 688 |
| 359 | Ga0501299_000376 | 3300049522 | Bacteria | 5270 |
| 360 | Ga0501034_0004706 | 3300049571 | Bacteria | 15108 |
| 361 | Ga0501034_0332998 | 3300049571 | Bacteria | 1449 |
| 362 | Ga0501036_0064960 | 3300049572 | Bacteria | 3088 |
| 363 | Ga0501037_0028037 | 3300049573 | Bacteria | 4160 |
| 364 | Ga0501038_0092841 | 3300049574 | Bacteria | 2527 |
| 365 | Ga0501039_0146562 | 3300049575 | Bacteria | 1855 |
| 366 | Ga0501043_0039339 | 3300049579 | Bacteria | 3716 |
| 367 | Ga0501046_0046221 | 3300049580 | Bacteria | 3456 |
| 368 | Ga0501046_0137945 | 3300049580 | Bacteria | 1847 |
| 369 | Ga0501047_0056300 | 3300049581 | Bacteria | 3802 |
| 370 | Ga0501047_0268228 | 3300049581 | Bacteria | 1553 |
| 371 | Ga0501047_0358231 | 3300049581 | Bacteria | 1295 |
| 372 | Ga0501048_0084535 | 3300049582 | Bacteria | 2238 |
| 373 | Ga0501048_0142781 | 3300049582 | Bacteria | 1693 |
| 374 | Ga0501048_0284831 | 3300049582 | Bacteria | 1175 |
| 375 | Ga0501067_0016375 | 3300049583 | Unclassified | 4097 |
| 376 | Ga0501067_0029635 | 3300049583 | Bacteria | 3033 |
| 377 | Ga0501070_0165165 | 3300049586 | Unclassified | 1824 |
| 378 | Ga0501070_0285348 | 3300049586 | Bacteria | 1346 |
| 379 | Ga0501071_0628832 | 3300049587 | Unclassified | 826 |
| 380 | Ga0501073_0014462 | 3300049589 | Bacteria | 5733 |
| 381 | Ga0501074_0014645 | 3300049590 | Bacteria | 5704 |
| 382 | Ga0501198_000760 | 3300049649 | Unclassified | 4029 |
| 383 | Ga0501201_000177 | 3300049651 | Bacteria | 5604 |
| 384 | Ga0501202_000044 | 3300049652 | Bacteria | 12530 |
| 385 | Ga0501202_006758 | 3300049652 | Unclassified | 2060 |
| 386 | Ga0501207_023131 | 3300049654 | Bacteria | 1007 |
| 387 | Ga0501217_004903 | 3300049661 | Unclassified | 2773 |
| 388 | Ga0501217_063946 | 3300049661 | Bacteria | 989 |
| 389 | Ga0501217_080554 | 3300049661 | Bacteria | 900 |
| 390 | Ga0501222_027603 | 3300049662 | Bacteria | 773 |
| 391 | Ga0501223_033699 | 3300049663 | Bacteria | 996 |
| 392 | Ga0501223_033871 | 3300049663 | Bacteria | 993 |
| 393 | Ga0501227_035121 | 3300049665 | Bacteria | 1219 |
| 394 | Ga0501233_001446 | 3300049668 | Bacteria | 4050 |
| 395 | Ga0501233_048702 | 3300049668 | Unclassified | 1020 |
| 396 | Ga0501235_003225 | 3300049669 | Bacteria | 3518 |
| 397 | Ga0501235_006083 | 3300049669 | Bacteria | 2625 |
| 398 | Ga0501238_010095 | 3300049671 | Bacteria | 1258 |
| 399 | Ga0501242_003591 | 3300049674 | Bacteria | 1685 |
| 400 | Ga0501243_002282 | 3300049675 | Unclassified | 2797 |
| 401 | Ga0501259_018194 | 3300049688 | Bacteria | 1225 |
| 402 | Ga0501221_001236 | 3300049704 | Bacteria | 4228 |
| 403 | Ga0501225_0010110 | 3300049705 | Bacteria | 2677 |
| 404 | Ga0501225_0059096 | 3300049705 | Unclassified | 1077 |
| 405 | Ga0501234_000133 | 3300049707 | Bacteria | 9804 |
| 406 | Ga0501245_014839 | 3300049708 | Bacteria | 1166 |
| 407 | Ga0501079_0352890 | 3300049741 | Bacteria | 1152 |
| 408 | Ga0501080_0011972 | 3300049742 | Bacteria | 7945 |
| 409 | Ga0501080_0476076 | 3300049742 | Unclassified | 1117 |
| 410 | Ga0501083_0038260 | 3300049744 | Unclassified | 3262 |
| 411 | Ga0501083_0074161 | 3300049744 | Bacteria | 2261 |
| 412 | Ga0501083_0301822 | 3300049744 | Unclassified | 1041 |
| 413 | Ga0501083_0563157 | 3300049744 | Unclassified | 741 |
| 414 | Ga0501266_020789 | 3300049763 | Bacteria | 895 |
| 415 | Ga0501270_017022 | 3300049767 | Bacteria | 1059 |
| 416 | Ga0501274_006474 | 3300049771 | Bacteria | 1011 |
| 417 | Ga0501279_017103 | 3300049775 | Bacteria | 1014 |
| 418 | Ga0501280_007643 | 3300049776 | Unclassified | 1510 |
| 419 | Ga0501035_0074366 | 3300049822 | Bacteria | 3006 |
| 420 | Ga0501044_0048057 | 3300049823 | Bacteria | 4410 |
| 421 | Ga0501044_0079225 | 3300049823 | Bacteria | 3329 |
| 422 | nmdc:mga0k408_14082_c1 | 3300050493 | Bacteria | 4398 |
| 423 | nmdc:mga0k408_149588_c1 | 3300050493 | Bacteria | 1390 |
| 424 | nmdc:mga0k408_8840_c1 | 3300050493 | Bacteria | 5419 |
| 425 | nmdc:mga09592_469177_c1 | 3300050508 | Bacteria | 1085 |
| 426 | nmdc:mga08y16_13394_c1 | 3300050511 | Bacteria | 8626 |
| 427 | nmdc:mga0n895_220022_c1 | 3300050512 | Bacteria | 1928 |
| 428 | Ga0500646_0137361 | 3300053090 | Bacteria | 799 |
| 429 | Ga0500556_0252068 | 3300053104 | Bacteria | 695 |
| 430 | Ga0500642_0002202 | 3300053130 | Bacteria | 5668 |
| 431 | Ga0500568_0000306 | 3300053139 | Bacteria | 39150 |
| 432 | Ga0500573_0103955 | 3300053140 | Bacteria | 1596 |
| 433 | Ga0500588_0004060 | 3300053146 | Bacteria | 3141 |
| 434 | Ga0500588_0029642 | 3300053146 | Bacteria | 1562 |
| 435 | Ga0500622_0000900 | 3300053156 | Bacteria | 25309 |
| 436 | Ga0500611_000028 | 3300053727 | Bacteria | 93696 |
| 437 | Ga0501082_0087577 | 3300060353 | Bacteria | 2687 |
| 438 | Ga0466962_0037097 | 3300061719 | Bacteria | 2333 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_11228656 | Ga0207702_112286561 | 173 |
| 2 | 3300005843 | Ga0068860_100000046 | Ga0068860_100000046107 | 177 |
| 3 | 3300005844 | Ga0068862_100532918 | Ga0068862_1005329182 | 177 |
| 4 | 3300009553 | Ga0105249_10230809 | Ga0105249_102308092 | 177 |
| 5 | 3300013306 | Ga0163162_10001998 | Ga0163162_100019984 | 177 |
| 6 | 3300025961 | Ga0207712_10274486 | Ga0207712_102744861 | 177 |
| 7 | 3300028380 | Ga0268265_10668502 | Ga0268265_106685021 | 177 |
| 8 | 3300028381 | Ga0268264_10000041 | Ga0268264_10000041220 | 177 |
| 9 | 3300031730 | Ga0307516_10000577 | Ga0307516_1000057726 | 177 |
| 10 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_269156_269713 | 177 |
| 11 | 3300037418 | Ga0395900_0580259 | Ga0395900_0580259_256_795 | 179 |
| 12 | 3300005329 | Ga0070683_100071654 | Ga0070683_1000716543 | 181 |
| 13 | 3300005334 | Ga0068869_100137379 | Ga0068869_1001373791 | 181 |
| 14 | 3300005338 | Ga0068868_100242595 | Ga0068868_1002425951 | 181 |
| 15 | 3300005340 | Ga0070689_100008364 | Ga0070689_1000083643 | 181 |
| 16 | 3300005344 | Ga0070661_100041644 | Ga0070661_1000416444 | 181 |
| 17 | 3300005354 | Ga0070675_100093750 | Ga0070675_1000937502 | 181 |
| 18 | 3300005364 | Ga0070673_100384693 | Ga0070673_1003846931 | 181 |
| 19 | 3300005365 | Ga0070688_100044335 | Ga0070688_1000443352 | 181 |
| 20 | 3300005455 | Ga0070663_100145029 | Ga0070663_1001450292 | 181 |
| 21 | 3300005466 | Ga0070685_10097419 | Ga0070685_100974191 | 181 |
| 22 | 3300005535 | Ga0070684_100029812 | Ga0070684_1000298127 | 181 |
| 23 | 3300005543 | Ga0070672_100270153 | Ga0070672_1002701531 | 181 |
| 24 | 3300005564 | Ga0070664_100101558 | Ga0070664_1001015583 | 181 |
| 25 | 3300005577 | Ga0068857_100232392 | Ga0068857_1002323921 | 181 |
| 26 | 3300005617 | Ga0068859_100177777 | Ga0068859_1001777771 | 181 |
| 27 | 3300005618 | Ga0068864_100012297 | Ga0068864_1000122974 | 181 |
| 28 | 3300005841 | Ga0068863_100658704 | Ga0068863_1006587041 | 181 |
| 29 | 3300006931 | Ga0097620_100177782 | Ga0097620_1001777821 | 181 |
| 30 | 3300009553 | Ga0105249_10860095 | Ga0105249_108600951 | 181 |
| 31 | 3300011119 | Ga0105246_10354742 | Ga0105246_103547422 | 181 |
| 32 | 3300013296 | Ga0157374_10031789 | Ga0157374_100317894 | 181 |
| 33 | 3300013308 | Ga0157375_10075816 | Ga0157375_100758163 | 181 |
| 34 | 3300014325 | Ga0163163_10010371 | Ga0163163_100103718 | 181 |
| 35 | 3300014968 | Ga0157379_10147844 | Ga0157379_101478442 | 181 |
| 36 | 3300025315 | Ga0207697_10070868 | Ga0207697_100708683 | 181 |
| 37 | 3300025936 | Ga0207670_10024788 | Ga0207670_100247884 | 181 |
| 38 | 3300025940 | Ga0207691_10342742 | Ga0207691_103427421 | 181 |
| 39 | 3300025944 | Ga0207661_10107897 | Ga0207661_101078971 | 181 |
| 40 | 3300026023 | Ga0207677_10211260 | Ga0207677_102112602 | 181 |
| 41 | 3300026041 | Ga0207639_10942541 | Ga0207639_109425412 | 181 |
| 42 | 3300026067 | Ga0207678_10037820 | Ga0207678_100378203 | 181 |
| 43 | 3300026095 | Ga0207676_10025336 | Ga0207676_100253365 | 181 |
| 44 | 3300026116 | Ga0207674_10107588 | Ga0207674_101075881 | 181 |
| 45 | 3300028381 | Ga0268264_10468339 | Ga0268264_104683392 | 181 |
| 46 | 3300042014 | Ga0439457_005952 | Ga0439457_005952_2149_2694 | 181 |
| 47 | 3300042128 | Ga0450897_007686 | Ga0450897_007686_29_574 | 181 |
| 48 | 3300048913 | Ga0496110_0337817 | Ga0496110_0337817_685_1260 | 181 |
| 49 | 3300003322 | rootL2_10088173 | rootL2_100881732 | 185 |
| 50 | 3300005335 | Ga0070666_10020827 | Ga0070666_100208273 | 185 |
| 51 | 3300005335 | Ga0070666_10740094 | Ga0070666_107400941 | 185 |
| 52 | 3300005341 | Ga0070691_10017336 | Ga0070691_100173361 | 185 |
| 53 | 3300005539 | Ga0068853_100001585 | Ga0068853_1000015854 | 185 |
| 54 | 3300005563 | Ga0068855_100171423 | Ga0068855_1001714233 | 185 |
| 55 | 3300005983 | Ga0081540_1014264 | Ga0081540_10142645 | 185 |
| 56 | 3300009093 | Ga0105240_10175593 | Ga0105240_101755933 | 185 |
| 57 | 3300009545 | Ga0105237_10000563 | Ga0105237_1000056339 | 185 |
| 58 | 3300009545 | Ga0105237_10020194 | Ga0105237_100201941 | 185 |
| 59 | 3300009545 | Ga0105237_10034848 | Ga0105237_100348484 | 185 |
| 60 | 3300010375 | Ga0105239_10003203 | Ga0105239_1000320315 | 185 |
| 61 | 3300010375 | Ga0105239_10078746 | Ga0105239_100787464 | 185 |
| 62 | 3300013307 | Ga0157372_11355704 | Ga0157372_113557041 | 185 |
| 63 | 3300013308 | Ga0157375_10414316 | Ga0157375_104143162 | 185 |
| 64 | 3300014968 | Ga0157379_10526962 | Ga0157379_105269622 | 185 |
| 65 | 3300025903 | Ga0207680_10025175 | Ga0207680_100251753 | 185 |
| 66 | 3300025903 | Ga0207680_10648731 | Ga0207680_106487311 | 185 |
| 67 | 3300025904 | Ga0207647_10081764 | Ga0207647_100817642 | 185 |
| 68 | 3300025913 | Ga0207695_10000023 | Ga0207695_1000002336 | 185 |
| 69 | 3300025913 | Ga0207695_10000229 | Ga0207695_10000229105 | 185 |
| 70 | 3300025913 | Ga0207695_10002425 | Ga0207695_1000242513 | 185 |
| 71 | 3300025913 | Ga0207695_10016531 | Ga0207695_100165319 | 185 |
| 72 | 3300025913 | Ga0207695_10834910 | Ga0207695_108349102 | 185 |
| 73 | 3300025914 | Ga0207671_10003761 | Ga0207671_100037618 | 185 |
| 74 | 3300025914 | Ga0207671_10004878 | Ga0207671_100048783 | 185 |
| 75 | 3300025914 | Ga0207671_10048967 | Ga0207671_100489672 | 185 |
| 76 | 3300025924 | Ga0207694_10091143 | Ga0207694_100911433 | 185 |
| 77 | 3300025949 | Ga0207667_10123299 | Ga0207667_101232993 | 185 |
| 78 | 3300026041 | Ga0207639_10051489 | Ga0207639_100514894 | 185 |
| 79 | 3300026041 | Ga0207639_10560170 | Ga0207639_105601702 | 185 |
| 80 | 3300028381 | Ga0268264_10005933 | Ga0268264_1000593310 | 185 |
| 81 | 3300030521 | Ga0307511_10000285 | Ga0307511_1000028531 | 185 |
| 82 | 3300044719 | Ga0466971_0088119 | Ga0466971_0088119_461_1018 | 185 |
| 83 | 3300045049 | Ga0466959_0001399 | Ga0466959_0001399_2186_2743 | 185 |
| 84 | 3300046460 | Ga0495638_0189848 | Ga0495638_0189848_466_1023 | 185 |
| 85 | 3300046524 | Ga0495648_0001994 | Ga0495648_0001994_11416_11973 | 185 |
| 86 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_483514_484116 | 185 |
| 87 | 3300053130 | Ga0500642_0002202 | Ga0500642_0002202_2612_3169 | 185 |
| 88 | 3300053140 | Ga0500573_0103955 | Ga0500573_0103955_730_1320 | 185 |
| 89 | 3300053146 | Ga0500588_0004060 | Ga0500588_0004060_1260_1817 | 185 |
| 90 | 3300053156 | Ga0500622_0000900 | Ga0500622_0000900_24163_24720 | 185 |
| 91 | 3300061719 | Ga0466962_0037097 | Ga0466962_0037097_1154_1711 | 185 |
| 92 | 3300003320 | rootH2_10003541 | rootH2_1000354112 | 186 |
| 93 | 3300013307 | Ga0157372_10086188 | Ga0157372_100861881 | 186 |
| 94 | 3300014969 | Ga0157376_10002300 | Ga0157376_1000230016 | 186 |
| 95 | iso_pu_bacteria | 2911138879 | 2911140291 | 186 |
| 96 | 3300005347 | Ga0070668_100340221 | Ga0070668_1003402212 | 187 |
| 97 | 3300005353 | Ga0070669_100077070 | Ga0070669_1000770704 | 187 |
| 98 | 3300005364 | Ga0070673_101599306 | Ga0070673_1015993061 | 187 |
| 99 | 3300005365 | Ga0070688_100041313 | Ga0070688_1000413135 | 187 |
| 100 | 3300005458 | Ga0070681_10014654 | Ga0070681_100146547 | 187 |
| 101 | 3300005466 | Ga0070685_10552679 | Ga0070685_105526791 | 187 |
| 102 | 3300005543 | Ga0070672_100281764 | Ga0070672_1002817643 | 187 |
| 103 | 3300014325 | Ga0163163_11376813 | Ga0163163_113768132 | 187 |
| 104 | 3300014326 | Ga0157380_10002439 | Ga0157380_100024399 | 187 |
| 105 | 3300025908 | Ga0207643_10242930 | Ga0207643_102429301 | 187 |
| 106 | 3300025912 | Ga0207707_10139010 | Ga0207707_101390103 | 187 |
| 107 | 3300025925 | Ga0207650_10038885 | Ga0207650_100388854 | 187 |
| 108 | 3300025926 | Ga0207659_10759149 | Ga0207659_107591491 | 187 |
| 109 | 3300025940 | Ga0207691_10499992 | Ga0207691_104999922 | 187 |
| 110 | 3300032002 | Ga0307416_100503876 | Ga0307416_1005038762 | 187 |
| 111 | 3300032004 | Ga0307414_10414693 | Ga0307414_104146932 | 187 |
| 112 | 3300033180 | Ga0307510_10000805 | Ga0307510_1000080512 | 187 |
| 113 | 3300046507 | Ga0495606_0050751 | Ga0495606_0050751_876_1484 | 187 |
| 114 | 3300049522 | Ga0501299_000376 | Ga0501299_000376_105_668 | 187 |
| 115 | 3300049571 | Ga0501034_0332998 | Ga0501034_0332998_832_1395 | 187 |
| 116 | 3300049580 | Ga0501046_0137945 | Ga0501046_0137945_89_652 | 187 |
| 117 | 3300049581 | Ga0501047_0358231 | Ga0501047_0358231_603_1166 | 187 |
| 118 | 3300049582 | Ga0501048_0142781 | Ga0501048_0142781_255_818 | 187 |
| 119 | 3300049583 | Ga0501067_0016375 | Ga0501067_0016375_1209_1772 | 187 |
| 120 | 3300049586 | Ga0501070_0165165 | Ga0501070_0165165_27_590 | 187 |
| 121 | 3300049587 | Ga0501071_0628832 | Ga0501071_0628832_130_693 | 187 |
| 122 | 3300049649 | Ga0501198_000760 | Ga0501198_000760_133_696 | 187 |
| 123 | 3300049651 | Ga0501201_000177 | Ga0501201_000177_104_667 | 187 |
| 124 | 3300049652 | Ga0501202_000044 | Ga0501202_000044_3189_3752 | 187 |
| 125 | 3300049654 | Ga0501207_023131 | Ga0501207_023131_105_668 | 187 |
| 126 | 3300049661 | Ga0501217_063946 | Ga0501217_063946_276_839 | 187 |
| 127 | 3300049661 | Ga0501217_080554 | Ga0501217_080554_123_686 | 187 |
| 128 | 3300049662 | Ga0501222_027603 | Ga0501222_027603_103_666 | 187 |
| 129 | 3300049663 | Ga0501223_033699 | Ga0501223_033699_347_910 | 187 |
| 130 | 3300049665 | Ga0501227_035121 | Ga0501227_035121_334_897 | 187 |
| 131 | 3300049668 | Ga0501233_001446 | Ga0501233_001446_340_903 | 187 |
| 132 | 3300049669 | Ga0501235_003225 | Ga0501235_003225_1114_1677 | 187 |
| 133 | 3300049674 | Ga0501242_003591 | Ga0501242_003591_830_1393 | 187 |
| 134 | 3300049675 | Ga0501243_002282 | Ga0501243_002282_342_905 | 187 |
| 135 | 3300049688 | Ga0501259_018194 | Ga0501259_018194_328_891 | 187 |
| 136 | 3300049704 | Ga0501221_001236 | Ga0501221_001236_1573_2136 | 187 |
| 137 | 3300049705 | Ga0501225_0010110 | Ga0501225_0010110_1882_2445 | 187 |
| 138 | 3300049707 | Ga0501234_000133 | Ga0501234_000133_2713_3276 | 187 |
| 139 | 3300049708 | Ga0501245_014839 | Ga0501245_014839_82_645 | 187 |
| 140 | 3300049742 | Ga0501080_0476076 | Ga0501080_0476076_24_587 | 187 |
| 141 | 3300049744 | Ga0501083_0301822 | Ga0501083_0301822_27_590 | 187 |
| 142 | 3300049744 | Ga0501083_0563157 | Ga0501083_0563157_152_715 | 187 |
| 143 | 3300049763 | Ga0501266_020789 | Ga0501266_020789_158_721 | 187 |
| 144 | 3300049775 | Ga0501279_017103 | Ga0501279_017103_176_739 | 187 |
| 145 | 3300049776 | Ga0501280_007643 | Ga0501280_007643_776_1339 | 187 |
| 146 | 3300049823 | Ga0501044_0079225 | Ga0501044_0079225_1813_2376 | 187 |
| 147 | 3300053090 | Ga0500646_0137361 | Ga0500646_0137361_194_757 | 187 |
| 148 | 3300005295 | Ga0065707_10026270 | Ga0065707_100262702 | 188 |
| 149 | 3300005330 | Ga0070690_100049469 | Ga0070690_1000494693 | 188 |
| 150 | 3300005441 | Ga0070700_100098974 | Ga0070700_1000989743 | 188 |
| 151 | 3300009093 | Ga0105240_10288473 | Ga0105240_102884731 | 188 |
| 152 | 3300009545 | Ga0105237_10031794 | Ga0105237_100317943 | 188 |
| 153 | 3300009551 | Ga0105238_10390705 | Ga0105238_103907051 | 188 |
| 154 | 3300010375 | Ga0105239_10000048 | Ga0105239_10000048157 | 188 |
| 155 | 3300013306 | Ga0163162_10017671 | Ga0163162_100176717 | 188 |
| 156 | 3300013307 | Ga0157372_10002035 | Ga0157372_100020354 | 188 |
| 157 | 3300025321 | Ga0207656_10274294 | Ga0207656_102742941 | 188 |
| 158 | 3300025904 | Ga0207647_10090040 | Ga0207647_100900402 | 188 |
| 159 | 3300026075 | Ga0207708_10085873 | Ga0207708_100858733 | 188 |
| 160 | 3300031251 | Ga0265327_10048446 | Ga0265327_100484463 | 188 |
| 161 | 3300031824 | Ga0307413_10007405 | Ga0307413_1000740510 | 188 |
| 162 | 3300031852 | Ga0307410_10010058 | Ga0307410_100100586 | 188 |
| 163 | 3300031852 | Ga0307410_10259695 | Ga0307410_102596952 | 188 |
| 164 | 3300031901 | Ga0307406_10058684 | Ga0307406_100586845 | 188 |
| 165 | 3300032002 | Ga0307416_100069246 | Ga0307416_1000692465 | 188 |
| 166 | 3300032126 | Ga0307415_100156123 | Ga0307415_1001561234 | 188 |
| 167 | 3300037466 | Ga0395898_0068889 | Ga0395898_0068889_894_1481 | 188 |
| 168 | 3300049521 | Ga0501298_089445 | Ga0501298_089445_19_585 | 188 |
| 169 | 3300049652 | Ga0501202_006758 | Ga0501202_006758_19_585 | 188 |
| 170 | 3300049661 | Ga0501217_004903 | Ga0501217_004903_636_1202 | 188 |
| 171 | 3300049663 | Ga0501223_033871 | Ga0501223_033871_270_836 | 188 |
| 172 | 3300049668 | Ga0501233_048702 | Ga0501233_048702_59_625 | 188 |
| 173 | 3300049669 | Ga0501235_006083 | Ga0501235_006083_1794_2360 | 188 |
| 174 | 3300049671 | Ga0501238_010095 | Ga0501238_010095_50_616 | 188 |
| 175 | 3300049705 | Ga0501225_0059096 | Ga0501225_0059096_415_981 | 188 |
| 176 | 3300049767 | Ga0501270_017022 | Ga0501270_017022_245_811 | 188 |
| 177 | 3300049771 | Ga0501274_006474 | Ga0501274_006474_20_586 | 188 |
| 178 | 3300050508 | nmdc:mga09592_469177_c1 | nmdc:mga09592_469177_c1_481_1047 | 188 |
| 179 | 3300002459 | JGI24751J29686_10003924 | JGI24751J29686_100039244 | 189 |
| 180 | 3300002459 | JGI24751J29686_10005979 | JGI24751J29686_100059793 | 189 |
| 181 | 3300003322 | rootL2_10081164 | rootL2_100811641 | 189 |
| 182 | 3300005334 | Ga0068869_100157718 | Ga0068869_1001577182 | 189 |
| 183 | 3300005356 | Ga0070674_100568176 | Ga0070674_1005681762 | 189 |
| 184 | 3300005367 | Ga0070667_100794776 | Ga0070667_1007947761 | 189 |
| 185 | 3300005456 | Ga0070678_100066003 | Ga0070678_1000660032 | 189 |
| 186 | 3300005459 | Ga0068867_100055427 | Ga0068867_1000554272 | 189 |
| 187 | 3300005530 | Ga0070679_101047930 | Ga0070679_1010479301 | 189 |
| 188 | 3300005563 | Ga0068855_100637998 | Ga0068855_1006379982 | 189 |
| 189 | 3300005563 | Ga0068855_100787107 | Ga0068855_1007871072 | 189 |
| 190 | 3300005618 | Ga0068864_100027484 | Ga0068864_1000274843 | 189 |
| 191 | 3300005718 | Ga0068866_10122371 | Ga0068866_101223712 | 189 |
| 192 | 3300005843 | Ga0068860_100883173 | Ga0068860_1008831731 | 189 |
| 193 | 3300006195 | Ga0075366_10009711 | Ga0075366_100097114 | 189 |
| 194 | 3300006195 | Ga0075366_10147356 | Ga0075366_101473562 | 189 |
| 195 | 3300006195 | Ga0075366_10178241 | Ga0075366_101782411 | 189 |
| 196 | 3300006881 | Ga0068865_100299936 | Ga0068865_1002999362 | 189 |
| 197 | 3300009176 | Ga0105242_10042160 | Ga0105242_100421603 | 189 |
| 198 | 3300009553 | Ga0105249_10002924 | Ga0105249_1000292410 | 189 |
| 199 | 3300010375 | Ga0105239_12305392 | Ga0105239_123053921 | 189 |
| 200 | 3300013104 | Ga0157370_10598502 | Ga0157370_105985022 | 189 |
| 201 | 3300013296 | Ga0157374_10127736 | Ga0157374_101277363 | 189 |
| 202 | 3300013307 | Ga0157372_10048249 | Ga0157372_100482493 | 189 |
| 203 | 3300013308 | Ga0157375_10518735 | Ga0157375_105187352 | 189 |
| 204 | 3300014325 | Ga0163163_10694297 | Ga0163163_106942972 | 189 |
| 205 | 3300014326 | Ga0157380_10755370 | Ga0157380_107553702 | 189 |
| 206 | 3300014969 | Ga0157376_10295722 | Ga0157376_102957222 | 189 |
| 207 | 3300014969 | Ga0157376_11274525 | Ga0157376_112745252 | 189 |
| 208 | 3300025907 | Ga0207645_10007158 | Ga0207645_100071583 | 189 |
| 209 | 3300025909 | Ga0207705_10361394 | Ga0207705_103613942 | 189 |
| 210 | 3300025925 | Ga0207650_10352611 | Ga0207650_103526111 | 189 |
| 211 | 3300025925 | Ga0207650_10489201 | Ga0207650_104892012 | 189 |
| 212 | 3300025935 | Ga0207709_10318949 | Ga0207709_103189492 | 189 |
| 213 | 3300025940 | Ga0207691_10154582 | Ga0207691_101545822 | 189 |
| 214 | 3300025940 | Ga0207691_10351653 | Ga0207691_103516532 | 189 |
| 215 | 3300025960 | Ga0207651_10225882 | Ga0207651_102258822 | 189 |
| 216 | 3300025961 | Ga0207712_10030807 | Ga0207712_100308073 | 189 |
| 217 | 3300025986 | Ga0207658_10759948 | Ga0207658_107599482 | 189 |
| 218 | 3300026089 | Ga0207648_10006809 | Ga0207648_100068098 | 189 |
| 219 | 3300026095 | Ga0207676_10022185 | Ga0207676_100221854 | 189 |
| 220 | 3300026118 | Ga0207675_100137443 | Ga0207675_1001374433 | 189 |
| 221 | 3300026118 | Ga0207675_100174518 | Ga0207675_1001745181 | 189 |
| 222 | 3300026121 | Ga0207683_10092086 | Ga0207683_100920864 | 189 |
| 223 | 3300028380 | Ga0268265_10420324 | Ga0268265_104203243 | 189 |
| 224 | 3300028381 | Ga0268264_10111791 | Ga0268264_101117911 | 189 |
| 225 | 3300031507 | Ga0307509_10015768 | Ga0307509_1001576810 | 189 |
| 226 | 3300041486 | Ga0451807_2709964 | Ga0451807_2709964_99_668 | 189 |
| 227 | 3300044656 | Ga0466969_0000182 | Ga0466969_0000182_32703_33323 | 189 |
| 228 | 3300044658 | Ga0466972_0003013 | Ga0466972_0003013_5173_5745 | 189 |
| 229 | 3300044684 | Ga0466966_0014856 | Ga0466966_0014856_207_827 | 189 |
| 230 | 3300044765 | Ga0466970_0180950 | Ga0466970_0180950_66_686 | 189 |
| 231 | 3300045049 | Ga0466959_0000056 | Ga0466959_0000056_30511_31131 | 189 |
| 232 | 3300046460 | Ga0495638_0279694 | Ga0495638_0279694_144_713 | 189 |
| 233 | 3300047320 | Ga0495672_0316397 | Ga0495672_0316397_142_711 | 189 |
| 234 | 3300049571 | Ga0501034_0004706 | Ga0501034_0004706_1046_1615 | 189 |
| 235 | 3300049572 | Ga0501036_0064960 | Ga0501036_0064960_922_1491 | 189 |
| 236 | 3300049573 | Ga0501037_0028037 | Ga0501037_0028037_1221_1790 | 189 |
| 237 | 3300049574 | Ga0501038_0092841 | Ga0501038_0092841_794_1363 | 189 |
| 238 | 3300049575 | Ga0501039_0146562 | Ga0501039_0146562_199_768 | 189 |
| 239 | 3300049579 | Ga0501043_0039339 | Ga0501043_0039339_940_1509 | 189 |
| 240 | 3300049580 | Ga0501046_0046221 | Ga0501046_0046221_454_1023 | 189 |
| 241 | 3300049581 | Ga0501047_0056300 | Ga0501047_0056300_2378_2950 | 189 |
| 242 | 3300049581 | Ga0501047_0268228 | Ga0501047_0268228_789_1358 | 189 |
| 243 | 3300049582 | Ga0501048_0084535 | Ga0501048_0084535_822_1391 | 189 |
| 244 | 3300049582 | Ga0501048_0284831 | Ga0501048_0284831_503_1075 | 189 |
| 245 | 3300049583 | Ga0501067_0029635 | Ga0501067_0029635_713_1282 | 189 |
| 246 | 3300049586 | Ga0501070_0285348 | Ga0501070_0285348_679_1248 | 189 |
| 247 | 3300049589 | Ga0501073_0014462 | Ga0501073_0014462_270_839 | 189 |
| 248 | 3300049590 | Ga0501074_0014645 | Ga0501074_0014645_757_1326 | 189 |
| 249 | 3300049741 | Ga0501079_0352890 | Ga0501079_0352890_12_581 | 189 |
| 250 | 3300049742 | Ga0501080_0011972 | Ga0501080_0011972_194_763 | 189 |
| 251 | 3300049744 | Ga0501083_0038260 | Ga0501083_0038260_2325_2894 | 189 |
| 252 | 3300049822 | Ga0501035_0074366 | Ga0501035_0074366_1001_1570 | 189 |
| 253 | 3300049823 | Ga0501044_0048057 | Ga0501044_0048057_1728_2297 | 189 |
| 254 | 3300050493 | nmdc:mga0k408_149588_c1 | nmdc:mga0k408_149588_c1_570_1139 | 189 |
| 255 | 3300050493 | nmdc:mga0k408_8840_c1 | nmdc:mga0k408_8840_c1_2772_3341 | 189 |
| 256 | 3300053104 | Ga0500556_0252068 | Ga0500556_0252068_88_660 | 189 |
| 257 | 3300053139 | Ga0500568_0000306 | Ga0500568_0000306_34973_35542 | 189 |
| 258 | 3300053146 | Ga0500588_0029642 | Ga0500588_0029642_888_1466 | 189 |
| 259 | 3300053727 | Ga0500611_000028 | Ga0500611_000028_22854_23423 | 189 |
| 260 | 3300060353 | Ga0501082_0087577 | Ga0501082_0087577_844_1413 | 189 |
| 261 | 3300005331 | Ga0070670_100080392 | Ga0070670_1000803922 | 190 |
| 262 | 3300005338 | Ga0068868_100001540 | Ga0068868_1000015405 | 190 |
| 263 | 3300005341 | Ga0070691_10147830 | Ga0070691_101478302 | 190 |
| 264 | 3300005834 | Ga0068851_10110625 | Ga0068851_101106252 | 190 |
| 265 | 3300005841 | Ga0068863_100002125 | Ga0068863_10000212520 | 190 |
| 266 | 3300006195 | Ga0075366_10003238 | Ga0075366_100032384 | 190 |
| 267 | 3300006358 | Ga0068871_100727544 | Ga0068871_1007275442 | 190 |
| 268 | 3300013296 | Ga0157374_10064428 | Ga0157374_100644283 | 190 |
| 269 | 3300013297 | Ga0157378_10002969 | Ga0157378_1000296911 | 190 |
| 270 | 3300013308 | Ga0157375_10417578 | Ga0157375_104175782 | 190 |
| 271 | 3300014325 | Ga0163163_10172079 | Ga0163163_101720792 | 190 |
| 272 | 3300025321 | Ga0207656_10110528 | Ga0207656_101105282 | 190 |
| 273 | 3300025925 | Ga0207650_10003002 | Ga0207650_100030026 | 190 |
| 274 | 3300025931 | Ga0207644_10072811 | Ga0207644_100728111 | 190 |
| 275 | 3300026023 | Ga0207677_10010001 | Ga0207677_100100013 | 190 |
| 276 | 3300026088 | Ga0207641_10109066 | Ga0207641_101090663 | 190 |
| 277 | 3300026095 | Ga0207676_10226578 | Ga0207676_102265782 | 190 |
| 278 | 3300046460 | Ga0495638_0221314 | Ga0495638_0221314_176_748 | 190 |
| 279 | 3300047320 | Ga0495672_0025644 | Ga0495672_0025644_2239_2814 | 190 |
| 280 | 3300047472 | Ga0495686_0012413 | Ga0495686_0012413_4059_4631 | 190 |
| 281 | 3300049744 | Ga0501083_0074161 | Ga0501083_0074161_689_1261 | 190 |
| 282 | 3300050493 | nmdc:mga0k408_14082_c1 | nmdc:mga0k408_14082_c1_1383_1955 | 190 |
| 283 | 3300000043 | ARcpr5yngRDRAFT_c004433 | ARcpr5yngRDRAFT_0044331 | 191 |
| 284 | 3300000044 | ARSoilOldRDRAFT_c004955 | ARSoilOldRDRAFT_0049552 | 191 |
| 285 | 3300002076 | JGI24749J21850_1017256 | JGI24749J21850_10172562 | 191 |
| 286 | 3300005290 | Ga0065712_10073069 | Ga0065712_100730692 | 191 |
| 287 | 3300005293 | Ga0065715_10439045 | Ga0065715_104390452 | 191 |
| 288 | 3300005295 | Ga0065707_10003327 | Ga0065707_100033273 | 191 |
| 289 | 3300005328 | Ga0070676_10730802 | Ga0070676_107308021 | 191 |
| 290 | 3300005329 | Ga0070683_100145962 | Ga0070683_1001459622 | 191 |
| 291 | 3300005330 | Ga0070690_100034387 | Ga0070690_1000343873 | 191 |
| 292 | 3300005331 | Ga0070670_100036587 | Ga0070670_1000365872 | 191 |
| 293 | 3300005338 | Ga0068868_100004208 | Ga0068868_1000042081 | 191 |
| 294 | 3300005340 | Ga0070689_100001483 | Ga0070689_10000148313 | 191 |
| 295 | 3300005340 | Ga0070689_100046302 | Ga0070689_1000463021 | 191 |
| 296 | 3300005340 | Ga0070689_100227318 | Ga0070689_1002273182 | 191 |
| 297 | 3300005343 | Ga0070687_100102612 | Ga0070687_1001026123 | 191 |
| 298 | 3300005347 | Ga0070668_100033045 | Ga0070668_1000330453 | 191 |
| 299 | 3300005353 | Ga0070669_100000458 | Ga0070669_10000045825 | 191 |
| 300 | 3300005354 | Ga0070675_100273568 | Ga0070675_1002735682 | 191 |
| 301 | 3300005356 | Ga0070674_100454139 | Ga0070674_1004541392 | 191 |
| 302 | 3300005364 | Ga0070673_100005119 | Ga0070673_1000051196 | 191 |
| 303 | 3300005364 | Ga0070673_100876478 | Ga0070673_1008764781 | 191 |
| 304 | 3300005365 | Ga0070688_100000687 | Ga0070688_10000068715 | 191 |
| 305 | 3300005365 | Ga0070688_100274520 | Ga0070688_1002745201 | 191 |
| 306 | 3300005366 | Ga0070659_100030490 | Ga0070659_1000304903 | 191 |
| 307 | 3300005366 | Ga0070659_100292286 | Ga0070659_1002922862 | 191 |
| 308 | 3300005441 | Ga0070700_100079291 | Ga0070700_1000792913 | 191 |
| 309 | 3300005457 | Ga0070662_100014264 | Ga0070662_1000142642 | 191 |
| 310 | 3300005457 | Ga0070662_100075038 | Ga0070662_1000750383 | 191 |
| 311 | 3300005457 | Ga0070662_100147241 | Ga0070662_1001472412 | 191 |
| 312 | 3300005459 | Ga0068867_100111565 | Ga0068867_1001115652 | 191 |
| 313 | 3300005459 | Ga0068867_100233444 | Ga0068867_1002334442 | 191 |
| 314 | 3300005466 | Ga0070685_10023259 | Ga0070685_100232593 | 191 |
| 315 | 3300005471 | Ga0070698_100685702 | Ga0070698_1006857021 | 191 |
| 316 | 3300005535 | Ga0070684_100007763 | Ga0070684_1000077639 | 191 |
| 317 | 3300005539 | Ga0068853_100005622 | Ga0068853_1000056225 | 191 |
| 318 | 3300005543 | Ga0070672_100025613 | Ga0070672_1000256133 | 191 |
| 319 | 3300005544 | Ga0070686_100129478 | Ga0070686_1001294783 | 191 |
| 320 | 3300005549 | Ga0070704_100538748 | Ga0070704_1005387482 | 191 |
| 321 | 3300005564 | Ga0070664_100009504 | Ga0070664_1000095045 | 191 |
| 322 | 3300005564 | Ga0070664_100661729 | Ga0070664_1006617291 | 191 |
| 323 | 3300005577 | Ga0068857_100030730 | Ga0068857_1000307303 | 191 |
| 324 | 3300005578 | Ga0068854_100034866 | Ga0068854_1000348664 | 191 |
| 325 | 3300005578 | Ga0068854_100048652 | Ga0068854_1000486522 | 191 |
| 326 | 3300005614 | Ga0068856_100257542 | Ga0068856_1002575422 | 191 |
| 327 | 3300005617 | Ga0068859_100041535 | Ga0068859_1000415353 | 191 |
| 328 | 3300005617 | Ga0068859_100092592 | Ga0068859_1000925923 | 191 |
| 329 | 3300005617 | Ga0068859_100368563 | Ga0068859_1003685633 | 191 |
| 330 | 3300005618 | Ga0068864_100051263 | Ga0068864_1000512632 | 191 |
| 331 | 3300005618 | Ga0068864_100410571 | Ga0068864_1004105712 | 191 |
| 332 | 3300005719 | Ga0068861_100000225 | Ga0068861_1000002253 | 191 |
| 333 | 3300005719 | Ga0068861_100658708 | Ga0068861_1006587082 | 191 |
| 334 | 3300005840 | Ga0068870_10019966 | Ga0068870_100199664 | 191 |
| 335 | 3300005842 | Ga0068858_100034683 | Ga0068858_1000346833 | 191 |
| 336 | 3300005844 | Ga0068862_100016616 | Ga0068862_1000166163 | 191 |
| 337 | 3300005844 | Ga0068862_101541209 | Ga0068862_1015412091 | 191 |
| 338 | 3300006237 | Ga0097621_100131313 | Ga0097621_1001313132 | 191 |
| 339 | 3300006358 | Ga0068871_100658295 | Ga0068871_1006582952 | 191 |
| 340 | 3300006881 | Ga0068865_100619428 | Ga0068865_1006194282 | 191 |
| 341 | 3300006931 | Ga0097620_100041533 | Ga0097620_1000415333 | 191 |
| 342 | 3300006931 | Ga0097620_100092588 | Ga0097620_1000925883 | 191 |
| 343 | 3300006931 | Ga0097620_100368532 | Ga0097620_1003685323 | 191 |
| 344 | 3300009094 | Ga0111539_10006834 | Ga0111539_100068346 | 191 |
| 345 | 3300009101 | Ga0105247_10398246 | Ga0105247_103982462 | 191 |
| 346 | 3300009176 | Ga0105242_10797314 | Ga0105242_107973142 | 191 |
| 347 | 3300009553 | Ga0105249_10020253 | Ga0105249_100202536 | 191 |
| 348 | 3300009553 | Ga0105249_10207200 | Ga0105249_102072003 | 191 |
| 349 | 3300010375 | Ga0105239_11361628 | Ga0105239_113616281 | 191 |
| 350 | 3300013100 | Ga0157373_10136021 | Ga0157373_101360212 | 191 |
| 351 | 3300013104 | Ga0157370_10077001 | Ga0157370_100770012 | 191 |
| 352 | 3300013296 | Ga0157374_10072106 | Ga0157374_100721063 | 191 |
| 353 | 3300013296 | Ga0157374_10082273 | Ga0157374_100822734 | 191 |
| 354 | 3300013306 | Ga0163162_10002326 | Ga0163162_1000232620 | 191 |
| 355 | 3300013306 | Ga0163162_10130927 | Ga0163162_101309273 | 191 |
| 356 | 3300013306 | Ga0163162_10236379 | Ga0163162_102363793 | 191 |
| 357 | 3300013307 | Ga0157372_10113422 | Ga0157372_101134222 | 191 |
| 358 | 3300013308 | Ga0157375_10192005 | Ga0157375_101920053 | 191 |
| 359 | 3300013308 | Ga0157375_11720379 | Ga0157375_117203791 | 191 |
| 360 | 3300014325 | Ga0163163_10377909 | Ga0163163_103779092 | 191 |
| 361 | 3300014326 | Ga0157380_10002418 | Ga0157380_100024186 | 191 |
| 362 | 3300014326 | Ga0157380_10205208 | Ga0157380_102052082 | 191 |
| 363 | 3300014326 | Ga0157380_10632717 | Ga0157380_106327172 | 191 |
| 364 | 3300014745 | Ga0157377_10000289 | Ga0157377_1000028916 | 191 |
| 365 | 3300014745 | Ga0157377_10065882 | Ga0157377_100658822 | 191 |
| 366 | 3300014745 | Ga0157377_10766375 | Ga0157377_107663751 | 191 |
| 367 | 3300014968 | Ga0157379_10030191 | Ga0157379_100301914 | 191 |
| 368 | 3300025315 | Ga0207697_10094300 | Ga0207697_100943003 | 191 |
| 369 | 3300025908 | Ga0207643_10049870 | Ga0207643_100498703 | 191 |
| 370 | 3300025918 | Ga0207662_10146328 | Ga0207662_101463283 | 191 |
| 371 | 3300025918 | Ga0207662_10654569 | Ga0207662_106545691 | 191 |
| 372 | 3300025920 | Ga0207649_10024736 | Ga0207649_100247363 | 191 |
| 373 | 3300025920 | Ga0207649_10424744 | Ga0207649_104247441 | 191 |
| 374 | 3300025923 | Ga0207681_10014054 | Ga0207681_100140542 | 191 |
| 375 | 3300025925 | Ga0207650_10121963 | Ga0207650_101219633 | 191 |
| 376 | 3300025925 | Ga0207650_10393583 | Ga0207650_103935832 | 191 |
| 377 | 3300025926 | Ga0207659_10189861 | Ga0207659_101898613 | 191 |
| 378 | 3300025931 | Ga0207644_11033121 | Ga0207644_110331212 | 191 |
| 379 | 3300025932 | Ga0207690_10234692 | Ga0207690_102346921 | 191 |
| 380 | 3300025933 | Ga0207706_10133193 | Ga0207706_101331933 | 191 |
| 381 | 3300025933 | Ga0207706_10183725 | Ga0207706_101837252 | 191 |
| 382 | 3300025936 | Ga0207670_10011769 | Ga0207670_100117693 | 191 |
| 383 | 3300025940 | Ga0207691_10039066 | Ga0207691_100390664 | 191 |
| 384 | 3300025942 | Ga0207689_10220798 | Ga0207689_102207983 | 191 |
| 385 | 3300025944 | Ga0207661_10000927 | Ga0207661_1000092719 | 191 |
| 386 | 3300025944 | Ga0207661_10135257 | Ga0207661_101352573 | 191 |
| 387 | 3300025945 | Ga0207679_10012298 | Ga0207679_100122984 | 191 |
| 388 | 3300025945 | Ga0207679_10441991 | Ga0207679_104419912 | 191 |
| 389 | 3300025945 | Ga0207679_10547000 | Ga0207679_105470001 | 191 |
| 390 | 3300025960 | Ga0207651_10846702 | Ga0207651_108467021 | 191 |
| 391 | 3300025961 | Ga0207712_10065768 | Ga0207712_100657683 | 191 |
| 392 | 3300025961 | Ga0207712_10168189 | Ga0207712_101681892 | 191 |
| 393 | 3300025972 | Ga0207668_10180227 | Ga0207668_101802272 | 191 |
| 394 | 3300025981 | Ga0207640_10020131 | Ga0207640_100201313 | 191 |
| 395 | 3300025981 | Ga0207640_10039229 | Ga0207640_100392293 | 191 |
| 396 | 3300026023 | Ga0207677_10035021 | Ga0207677_100350214 | 191 |
| 397 | 3300026041 | Ga0207639_10010461 | Ga0207639_100104614 | 191 |
| 398 | 3300026075 | Ga0207708_10106564 | Ga0207708_101065642 | 191 |
| 399 | 3300026075 | Ga0207708_11264777 | Ga0207708_112647771 | 191 |
| 400 | 3300026089 | Ga0207648_10069923 | Ga0207648_100699232 | 191 |
| 401 | 3300026089 | Ga0207648_10112212 | Ga0207648_101122122 | 191 |
| 402 | 3300026095 | Ga0207676_10560033 | Ga0207676_105600331 | 191 |
| 403 | 3300026116 | Ga0207674_10002719 | Ga0207674_1000271922 | 191 |
| 404 | 3300026116 | Ga0207674_10025545 | Ga0207674_100255457 | 191 |
| 405 | 3300026116 | Ga0207674_10122656 | Ga0207674_101226562 | 191 |
| 406 | 3300026118 | Ga0207675_100000386 | Ga0207675_10000038614 | 191 |
| 407 | 3300026118 | Ga0207675_100431302 | Ga0207675_1004313022 | 191 |
| 408 | 3300027907 | Ga0207428_10027645 | Ga0207428_100276455 | 191 |
| 409 | 3300028380 | Ga0268265_10266885 | Ga0268265_102668853 | 191 |
| 410 | 3300031456 | Ga0307513_10285032 | Ga0307513_102850322 | 191 |
| 411 | 3300035120 | Ga0373957_0102365 | Ga0373957_0102365_419_994 | 191 |
| 412 | 3300035171 | Ga0373946_0200926 | Ga0373946_0200926_199_774 | 191 |
| 413 | 3300035724 | Ga0373933_0212812 | Ga0373933_0212812_591_1166 | 191 |
| 414 | 3300035725 | Ga0373947_0154227 | Ga0373947_0154227_209_784 | 191 |
| 415 | 3300036401 | Ga0373937_0027905 | Ga0373937_0027905_2535_3110 | 191 |
| 416 | 3300037068 | Ga0373925_0286067 | Ga0373925_0286067_518_1093 | 191 |
| 417 | 3300041410 | Ga0439461_0010508 | Ga0439461_0010508_619_1194 | 191 |
| 418 | 3300041509 | Ga0451843_0344114 | Ga0451843_0344114_47_622 | 191 |
| 419 | 3300042131 | Ga0450894_004960 | Ga0450894_004960_280_855 | 191 |
| 420 | 3300042135 | Ga0450899_005125 | Ga0450899_005125_147_722 | 191 |
| 421 | 3300042435 | Ga0439434_0074662 | Ga0439434_0074662_365_940 | 191 |
| 422 | 3300042532 | Ga0450893_0029653 | Ga0450893_0029653_297_872 | 191 |
| 423 | 3300044712 | Ga0453684_0117232 | Ga0453684_0117232_1397_1972 | 191 |
| 424 | 3300046472 | Ga0495580_0639584 | Ga0495580_0639584_103_678 | 191 |
| 425 | 3300046511 | Ga0495608_0125173 | Ga0495608_0125173_459_1034 | 191 |
| 426 | 3300046516 | Ga0495628_0241722 | Ga0495628_0241722_109_684 | 191 |
| 427 | 3300046517 | Ga0495630_0014413 | Ga0495630_0014413_3973_4548 | 191 |
| 428 | 3300046522 | Ga0495643_0019504 | Ga0495643_0019504_3123_3698 | 191 |
| 429 | 3300046536 | Ga0495587_0271126 | Ga0495587_0271126_280_855 | 191 |
| 430 | 3300046559 | Ga0495667_0251073 | Ga0495667_0251073_79_654 | 191 |
| 431 | 3300046690 | Ga0495624_0195153 | Ga0495624_0195153_128_703 | 191 |
| 432 | 3300046809 | Ga0495600_0121764 | Ga0495600_0121764_590_1165 | 191 |
| 433 | 3300047322 | Ga0495680_0228631 | Ga0495680_0228631_641_1216 | 191 |
| 434 | 3300047471 | Ga0495684_0283950 | Ga0495684_0283950_554_1129 | 191 |
| 435 | 3300048907 | Ga0496104_0563328 | Ga0496104_0563328_453_1028 | 191 |
| 436 | 3300048913 | Ga0496110_0039739 | Ga0496110_0039739_957_1532 | 191 |
| 437 | 3300048914 | Ga0496111_0711500 | Ga0496111_0711500_78_653 | 191 |
| 438 | 3300050511 | nmdc:mga08y16_13394_c1 | nmdc:mga08y16_13394_c1_7252_7833 | 191 |
| 439 | 3300050512 | nmdc:mga0n895_220022_c1 | nmdc:mga0n895_220022_c1_414_989 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar