F444002

General Info

Members Datasets Scaffolds Average Seq Length
438 292 876 138

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10869269|Ga0207674_108692692
Length 157
Sequence LDDISRKRNAPEPEPLDSASSIMFRLVAIDHLVLRVVDLDRMLRFYCDALGCTIEKRQENIGLIQLRAGNSLIDLVPVDGKLGAAGGAPPGKEGRNLDHFCLRVEPFDEAAIHAQLARFGYASGPVEKRYGAEGEGPSIYVTDPEGNVVELKGPPAK

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
113 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
196 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
199 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
200 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
201 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
205 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
282 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
287 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
288 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
289 2738541337 Pelomonas sp. BT06 Isolate Unclassified
290 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
291 2904424332 Duganella sp. 1411 Isolate Rhizosphere
292 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 0
Rhizoplane 3.42
Rhizosphere 82.65
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10869269 3300026116 Bacteria 869
2 JGI24739J22299_10125216 3300001989 Bacteria 766
3 JGI25162J39368_1000271 3300002737 Bacteria 49990
4 JGI25164J39214_1005916 3300002772 Bacteria 1304
5 JGI25165J46597_1000373 3300003214 Bacteria 49990
6 Ga0055538_1000144 3300003751 Bacteria 49990
7 Ga0055539_1000195 3300003752 Bacteria 49990
8 Ga0055533_1000196 3300003756 Bacteria 49990
9 Ga0055525_1000263 3300003759 Bacteria 49990
10 Ga0055526_1000023 3300003771 Bacteria 163444
11 Ga0055536_1000251 3300003781 Bacteria 42530
12 Ga0055530_10110863 3300003791 Bacteria 541
13 Ga0055541_1000128 3300003841 Bacteria 49990
14 Ga0065165_1099985 3300005262 Bacteria 727
15 Ga0065707_10096030 3300005295 Bacteria 3311
16 Ga0065707_10146614 3300005295 Bacteria 1706
17 Ga0070676_10272810 3300005328 Bacteria 1137
18 Ga0070690_100016476 3300005330 Bacteria 4428
19 Ga0070670_100001457 3300005331 Bacteria 19034
20 Ga0070670_101690914 3300005331 Bacteria 582
21 Ga0070677_10001049 3300005333 Bacteria 8918
22 Ga0068869_100031650 3300005334 Bacteria 3721
23 Ga0068869_101168718 3300005334 Bacteria 675
24 Ga0070666_10109049 3300005335 Bacteria 1913
25 Ga0070680_100187650 3300005336 Bacteria 1742
26 Ga0068868_100101210 3300005338 Unclassified 2332
27 Ga0068868_100134854 3300005338 Bacteria 2023
28 Ga0068868_100389163 3300005338 Bacteria 1201
29 Ga0070689_101512484 3300005340 Bacteria 608
30 Ga0070691_10096315 3300005341 Bacteria 1465
31 Ga0070661_101300775 3300005344 Bacteria 610
32 Ga0070692_10010150 3300005345 Bacteria 4276
33 Ga0070668_100069510 3300005347 Bacteria 2739
34 Ga0070669_100023781 3300005353 Bacteria 4391
35 Ga0070675_100000234 3300005354 Bacteria 35700
36 Ga0070671_100012794 3300005355 Bacteria 6766
37 Ga0070671_100113432 3300005355 Bacteria 2277
38 Ga0070674_100002586 3300005356 Bacteria 10017
39 Ga0070673_100002987 3300005364 Bacteria 10440
40 Ga0070673_100018412 3300005364 Bacteria 4987
41 Ga0070688_100286771 3300005365 Bacteria 1185
42 Ga0070667_100083739 3300005367 Bacteria 2733
43 Ga0070667_100098378 3300005367 Bacteria 2525
44 Ga0070667_100972578 3300005367 Unclassified 791
45 Ga0070667_101688115 3300005367 Unclassified 596
46 Ga0070703_10194255 3300005406 Bacteria 792
47 Ga0070701_10000729 3300005438 Bacteria 11644
48 Ga0070700_100002634 3300005441 Bacteria 9182
49 Ga0070694_100082308 3300005444 Bacteria 2241
50 Ga0070694_100767782 3300005444 Bacteria 788
51 Ga0070708_100409250 3300005445 Bacteria 1279
52 Ga0070663_100442476 3300005455 Bacteria 1070
53 Ga0070678_100004620 3300005456 Bacteria 7825
54 Ga0070678_101280155 3300005456 Bacteria 682
55 Ga0070678_101373392 3300005456 Bacteria 659
56 Ga0070662_101646153 3300005457 Bacteria 554
57 Ga0068867_100000720 3300005459 Bacteria 22110
58 Ga0068867_100014633 3300005459 Bacteria 5559
59 Ga0070685_10057554 3300005466 Bacteria 2263
60 Ga0070706_100001321 3300005467 Bacteria 26375
61 Ga0070707_100062813 3300005468 Bacteria 3563
62 Ga0070707_100118537 3300005468 Bacteria 2569
63 Ga0070698_100472517 3300005471 Bacteria 1190
64 Ga0070699_100407444 3300005518 Bacteria 1230
65 Ga0070699_100704316 3300005518 Bacteria 923
66 Ga0068853_100855258 3300005539 Bacteria 872
67 Ga0068853_101016906 3300005539 Bacteria 798
68 Ga0070672_100009044 3300005543 Bacteria 6848
69 Ga0070672_101270332 3300005543 Bacteria 657
70 Ga0070686_100004547 3300005544 Bacteria 7652
71 Ga0070695_100009071 3300005545 Bacteria 5913
72 Ga0070695_100051259 3300005545 Bacteria 2648
73 Ga0070696_100039451 3300005546 Bacteria 3260
74 Ga0070696_100807511 3300005546 Bacteria 772
75 Ga0070693_100266836 3300005547 Bacteria 1141
76 Ga0070665_100640855 3300005548 Bacteria 1076
77 Ga0070665_101649374 3300005548 Bacteria 649
78 Ga0070704_100093528 3300005549 Bacteria 2247
79 Ga0070704_101924930 3300005549 Bacteria 548
80 Ga0068855_100126952 3300005563 Bacteria 2915
81 Ga0070664_100057118 3300005564 Bacteria 3317
82 Ga0068857_100434866 3300005577 Bacteria 1225
83 Ga0068856_101961571 3300005614 Bacteria 596
84 Ga0070702_100033171 3300005615 Bacteria 2837
85 Ga0068852_100434049 3300005616 Bacteria 1298
86 Ga0068852_100511638 3300005616 Bacteria 1197
87 Ga0068852_100907658 3300005616 Bacteria 898
88 Ga0068852_101312249 3300005616 Bacteria 745
89 Ga0068859_100047702 3300005617 Bacteria 4303
90 Ga0068859_100071420 3300005617 Bacteria 3507
91 Ga0068859_102360070 3300005617 Bacteria 586
92 Ga0068864_100054440 3300005618 Bacteria 3453
93 Ga0068864_100104795 3300005618 Bacteria 2513
94 Ga0068866_10057466 3300005718 Bacteria 2005
95 Ga0068861_100205909 3300005719 Bacteria 1654
96 Ga0068863_101001892 3300005841 Bacteria 838
97 Ga0068858_100036307 3300005842 Bacteria 4569
98 Ga0068858_100539207 3300005842 Unclassified 1129
99 Ga0068858_101022660 3300005842 Bacteria 810
100 Ga0068860_100045968 3300005843 Bacteria 4164
101 Ga0068860_100176220 3300005843 Bacteria 2066
102 Ga0068860_100621263 3300005843 Bacteria 1087
103 Ga0068860_100977583 3300005843 Bacteria 864
104 Ga0068862_100165145 3300005844 Unclassified 1979
105 Ga0081539_10106244 3300005985 Bacteria 1421
106 Ga0075362_10171688 3300006177 Bacteria 1048
107 Ga0075367_10012706 3300006178 Bacteria 4503
108 Ga0075367_10156999 3300006178 Bacteria 1414
109 Ga0075366_10004870 3300006195 Bacteria 7242
110 Ga0075366_10287651 3300006195 Bacteria 1005
111 Ga0097621_100008547 3300006237 Bacteria 7377
112 Ga0097621_100477185 3300006237 Bacteria 1127
113 Ga0075370_10139784 3300006353 Bacteria 1415
114 Ga0075370_10282468 3300006353 Bacteria 986
115 Ga0068871_100035618 3300006358 Bacteria 3956
116 Ga0075428_100022231 3300006844 Bacteria 7022
117 Ga0075428_102499588 3300006844 Bacteria 529
118 Ga0075431_100018577 3300006847 Bacteria 7082
119 Ga0075431_100025444 3300006847 Bacteria 6065
120 Ga0075429_100000921 3300006880 Bacteria 23314
121 Ga0075429_100046921 3300006880 Bacteria 3758
122 Ga0068865_100013692 3300006881 Bacteria 5136
123 Ga0068865_100097288 3300006881 Bacteria 2148
124 Ga0097620_100047703 3300006931 Bacteria 4303
125 Ga0097620_100071419 3300006931 Bacteria 3507
126 Ga0097620_102360820 3300006931 Bacteria 586
127 Ga0075435_100081986 3300007076 Bacteria 2651
128 Ga0075435_101230284 3300007076 Bacteria 655
129 Ga0099794_10384587 3300007265 Bacteria 732
130 Ga0111539_10041808 3300009094 Bacteria 5508
131 Ga0105247_11084254 3300009101 Bacteria 631
132 Ga0114129_10001505 3300009147 Bacteria 31535
133 Ga0114129_10067906 3300009147 Bacteria 4971
134 Ga0105243_10043296 3300009148 Bacteria 3528
135 Ga0105242_10018744 3300009176 Bacteria 5413
136 Ga0105248_10002775 3300009177 Bacteria 19479
137 Ga0105248_10034506 3300009177 Bacteria 5658
138 Ga0105239_12224127 3300010375 Unclassified 638
139 Ga0157370_10699022 3300013104 Bacteria 925
140 Ga0157369_11258364 3300013105 Bacteria 755
141 Ga0157378_10087696 3300013297 Unclassified 2823
142 Ga0157378_11006594 3300013297 Bacteria 868
143 Ga0163162_10136158 3300013306 Bacteria 2567
144 Ga0163162_12475352 3300013306 Bacteria 597
145 Ga0157372_10429501 3300013307 Bacteria 1540
146 Ga0157372_10480947 3300013307 Bacteria 1448
147 Ga0157372_10636667 3300013307 Bacteria 1242
148 Ga0157372_10959605 3300013307 Bacteria 991
149 Ga0157375_10094447 3300013308 Bacteria 3059
150 Ga0157375_10187711 3300013308 Bacteria 2221
151 Ga0157375_11208452 3300013308 Bacteria 887
152 Ga0163163_10532918 3300014325 Bacteria 1237
153 Ga0163163_11538219 3300014325 Bacteria 726
154 Ga0157380_10341864 3300014326 Bacteria 1396
155 Ga0157377_10202713 3300014745 Bacteria 1260
156 Ga0157377_10923611 3300014745 Bacteria 654
157 Ga0157379_10115112 3300014968 Bacteria 2418
158 Ga0157376_10180564 3300014969 Bacteria 1929
159 Ga0157376_10220362 3300014969 Bacteria 1757
160 Ga0182007_10002479 3300015262 Bacteria 9146
161 Ga0163161_10005169 3300017792 Bacteria 9077
162 Ga0213872_10030549 3300021361 Bacteria 2469
163 Ga0209784_100010 3300025224 Bacteria 683664
164 Ga0209566_100008 3300025225 Bacteria 683664
165 Ga0209674_100019 3300025226 Bacteria 683664
166 Ga0209563_100021 3300025230 Bacteria 683764
167 Ga0207427_100222 3300025231 Bacteria 48738
168 Ga0209437_100019 3300025233 Bacteria 683764
169 Ga0209026_1000248 3300025250 Bacteria 68614
170 Ga0209677_100011 3300025253 Bacteria 683664
171 Ga0209759_1000221 3300025256 Bacteria 86919
172 Ga0209233_1000025 3300025261 Bacteria 683764
173 Ga0209676_1000038 3300025292 Bacteria 449305
174 Ga0209676_1000198 3300025292 Bacteria 134708
175 Ga0209564_1000002 3300025295 Bacteria 1636803
176 Ga0209050_1028425 3300025298 Bacteria 1814
177 Ga0209050_1060184 3300025298 Bacteria 901
178 Ga0209051_1043849 3300025303 Bacteria 1565
179 Ga0209257_1000433 3300025304 Bacteria 80612
180 Ga0207697_10009128 3300025315 Bacteria 4298
181 Ga0207653_10289682 3300025885 Bacteria 633
182 Ga0207682_10001559 3300025893 Bacteria 10527
183 Ga0207682_10235936 3300025893 Bacteria 849
184 Ga0207688_10079464 3300025901 Bacteria 1871
185 Ga0207643_10028651 3300025908 Bacteria 3094
186 Ga0207643_10227492 3300025908 Bacteria 1143
187 Ga0207643_10349447 3300025908 Bacteria 928
188 Ga0207684_10007886 3300025910 Bacteria 9524
189 Ga0207662_10446970 3300025918 Bacteria 883
190 Ga0207649_10158198 3300025920 Bacteria 1567
191 Ga0207649_10167188 3300025920 Bacteria 1529
192 Ga0207646_10127629 3300025922 Bacteria 2287
193 Ga0207681_10024729 3300025923 Bacteria 3856
194 Ga0207681_10962591 3300025923 Bacteria 716
195 Ga0207694_10083649 3300025924 Bacteria 2509
196 Ga0207650_10002445 3300025925 Bacteria 12935
197 Ga0207659_10003495 3300025926 Bacteria 9436
198 Ga0207687_10035466 3300025927 Unclassified 3393
199 Ga0207706_10777113 3300025933 Bacteria 815
200 Ga0207686_10018699 3300025934 Bacteria 3926
201 Ga0207709_10014395 3300025935 Bacteria 4367
202 Ga0207670_10944571 3300025936 Bacteria 724
203 Ga0207669_10024103 3300025937 Bacteria 3264
204 Ga0207704_10073514 3300025938 Bacteria 2177
205 Ga0207704_10113239 3300025938 Unclassified 1839
206 Ga0207704_10266418 3300025938 Bacteria 1295
207 Ga0207691_10001394 3300025940 Bacteria 24181
208 Ga0207691_10038747 3300025940 Bacteria 4410
209 Ga0207711_10032268 3300025941 Bacteria 4428
210 Ga0207711_11685664 3300025941 Bacteria 577
211 Ga0207689_10004549 3300025942 Bacteria 12553
212 Ga0207689_10052224 3300025942 Bacteria 3369
213 Ga0207679_10143753 3300025945 Bacteria 1932
214 Ga0207667_10043635 3300025949 Bacteria 4758
215 Ga0207651_10000764 3300025960 Bacteria 13832
216 Ga0207651_10027343 3300025960 Bacteria 3582
217 Ga0207651_11496326 3300025960 Bacteria 608
218 Ga0207651_11525903 3300025960 Unclassified 602
219 Ga0207668_10305510 3300025972 Bacteria 1314
220 Ga0207658_10233364 3300025986 Bacteria 1554
221 Ga0207658_10370055 3300025986 Bacteria 1253
222 Ga0207658_11526747 3300025986 Unclassified 611
223 Ga0207677_10061088 3300026023 Bacteria 2608
224 Ga0207703_10083828 3300026035 Unclassified 2664
225 Ga0207703_11724677 3300026035 Bacteria 602
226 Ga0207639_11230672 3300026041 Bacteria 703
227 Ga0207678_10454320 3300026067 Bacteria 1114
228 Ga0207708_10003954 3300026075 Bacteria 10911
229 Ga0207702_10577474 3300026078 Bacteria 1102
230 Ga0207641_10147885 3300026088 Bacteria 2126
231 Ga0207648_10001726 3300026089 Bacteria 23928
232 Ga0207648_10034486 3300026089 Bacteria 4461
233 Ga0207676_10966033 3300026095 Bacteria 838
234 Ga0207674_10047321 3300026116 Bacteria 4410
235 Ga0207674_10428831 3300026116 Bacteria 1278
236 Ga0207675_100005947 3300026118 Bacteria 11632
237 Ga0207683_10032830 3300026121 Bacteria 4510
238 Ga0207683_10066703 3300026121 Bacteria 3174
239 Ga0207683_10389158 3300026121 Bacteria 1282
240 Ga0207683_11030659 3300026121 Bacteria 764
241 Ga0207698_10053900 3300026142 Bacteria 3091
242 Ga0207698_10209793 3300026142 Bacteria 1751
243 Ga0209974_10001737 3300027876 Bacteria 7919
244 Ga0268266_10203761 3300028379 Bacteria 1812
245 Ga0268266_10824144 3300028379 Bacteria 896
246 Ga0268265_10066470 3300028380 Bacteria 2787
247 Ga0268265_10261375 3300028380 Bacteria 1539
248 Ga0268264_10084123 3300028381 Bacteria 2727
249 Ga0268264_11658857 3300028381 Bacteria 650
250 Ga0307515_10000902 3300028794 Bacteria 68371
251 Ga0307509_10053132 3300031507 Bacteria 4322
252 Ga0307408_100106699 3300031548 Bacteria 2143
253 Ga0307408_100537760 3300031548 Bacteria 1029
254 Ga0316575_10029654 3300031665 Bacteria 2137
255 Ga0316579_10538175 3300031691 Unclassified 565
256 Ga0316578_10499314 3300031728 Unclassified 717
257 Ga0307516_10016128 3300031730 Bacteria 7828
258 Ga0307516_10034082 3300031730 Bacteria 5120
259 Ga0307405_10006593 3300031731 Bacteria 5723
260 Ga0307405_10204393 3300031731 Bacteria 1437
261 Ga0307413_11088975 3300031824 Bacteria 689
262 Ga0307410_10072575 3300031852 Bacteria 2391
263 Ga0307410_10913982 3300031852 Bacteria 752
264 Ga0307406_10099437 3300031901 Bacteria 1977
265 Ga0307406_10519623 3300031901 Bacteria 969
266 Ga0307407_10041316 3300031903 Bacteria 2578
267 Ga0307407_10228221 3300031903 Bacteria 1263
268 Ga0307412_10042449 3300031911 Bacteria 2955
269 Ga0307409_100056518 3300031995 Bacteria 3035
270 Ga0307409_101582228 3300031995 Bacteria 683
271 Ga0307416_100022213 3300032002 Bacteria 4575
272 Ga0307414_10303726 3300032004 Bacteria 1351
273 Ga0307411_10008434 3300032005 Bacteria 5339
274 Ga0307411_10067591 3300032005 Bacteria 2405
275 Ga0307415_100299034 3300032126 Bacteria 1332
276 Ga0316583_10351069 3300032133 Unclassified 510
277 Ga0373939_0050273 3300035114 Bacteria 1292
278 Ga0373935_0530639 3300035692 Bacteria 857
279 Ga0373937_0478882 3300036401 Bacteria 1182
280 Ga0395899_0051665 3300037312 Bacteria 3049
281 Ga0395899_0055736 3300037312 Bacteria 2923
282 Ga0395899_0221201 3300037312 Bacteria 1311
283 Ga0395899_0435428 3300037312 Bacteria 861
284 Ga0395900_0000297 3300037418 Bacteria 74817
285 Ga0395900_0032818 3300037418 Bacteria 5340
286 Ga0395900_0443394 3300037418 Bacteria 1255
287 Ga0395900_0629184 3300037418 Bacteria 1011
288 Ga0395898_0203117 3300037466 Bacteria 1891
289 Ga0395898_0301119 3300037466 Bacteria 1529
290 Ga0395898_0412622 3300037466 Bacteria 1287
291 Ga0395898_0813585 3300037466 Bacteria 874
292 Ga0395905_0011653 3300037471 Bacteria 8490
293 Ga0395905_0087012 3300037471 Bacteria 2929
294 Ga0395901_0000182 3300038443 Bacteria 81583
295 Ga0395901_0015508 3300038443 Bacteria 7759
296 Ga0395901_0135697 3300038443 Bacteria 2586
297 Ga0395901_0507235 3300038443 Bacteria 1227
298 Ga0436361_0774986 3300039447 Bacteria 5968
299 Ga0451793_0807408 3300041452 Bacteria 2593
300 Ga0451841_1406417 3300041498 Bacteria 1442
301 Ga0451849_1165610 3300041505 Bacteria 764
302 Ga0451853_0134802 3300041512 Bacteria 1764
303 Ga0450912_001557 3300042116 Bacteria 1422
304 Ga0450890_003485 3300042127 Bacteria 2088
305 Ga0450891_003480 3300042129 Bacteria 1511
306 Ga0450893_0003253 3300042532 Bacteria 2552
307 Ga0451577_1730775 3300042876 Bacteria 550
308 Ga0466969_0057345 3300044656 Bacteria 1898
309 Ga0466969_0058235 3300044656 Bacteria 1881
310 Ga0466975_0052827 3300044661 Bacteria 2896
311 Ga0466977_0572031 3300044666 Bacteria 606
312 Ga0453683_0122182 3300044673 Bacteria 1640
313 Ga0466965_0116950 3300044683 Bacteria 1374
314 Ga0466966_0002614 3300044684 Bacteria 11807
315 Ga0466966_0052976 3300044684 Bacteria 2575
316 Ga0466966_0133716 3300044684 Bacteria 1517
317 Ga0466961_0013241 3300044693 Bacteria 5276
318 Ga0466961_0130638 3300044693 Bacteria 1574
319 Ga0466961_0232429 3300044693 Bacteria 1134
320 Ga0453684_0621602 3300044712 Bacteria 1182
321 Ga0466971_0461976 3300044719 Bacteria 623
322 Ga0466970_0181875 3300044765 Bacteria 1166
323 Ga0466959_0000208 3300045049 Bacteria 37886
324 Ga0466959_0017154 3300045049 Bacteria 5303
325 Ga0451576_0627855 3300045051 Bacteria 1129
326 Ga0451576_1690951 3300045051 Bacteria 655
327 Ga0466958_0023969 3300045836 Bacteria 3588
328 Ga0466958_0146680 3300045836 Bacteria 1487
329 Ga0466958_0312143 3300045836 Bacteria 1010
330 Ga0495651_0186645 3300046462 Bacteria 1462
331 Ga0495605_0000652 3300046474 Bacteria 26506
332 Ga0495584_0000495 3300046491 Bacteria 27066
333 Ga0495584_0002112 3300046491 Bacteria 11381
334 Ga0495584_0040371 3300046491 Bacteria 2356
335 Ga0495585_0000265 3300046492 Bacteria 52393
336 Ga0495596_0002995 3300046500 Bacteria 8757
337 Ga0495607_0004272 3300046501 Bacteria 10573
338 Ga0495607_0005552 3300046501 Bacteria 8994
339 Ga0495606_0009601 3300046507 Bacteria 8155
340 Ga0495606_0458902 3300046507 Bacteria 651
341 Ga0495608_0511540 3300046511 Bacteria 726
342 Ga0495616_0000827 3300046513 Bacteria 22588
343 Ga0495616_0010518 3300046513 Bacteria 5353
344 Ga0495616_0030497 3300046513 Bacteria 2833
345 Ga0495632_0035464 3300046519 Bacteria 2545
346 Ga0495643_0006079 3300046522 Bacteria 8039
347 Ga0495643_0183780 3300046522 Bacteria 1014
348 Ga0495666_0029017 3300046526 Bacteria 2721
349 Ga0495652_0023282 3300046529 Bacteria 5491
350 Ga0495665_0003914 3300046531 Bacteria 8059
351 Ga0495665_0672252 3300046531 Bacteria 515
352 Ga0495609_0000731 3300046538 Bacteria 24981
353 Ga0495609_0019624 3300046538 Bacteria 3126
354 Ga0495621_0117610 3300046539 Bacteria 1025
355 Ga0495645_0054445 3300046543 Bacteria 2907
356 Ga0495633_0005157 3300046558 Bacteria 8092
357 Ga0495656_0044842 3300046615 Bacteria 1864
358 Ga0495634_0695095 3300046642 Bacteria 585
359 Ga0495659_0112789 3300046664 Bacteria 1063
360 Ga0495661_0000894 3300046665 Bacteria 27503
361 Ga0495661_0008538 3300046665 Bacteria 7079
362 Ga0495661_0056411 3300046665 Bacteria 2350
363 Ga0495588_0000174 3300046674 Bacteria 81329
364 Ga0495588_0011414 3300046674 Bacteria 4168
365 Ga0495657_0555665 3300046675 Bacteria 666
366 Ga0495623_0160196 3300046679 Bacteria 1323
367 Ga0495646_0000203 3300046680 Bacteria 29373
368 Ga0495624_0010461 3300046690 Bacteria 6395
369 Ga0495624_0447166 3300046690 Bacteria 774
370 Ga0495589_0000693 3300046794 Bacteria 21927
371 Ga0495589_0000990 3300046794 Bacteria 17241
372 Ga0495660_0000157 3300046810 Bacteria 73772
373 Ga0495581_0016929 3300047315 Bacteria 4236
374 Ga0495672_0003512 3300047320 Bacteria 13363
375 Ga0495683_0000041 3300047323 Bacteria 137557
376 Ga0495687_000215 3300047443 Bacteria 82752
377 Ga0495687_000457 3300047443 Bacteria 49882
378 Ga0495687_014065 3300047443 Bacteria 4139
379 Ga0495687_016236 3300047443 Bacteria 3749
380 Ga0495677_0000259 3300047445 Bacteria 23264
381 Ga0495677_0000915 3300047445 Bacteria 11884
382 Ga0495681_0281482 3300047470 Bacteria 648
383 Ga0495686_0086061 3300047472 Bacteria 1913
384 Ga0495686_0230498 3300047472 Bacteria 1049
385 Ga0495602_0183814 3300048088 Bacteria 1609
386 Ga0495602_0340045 3300048088 Bacteria 1086
387 Ga0495626_0000016 3300048091 Bacteria 232214
388 Ga0495626_0001380 3300048091 Bacteria 19523
389 Ga0496102_0198657 3300048905 Bacteria 1890
390 Ga0496102_0658224 3300048905 Bacteria 970
391 Ga0496103_0338659 3300048906 Bacteria 967
392 Ga0496104_0095244 3300048907 Bacteria 2848
393 Ga0496104_1386753 3300048907 Bacteria 606
394 Ga0496106_0022733 3300048909 Bacteria 4660
395 Ga0496106_0172766 3300048909 Bacteria 1713
396 Ga0496107_0058584 3300048910 Bacteria 2785
397 Ga0496108_0858323 3300048911 Bacteria 781
398 Ga0496109_0070772 3300048912 Bacteria 3202
399 Ga0496109_0543904 3300048912 Bacteria 1096
400 Ga0496110_0162034 3300048913 Bacteria 2028
401 Ga0496111_1073645 3300048914 Bacteria 575
402 Ga0496112_0022932 3300048915 Bacteria 5956
403 Ga0496120_0075798 3300048923 Bacteria 1835
404 Ga0496125_0353145 3300048928 Bacteria 877
405 Ga0501031_0284044 3300049568 Bacteria 1073
406 Ga0501033_0001518 3300049570 Bacteria 20530
407 Ga0501047_0108126 3300049581 Bacteria 2663
408 Ga0501067_0199869 3300049583 Bacteria 1113
409 Ga0501083_0012461 3300049744 Bacteria 5946
410 Ga0501035_0002348 3300049822 Bacteria 18642
411 Ga0501044_0562815 3300049823 Bacteria 1036
412 nmdc:mga0k408_13380_c1 3300050493 Bacteria 4498
413 nmdc:mga06z11_104696_c1 3300050494 Bacteria 1558
414 nmdc:mga06z11_228540_c1 3300050494 Bacteria 1089
415 nmdc:mga07m45_171316_c1 3300050496 Bacteria 1262
416 nmdc:mga07m45_528232_c1 3300050496 Unclassified 683
417 nmdc:mga07m45_702622_c1 3300050496 Bacteria 581
418 nmdc:mga05p37_66539_c1 3300050507 Bacteria 4432
419 nmdc:mga05p37_78_c1 3300050507 Bacteria 85760
420 nmdc:mga09592_869_c1 3300050508 Bacteria 23648
421 nmdc:mga06r32_10717_c1 3300050510 Bacteria 8258
422 nmdc:mga06r32_834285_c1 3300050510 Bacteria 881
423 nmdc:mga0rr50_1219777_c1 3300050513 Bacteria 639
424 nmdc:mga0rr50_603129_c1 3300050513 Bacteria 936
425 nmdc:mga0rr50_826593_c1 3300050513 Bacteria 790
426 nmdc:mga08x19_172968_c1 3300050514 Bacteria 1471
427 Ga0500578_0053068 3300053086 Bacteria 2596
428 Ga0500590_017430 3300053148 Bacteria 3712
429 Ga0500616_0002153 3300053153 Bacteria 17047
430 Ga0500645_005054 3300053730 Bacteria 4930
431 Ga0466962_0309554 3300061719 Bacteria 782
432 2587756966 2585428062 Bacteria 6842168
433 2643741903 2643221544 Bacteria 5886209
434 2644256143 2643221646 Bacteria 6433402
435 2739054614 2738541337 Bacteria 6183410
436 2885195985 2885192300 Bacteria 5882526
437 2904424524 2904424332 Bacteria 7633521
438 8002871379 8002869464 Bacteria 3588529
439 Ga0207674_10869269
440 JGI24739J22299_10125216
441 JGI25162J39368_1000271
442 JGI25164J39214_1005916
443 JGI25165J46597_1000373
444 Ga0055538_1000144
445 Ga0055539_1000195
446 Ga0055533_1000196
447 Ga0055525_1000263
448 Ga0055526_1000023
449 Ga0055536_1000251
450 Ga0055530_10110863
451 Ga0055541_1000128
452 Ga0065165_1099985
453 Ga0065707_10096030
454 Ga0065707_10146614
455 Ga0070676_10272810
456 Ga0070690_100016476
457 Ga0070670_100001457
458 Ga0070670_101690914
459 Ga0070677_10001049
460 Ga0068869_100031650
461 Ga0068869_101168718
462 Ga0070666_10109049
463 Ga0070680_100187650
464 Ga0068868_100101210
465 Ga0068868_100134854
466 Ga0068868_100389163
467 Ga0070689_101512484
468 Ga0070691_10096315
469 Ga0070661_101300775
470 Ga0070692_10010150
471 Ga0070668_100069510
472 Ga0070669_100023781
473 Ga0070675_100000234
474 Ga0070671_100012794
475 Ga0070671_100113432
476 Ga0070674_100002586
477 Ga0070673_100002987
478 Ga0070673_100018412
479 Ga0070688_100286771
480 Ga0070667_100083739
481 Ga0070667_100098378
482 Ga0070667_100972578
483 Ga0070667_101688115
484 Ga0070703_10194255
485 Ga0070701_10000729
486 Ga0070700_100002634
487 Ga0070694_100082308
488 Ga0070694_100767782
489 Ga0070708_100409250
490 Ga0070663_100442476
491 Ga0070678_100004620
492 Ga0070678_101280155
493 Ga0070678_101373392
494 Ga0070662_101646153
495 Ga0068867_100000720
496 Ga0068867_100014633
497 Ga0070685_10057554
498 Ga0070706_100001321
499 Ga0070707_100062813
500 Ga0070707_100118537
501 Ga0070698_100472517
502 Ga0070699_100407444
503 Ga0070699_100704316
504 Ga0068853_100855258
505 Ga0068853_101016906
506 Ga0070672_100009044
507 Ga0070672_101270332
508 Ga0070686_100004547
509 Ga0070695_100009071
510 Ga0070695_100051259
511 Ga0070696_100039451
512 Ga0070696_100807511
513 Ga0070693_100266836
514 Ga0070665_100640855
515 Ga0070665_101649374
516 Ga0070704_100093528
517 Ga0070704_101924930
518 Ga0068855_100126952
519 Ga0070664_100057118
520 Ga0068857_100434866
521 Ga0068856_101961571
522 Ga0070702_100033171
523 Ga0068852_100434049
524 Ga0068852_100511638
525 Ga0068852_100907658
526 Ga0068852_101312249
527 Ga0068859_100047702
528 Ga0068859_100071420
529 Ga0068859_102360070
530 Ga0068864_100054440
531 Ga0068864_100104795
532 Ga0068866_10057466
533 Ga0068861_100205909
534 Ga0068863_101001892
535 Ga0068858_100036307
536 Ga0068858_100539207
537 Ga0068858_101022660
538 Ga0068860_100045968
539 Ga0068860_100176220
540 Ga0068860_100621263
541 Ga0068860_100977583
542 Ga0068862_100165145
543 Ga0081539_10106244
544 Ga0075362_10171688
545 Ga0075367_10012706
546 Ga0075367_10156999
547 Ga0075366_10004870
548 Ga0075366_10287651
549 Ga0097621_100008547
550 Ga0097621_100477185
551 Ga0075370_10139784
552 Ga0075370_10282468
553 Ga0068871_100035618
554 Ga0075428_100022231
555 Ga0075428_102499588
556 Ga0075431_100018577
557 Ga0075431_100025444
558 Ga0075429_100000921
559 Ga0075429_100046921
560 Ga0068865_100013692
561 Ga0068865_100097288
562 Ga0097620_100047703
563 Ga0097620_100071419
564 Ga0097620_102360820
565 Ga0075435_100081986
566 Ga0075435_101230284
567 Ga0099794_10384587
568 Ga0111539_10041808
569 Ga0105247_11084254
570 Ga0114129_10001505
571 Ga0114129_10067906
572 Ga0105243_10043296
573 Ga0105242_10018744
574 Ga0105248_10002775
575 Ga0105248_10034506
576 Ga0105239_12224127
577 Ga0157370_10699022
578 Ga0157369_11258364
579 Ga0157378_10087696
580 Ga0157378_11006594
581 Ga0163162_10136158
582 Ga0163162_12475352
583 Ga0157372_10429501
584 Ga0157372_10480947
585 Ga0157372_10636667
586 Ga0157372_10959605
587 Ga0157375_10094447
588 Ga0157375_10187711
589 Ga0157375_11208452
590 Ga0163163_10532918
591 Ga0163163_11538219
592 Ga0157380_10341864
593 Ga0157377_10202713
594 Ga0157377_10923611
595 Ga0157379_10115112
596 Ga0157376_10180564
597 Ga0157376_10220362
598 Ga0182007_10002479
599 Ga0163161_10005169
600 Ga0213872_10030549
601 Ga0209784_100010
602 Ga0209566_100008
603 Ga0209674_100019
604 Ga0209563_100021
605 Ga0207427_100222
606 Ga0209437_100019
607 Ga0209026_1000248
608 Ga0209677_100011
609 Ga0209759_1000221
610 Ga0209233_1000025
611 Ga0209676_1000038
612 Ga0209676_1000198
613 Ga0209564_1000002
614 Ga0209050_1028425
615 Ga0209050_1060184
616 Ga0209051_1043849
617 Ga0209257_1000433
618 Ga0207697_10009128
619 Ga0207653_10289682
620 Ga0207682_10001559
621 Ga0207682_10235936
622 Ga0207688_10079464
623 Ga0207643_10028651
624 Ga0207643_10227492
625 Ga0207643_10349447
626 Ga0207684_10007886
627 Ga0207662_10446970
628 Ga0207649_10158198
629 Ga0207649_10167188
630 Ga0207646_10127629
631 Ga0207681_10024729
632 Ga0207681_10962591
633 Ga0207694_10083649
634 Ga0207650_10002445
635 Ga0207659_10003495
636 Ga0207687_10035466
637 Ga0207706_10777113
638 Ga0207686_10018699
639 Ga0207709_10014395
640 Ga0207670_10944571
641 Ga0207669_10024103
642 Ga0207704_10073514
643 Ga0207704_10113239
644 Ga0207704_10266418
645 Ga0207691_10001394
646 Ga0207691_10038747
647 Ga0207711_10032268
648 Ga0207711_11685664
649 Ga0207689_10004549
650 Ga0207689_10052224
651 Ga0207679_10143753
652 Ga0207667_10043635
653 Ga0207651_10000764
654 Ga0207651_10027343
655 Ga0207651_11496326
656 Ga0207651_11525903
657 Ga0207668_10305510
658 Ga0207658_10233364
659 Ga0207658_10370055
660 Ga0207658_11526747
661 Ga0207677_10061088
662 Ga0207703_10083828
663 Ga0207703_11724677
664 Ga0207639_11230672
665 Ga0207678_10454320
666 Ga0207708_10003954
667 Ga0207702_10577474
668 Ga0207641_10147885
669 Ga0207648_10001726
670 Ga0207648_10034486
671 Ga0207676_10966033
672 Ga0207674_10047321
673 Ga0207674_10428831
674 Ga0207675_100005947
675 Ga0207683_10032830
676 Ga0207683_10066703
677 Ga0207683_10389158
678 Ga0207683_11030659
679 Ga0207698_10053900
680 Ga0207698_10209793
681 Ga0209974_10001737
682 Ga0268266_10203761
683 Ga0268266_10824144
684 Ga0268265_10066470
685 Ga0268265_10261375
686 Ga0268264_10084123
687 Ga0268264_11658857
688 Ga0307515_10000902
689 Ga0307509_10053132
690 Ga0307408_100106699
691 Ga0307408_100537760
692 Ga0316575_10029654
693 Ga0316579_10538175
694 Ga0316578_10499314
695 Ga0307516_10016128
696 Ga0307516_10034082
697 Ga0307405_10006593
698 Ga0307405_10204393
699 Ga0307413_11088975
700 Ga0307410_10072575
701 Ga0307410_10913982
702 Ga0307406_10099437
703 Ga0307406_10519623
704 Ga0307407_10041316
705 Ga0307407_10228221
706 Ga0307412_10042449
707 Ga0307409_100056518
708 Ga0307409_101582228
709 Ga0307416_100022213
710 Ga0307414_10303726
711 Ga0307411_10008434
712 Ga0307411_10067591
713 Ga0307415_100299034
714 Ga0316583_10351069
715 Ga0373939_0050273
716 Ga0373935_0530639
717 Ga0373937_0478882
718 Ga0395899_0051665
719 Ga0395899_0055736
720 Ga0395899_0221201
721 Ga0395899_0435428
722 Ga0395900_0000297
723 Ga0395900_0032818
724 Ga0395900_0443394
725 Ga0395900_0629184
726 Ga0395898_0203117
727 Ga0395898_0301119
728 Ga0395898_0412622
729 Ga0395898_0813585
730 Ga0395905_0011653
731 Ga0395905_0087012
732 Ga0395901_0000182
733 Ga0395901_0015508
734 Ga0395901_0135697
735 Ga0395901_0507235
736 Ga0436361_0774986
737 Ga0451793_0807408
738 Ga0451841_1406417
739 Ga0451849_1165610
740 Ga0451853_0134802
741 Ga0450912_001557
742 Ga0450890_003485
743 Ga0450891_003480
744 Ga0450893_0003253
745 Ga0451577_1730775
746 Ga0466969_0057345
747 Ga0466969_0058235
748 Ga0466975_0052827
749 Ga0466977_0572031
750 Ga0453683_0122182
751 Ga0466965_0116950
752 Ga0466966_0002614
753 Ga0466966_0052976
754 Ga0466966_0133716
755 Ga0466961_0013241
756 Ga0466961_0130638
757 Ga0466961_0232429
758 Ga0453684_0621602
759 Ga0466971_0461976
760 Ga0466970_0181875
761 Ga0466959_0000208
762 Ga0466959_0017154
763 Ga0451576_0627855
764 Ga0451576_1690951
765 Ga0466958_0023969
766 Ga0466958_0146680
767 Ga0466958_0312143
768 Ga0495651_0186645
769 Ga0495605_0000652
770 Ga0495584_0000495
771 Ga0495584_0002112
772 Ga0495584_0040371
773 Ga0495585_0000265
774 Ga0495596_0002995
775 Ga0495607_0004272
776 Ga0495607_0005552
777 Ga0495606_0009601
778 Ga0495606_0458902
779 Ga0495608_0511540
780 Ga0495616_0000827
781 Ga0495616_0010518
782 Ga0495616_0030497
783 Ga0495632_0035464
784 Ga0495643_0006079
785 Ga0495643_0183780
786 Ga0495666_0029017
787 Ga0495652_0023282
788 Ga0495665_0003914
789 Ga0495665_0672252
790 Ga0495609_0000731
791 Ga0495609_0019624
792 Ga0495621_0117610
793 Ga0495645_0054445
794 Ga0495633_0005157
795 Ga0495656_0044842
796 Ga0495634_0695095
797 Ga0495659_0112789
798 Ga0495661_0000894
799 Ga0495661_0008538
800 Ga0495661_0056411
801 Ga0495588_0000174
802 Ga0495588_0011414
803 Ga0495657_0555665
804 Ga0495623_0160196
805 Ga0495646_0000203
806 Ga0495624_0010461
807 Ga0495624_0447166
808 Ga0495589_0000693
809 Ga0495589_0000990
810 Ga0495660_0000157
811 Ga0495581_0016929
812 Ga0495672_0003512
813 Ga0495683_0000041
814 Ga0495687_000215
815 Ga0495687_000457
816 Ga0495687_014065
817 Ga0495687_016236
818 Ga0495677_0000259
819 Ga0495677_0000915
820 Ga0495681_0281482
821 Ga0495686_0086061
822 Ga0495686_0230498
823 Ga0495602_0183814
824 Ga0495602_0340045
825 Ga0495626_0000016
826 Ga0495626_0001380
827 Ga0496102_0198657
828 Ga0496102_0658224
829 Ga0496103_0338659
830 Ga0496104_0095244
831 Ga0496104_1386753
832 Ga0496106_0022733
833 Ga0496106_0172766
834 Ga0496107_0058584
835 Ga0496108_0858323
836 Ga0496109_0070772
837 Ga0496109_0543904
838 Ga0496110_0162034
839 Ga0496111_1073645
840 Ga0496112_0022932
841 Ga0496120_0075798
842 Ga0496125_0353145
843 Ga0501031_0284044
844 Ga0501033_0001518
845 Ga0501047_0108126
846 Ga0501067_0199869
847 Ga0501083_0012461
848 Ga0501035_0002348
849 Ga0501044_0562815
850 nmdc:mga0k408_13380_c1
851 nmdc:mga06z11_104696_c1
852 nmdc:mga06z11_228540_c1
853 nmdc:mga07m45_171316_c1
854 nmdc:mga07m45_528232_c1
855 nmdc:mga07m45_702622_c1
856 nmdc:mga05p37_66539_c1
857 nmdc:mga05p37_78_c1
858 nmdc:mga09592_869_c1
859 nmdc:mga06r32_10717_c1
860 nmdc:mga06r32_834285_c1
861 nmdc:mga0rr50_1219777_c1
862 nmdc:mga0rr50_603129_c1
863 nmdc:mga0rr50_826593_c1
864 nmdc:mga08x19_172968_c1
865 Ga0500578_0053068
866 Ga0500590_017430
867 Ga0500616_0002153
868 Ga0500645_005054
869 Ga0466962_0309554
870 2587756966
871 2643741903
872 2644256143
873 2739054614
874 2885195985
875 2904424524
876 8002871379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

151

0.81

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

141

0.79

PF18029

Glyoxalase_6

Glyoxalase-like domain

31

151

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8248 4 129
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.8186 2 128
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8183 4 129
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.8024 3 129
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.8014 3 129
ID Description Score Start End Superfamily
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8359 72 130 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8139 4 129 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8074 4 129 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8013 8 129 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7973 3 131 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0T2YNG5-F1-model_v4 Lactoylglutathione lyase 0.9737 20 135 GO:0016829
AF-A0A562PEL1-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9734 1 131 GO:0051213
AF-A0A0Q7FAU6-F1-model_v4 Lactoylglutathione lyase 0.972 1 132 GO:0016829
AF-A0A4R2W4V4-F1-model_v4 deleted 0.9707 2 132
AF-A0A7Y6QP04-F1-model_v4 VOC family protein 0.967 1 132

Map