F443829

General Info

Members Datasets Scaffolds Average Seq Length
437 267 874 190

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0423498|Ga0451577_0423498_23_673
Length 216
Sequence LARITNPPPARCSWAKTDLSIAYHDREWGVPVHDDRTLFEFLILEGAQAGLNWETILKKRENYRRAFDKFDPVKVAKYDKRKIARLLGDEGIIRNRLKIASAVQNAQAFLAVQKEFGSFDAYVWRFVHGKPLRRKSGKPVPTTTSESDALSRDLQQRGFKFVGSTICYAFMQAVGMVNDHGPKCFRHPKVAEKRKTRGSRNISRSGRQARPPMSKS

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
222 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
223 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
224 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
228 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
238 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
239 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
244 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
247 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
250 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
251 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
252 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
253 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.12
Rhizosphere 94.97
Stem 0
Stem Tuber 0
Unclassified 8.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0423498 3300042876 Bacteria 1209
2 SwRhRL3b_contig_382124 2162886006 Unclassified 962
3 LJNas_1004158 3300000546 Bacteria 1618
4 rootL2_10120384 3300003322 Bacteria 2389
5 Ga0065707_10024052 3300005295 Bacteria 1077
6 Ga0065707_10177466 3300005295 Bacteria 1441
7 Ga0070676_10420109 3300005328 Bacteria 934
8 Ga0070683_100031390 3300005329 Bacteria 4830
9 Ga0070690_100006800 3300005330 Bacteria 6504
10 Ga0070690_100119262 3300005330 Bacteria 1769
11 Ga0070670_100216951 3300005331 Unclassified 1664
12 Ga0070677_10072167 3300005333 Bacteria 1455
13 Ga0068869_100053860 3300005334 Bacteria 2926
14 Ga0068869_100091733 3300005334 Bacteria 2285
15 Ga0070680_100066443 3300005336 Unclassified 2957
16 Ga0070660_100191886 3300005339 Bacteria 1655
17 Ga0070660_100312615 3300005339 Bacteria 1289
18 Ga0070689_100055975 3300005340 Bacteria 3057
19 Ga0070689_100898358 3300005340 Bacteria 784
20 Ga0070687_100045321 3300005343 Bacteria 2245
21 Ga0070687_100346012 3300005343 Bacteria 958
22 Ga0070661_100010978 3300005344 Bacteria 6313
23 Ga0070692_10134633 3300005345 Unclassified 1392
24 Ga0070692_10330114 3300005345 Bacteria 941
25 Ga0070669_100258319 3300005353 Bacteria 1389
26 Ga0070669_100377927 3300005353 Bacteria 1155
27 Ga0070675_100264138 3300005354 Bacteria 1509
28 Ga0070673_100721594 3300005364 Unclassified 916
29 Ga0070659_100036561 3300005366 Unclassified 3828
30 Ga0070659_100147857 3300005366 Bacteria 1915
31 Ga0070659_100274204 3300005366 Bacteria 1402
32 Ga0070659_100291924 3300005366 Bacteria 1358
33 Ga0070703_10021760 3300005406 Bacteria 1877
34 Ga0070714_100764158 3300005435 Bacteria 935
35 Ga0070710_10065786 3300005437 Bacteria 2077
36 Ga0070710_10090785 3300005437 Bacteria 1801
37 Ga0070701_10154903 3300005438 Bacteria 1323
38 Ga0070711_100081006 3300005439 Bacteria 2313
39 Ga0070705_100027732 3300005440 Bacteria 3094
40 Ga0070705_100098299 3300005440 Bacteria 1841
41 Ga0070700_100028139 3300005441 Bacteria 3340
42 Ga0070700_100072257 3300005441 Bacteria 2205
43 Ga0070700_100523915 3300005441 Bacteria 916
44 Ga0070694_100009682 3300005444 Bacteria 5918
45 Ga0070694_100021139 3300005444 Bacteria 4155
46 Ga0070694_100036950 3300005444 Bacteria 3237
47 Ga0070708_100257420 3300005445 Bacteria 1640
48 Ga0070708_100387433 3300005445 Bacteria 1318
49 Ga0070678_100047451 3300005456 Bacteria 3086
50 Ga0070681_10019459 3300005458 Bacteria 6796
51 Ga0070681_10021041 3300005458 Bacteria 6536
52 Ga0070681_10646778 3300005458 Bacteria 972
53 Ga0070681_10651126 3300005458 Bacteria 968
54 Ga0068867_100209609 3300005459 Bacteria 1564
55 Ga0068867_101251771 3300005459 Bacteria 683
56 Ga0070706_100008993 3300005467 Bacteria 9299
57 Ga0070706_100029683 3300005467 Bacteria 5038
58 Ga0070706_100139254 3300005467 Bacteria 2265
59 Ga0070707_100014167 3300005468 Bacteria 7473
60 Ga0070707_100747972 3300005468 Bacteria 941
61 Ga0070707_101376361 3300005468 Bacteria 672
62 Ga0070698_100018775 3300005471 Bacteria 7278
63 Ga0070698_100336993 3300005471 Bacteria 1440
64 Ga0070699_100123614 3300005518 Bacteria 2277
65 Ga0070699_100169888 3300005518 Bacteria 1932
66 Ga0070679_100045385 3300005530 Unclassified 4379
67 Ga0070679_100277419 3300005530 Bacteria 1629
68 Ga0070684_100149911 3300005535 Bacteria 2112
69 Ga0070684_100153484 3300005535 Unclassified 2087
70 Ga0070697_100446424 3300005536 Bacteria 1126
71 Ga0070697_100838712 3300005536 Bacteria 814
72 Ga0070697_101077980 3300005536 Unclassified 715
73 Ga0068853_100033000 3300005539 Bacteria 4389
74 Ga0068853_100056272 3300005539 Bacteria 3391
75 Ga0070686_100015079 3300005544 Bacteria 4467
76 Ga0070695_100024058 3300005545 Bacteria 3750
77 Ga0070695_100120157 3300005545 Bacteria 1796
78 Ga0070695_100129812 3300005545 Bacteria 1736
79 Ga0070695_100143467 3300005545 Bacteria 1659
80 Ga0070695_100214400 3300005545 Bacteria 1384
81 Ga0070695_100345228 3300005545 Bacteria 1114
82 Ga0070696_100026707 3300005546 Bacteria 3929
83 Ga0070696_100170196 3300005546 Bacteria 1610
84 Ga0070696_100208464 3300005546 Bacteria 1462
85 Ga0070696_100323373 3300005546 Bacteria 1187
86 Ga0070693_100004623 3300005547 Bacteria 6534
87 Ga0070693_100019192 3300005547 Bacteria 3580
88 Ga0070693_100043377 3300005547 Bacteria 2539
89 Ga0070693_100055663 3300005547 Bacteria 2280
90 Ga0070693_100059603 3300005547 Bacteria 2213
91 Ga0070693_100175370 3300005547 Bacteria 1376
92 Ga0070704_100074213 3300005549 Bacteria 2480
93 Ga0070704_100281112 3300005549 Bacteria 1379
94 Ga0070704_100348176 3300005549 Bacteria 1250
95 Ga0068855_100046614 3300005563 Bacteria 5123
96 Ga0068855_100445841 3300005563 Bacteria 1413
97 Ga0070664_100003302 3300005564 Bacteria 13031
98 Ga0068857_100023275 3300005577 Bacteria 5452
99 Ga0068857_100085301 3300005577 Bacteria 2822
100 Ga0068857_100138187 3300005577 Bacteria 2201
101 Ga0068854_100060742 3300005578 Bacteria 2735
102 Ga0068856_100779317 3300005614 Bacteria 976
103 Ga0068852_100290440 3300005616 Bacteria 1579
104 Ga0068859_100005958 3300005617 Bacteria 12378
105 Ga0068859_100249671 3300005617 Bacteria 1865
106 Ga0068859_100254348 3300005617 Bacteria 1847
107 Ga0068859_100411626 3300005617 Unclassified 1448
108 Ga0068859_100619010 3300005617 Bacteria 1175
109 Ga0068864_100034770 3300005618 Unclassified 4288
110 Ga0068864_101743457 3300005618 Bacteria 628
111 Ga0068861_100013241 3300005719 Bacteria 5770
112 Ga0068861_100563131 3300005719 Bacteria 1040
113 Ga0068861_100797286 3300005719 Bacteria 886
114 Ga0068851_10001281 3300005834 Bacteria 10969
115 Ga0068870_10011501 3300005840 Bacteria 4106
116 Ga0068863_100305375 3300005841 Bacteria 1544
117 Ga0068858_100143726 3300005842 Bacteria 2240
118 Ga0068858_100611059 3300005842 Bacteria 1058
119 Ga0068860_100348812 3300005843 Bacteria 1456
120 Ga0068860_100568607 3300005843 Bacteria 1137
121 Ga0068862_100055510 3300005844 Bacteria 3393
122 Ga0068862_100314046 3300005844 Bacteria 1445
123 Ga0068862_100600706 3300005844 Bacteria 1056
124 Ga0070717_10106497 3300006028 Bacteria 2387
125 Ga0070715_10021392 3300006163 Bacteria 2508
126 Ga0070716_100003711 3300006173 Bacteria 7232
127 Ga0097621_100006382 3300006237 Bacteria 8368
128 Ga0097621_100172701 3300006237 Bacteria 1864
129 Ga0097621_100799144 3300006237 Bacteria 874
130 Ga0068871_100974019 3300006358 Unclassified 789
131 Ga0075428_100124074 3300006844 Bacteria 2811
132 Ga0075428_100131447 3300006844 Unclassified 2722
133 Ga0075428_100529194 3300006844 Bacteria 1260
134 Ga0075431_100049084 3300006847 Bacteria 4353
135 Ga0075431_100495830 3300006847 Bacteria 1213
136 Ga0075433_10032185 3300006852 Bacteria 4491
137 Ga0075433_10067511 3300006852 Bacteria 3139
138 Ga0075434_100005288 3300006871 Bacteria 11739
139 Ga0075434_100039254 3300006871 Bacteria 4691
140 Ga0075434_100111348 3300006871 Bacteria 2748
141 Ga0075429_100089820 3300006880 Bacteria 2678
142 Ga0075429_100129859 3300006880 Bacteria 2204
143 Ga0075436_100007558 3300006914 Bacteria 7424
144 Ga0075436_100020184 3300006914 Bacteria 4573
145 Ga0097620_100005958 3300006931 Bacteria 12378
146 Ga0097620_100249696 3300006931 Bacteria 1865
147 Ga0097620_100254359 3300006931 Bacteria 1847
148 Ga0097620_100411606 3300006931 Unclassified 1448
149 Ga0097620_100619001 3300006931 Bacteria 1175
150 Ga0075435_100003247 3300007076 Bacteria 11013
151 Ga0105240_10044998 3300009093 Bacteria 5602
152 Ga0105240_10061800 3300009093 Bacteria 4667
153 Ga0111539_10018502 3300009094 Bacteria 8629
154 Ga0105245_10092685 3300009098 Bacteria 2782
155 Ga0114129_10006906 3300009147 Bacteria 16149
156 Ga0114129_10020879 3300009147 Bacteria 9303
157 Ga0114129_10574791 3300009147 Bacteria 1463
158 Ga0114129_10967696 3300009147 Bacteria 1074
159 Ga0105243_10316872 3300009148 Bacteria 1420
160 Ga0105241_10016253 3300009174 Bacteria 5452
161 Ga0105241_10068791 3300009174 Unclassified 2744
162 Ga0105241_10172107 3300009174 Bacteria 1789
163 Ga0105241_11042406 3300009174 Bacteria 767
164 Ga0105242_10000013 3300009176 Bacteria 133981
165 Ga0105242_10000365 3300009176 Bacteria 36180
166 Ga0105237_10000521 3300009545 Bacteria 54240
167 Ga0105237_10004316 3300009545 Bacteria 16486
168 Ga0105237_10017713 3300009545 Bacteria 7383
169 Ga0105238_10174526 3300009551 Bacteria 2126
170 Ga0105249_10012334 3300009553 Bacteria 7530
171 Ga0105249_10138373 3300009553 Bacteria 2332
172 Ga0105249_10220733 3300009553 Unclassified 1865
173 Ga0105249_10800144 3300009553 Bacteria 1007
174 Ga0105239_10012573 3300010375 Bacteria 9423
175 Ga0105239_10031594 3300010375 Bacteria 5821
176 Ga0105239_10031857 3300010375 Bacteria 5793
177 Ga0105239_10205866 3300010375 Bacteria 2205
178 Ga0157373_10111850 3300013100 Bacteria 1920
179 Ga0157369_10108766 3300013105 Bacteria 2948
180 Ga0157369_10590192 3300013105 Bacteria 1147
181 Ga0157374_10181790 3300013296 Bacteria 2054
182 Ga0157378_10030611 3300013297 Bacteria 4755
183 Ga0157378_10179438 3300013297 Bacteria 1991
184 Ga0157378_10848312 3300013297 Bacteria 942
185 Ga0163162_10024386 3300013306 Bacteria 5969
186 Ga0163162_10048653 3300013306 Bacteria 4249
187 Ga0163162_10057585 3300013306 Bacteria 3914
188 Ga0163162_10220680 3300013306 Bacteria 2026
189 Ga0163162_10841754 3300013306 Unclassified 1033
190 Ga0157372_10001998 3300013307 Bacteria 22149
191 Ga0157372_10132506 3300013307 Bacteria 2869
192 Ga0157372_10576240 3300013307 Bacteria 1312
193 Ga0163163_10002592 3300014325 Bacteria 15319
194 Ga0157380_10014621 3300014326 Bacteria 5746
195 Ga0157380_10093583 3300014326 Bacteria 2485
196 Ga0157380_11238549 3300014326 Bacteria 791
197 Ga0157377_10046367 3300014745 Bacteria 2431
198 Ga0157376_10065468 3300014969 Bacteria 3069
199 Ga0157376_10640858 3300014969 Bacteria 1062
200 Ga0207656_10001382 3300025321 Bacteria 8008
201 Ga0207682_10055676 3300025893 Bacteria 1645
202 Ga0207692_10008559 3300025898 Bacteria 4239
203 Ga0207647_10116387 3300025904 Unclassified 1578
204 Ga0207685_10001608 3300025905 Bacteria 4831
205 Ga0207645_10085227 3300025907 Bacteria 2028
206 Ga0207643_10044527 3300025908 Bacteria 2506
207 Ga0207684_10016095 3300025910 Bacteria 6424
208 Ga0207684_10179279 3300025910 Unclassified 1826
209 Ga0207654_10211365 3300025911 Bacteria 1282
210 Ga0207654_10614005 3300025911 Bacteria 777
211 Ga0207707_10012052 3300025912 Bacteria 7518
212 Ga0207707_10029405 3300025912 Bacteria 4803
213 Ga0207707_10623900 3300025912 Bacteria 911
214 Ga0207707_11059058 3300025912 Bacteria 663
215 Ga0207695_10081365 3300025913 Bacteria 3278
216 Ga0207671_10003001 3300025914 Bacteria 17302
217 Ga0207693_10023350 3300025915 Bacteria 4911
218 Ga0207663_10043517 3300025916 Bacteria 2750
219 Ga0207660_10064723 3300025917 Unclassified 2640
220 Ga0207662_10054798 3300025918 Bacteria 2379
221 Ga0207662_10055387 3300025918 Bacteria 2366
222 Ga0207662_10399307 3300025918 Bacteria 932
223 Ga0207657_10090944 3300025919 Unclassified 2546
224 Ga0207657_10410778 3300025919 Bacteria 1064
225 Ga0207649_10056087 3300025920 Unclassified 2459
226 Ga0207652_10118243 3300025921 Unclassified 2355
227 Ga0207646_10423678 3300025922 Bacteria 1201
228 Ga0207650_10245727 3300025925 Unclassified 1447
229 Ga0207690_10028604 3300025932 Unclassified 3534
230 Ga0207690_10126257 3300025932 Bacteria 1866
231 Ga0207690_10217207 3300025932 Bacteria 1461
232 Ga0207706_10320361 3300025933 Bacteria 1349
233 Ga0207686_10000006 3300025934 Bacteria 259583
234 Ga0207709_10000037 3300025935 Bacteria 279771
235 Ga0207670_10393416 3300025936 Bacteria 1107
236 Ga0207665_10001540 3300025939 Bacteria 15502
237 Ga0207711_10077444 3300025941 Unclassified 2898
238 Ga0207661_10195115 3300025944 Bacteria 1777
239 Ga0207679_10024137 3300025945 Unclassified 4166
240 Ga0207667_10016944 3300025949 Bacteria 8220
241 Ga0207667_10147253 3300025949 Bacteria 2424
242 Ga0207651_10968829 3300025960 Unclassified 759
243 Ga0207712_10298027 3300025961 Bacteria 1322
244 Ga0207668_10561699 3300025972 Bacteria 990
245 Ga0207640_10119399 3300025981 Bacteria 1885
246 Ga0207677_10661127 3300026023 Bacteria 923
247 Ga0207703_10123132 3300026035 Bacteria 2229
248 Ga0207703_10345404 3300026035 Bacteria 1369
249 Ga0207703_10478006 3300026035 Bacteria 1167
250 Ga0207639_10025046 3300026041 Bacteria 4324
251 Ga0207639_10063950 3300026041 Bacteria 2851
252 Ga0207708_10042102 3300026075 Bacteria 3482
253 Ga0207708_10068570 3300026075 Bacteria 2715
254 Ga0207708_10124985 3300026075 Bacteria 2007
255 Ga0207702_10265026 3300026078 Bacteria 1619
256 Ga0207702_10553725 3300026078 Bacteria 1125
257 Ga0207648_10401402 3300026089 Bacteria 1242
258 Ga0207648_10488149 3300026089 Bacteria 1126
259 Ga0207648_10949423 3300026089 Bacteria 804
260 Ga0207676_10056069 3300026095 Unclassified 3096
261 Ga0207676_11059131 3300026095 Bacteria 801
262 Ga0207676_11196119 3300026095 Bacteria 753
263 Ga0207674_10000497 3300026116 Bacteria 51891
264 Ga0207674_10101833 3300026116 Bacteria 2852
265 Ga0207675_100009488 3300026118 Bacteria 9108
266 Ga0207675_100108741 3300026118 Bacteria 2615
267 Ga0207675_100207745 3300026118 Unclassified 1882
268 Ga0207683_10023716 3300026121 Bacteria 5279
269 Ga0268265_10121503 3300028380 Bacteria 2153
270 Ga0268265_10323612 3300028380 Bacteria 1397
271 Ga0268265_10750518 3300028380 Bacteria 947
272 Ga0268265_10907762 3300028380 Bacteria 865
273 Ga0268264_10043002 3300028381 Bacteria 3742
274 Ga0268264_10369105 3300028381 Unclassified 1371
275 Ga0268264_11092179 3300028381 Bacteria 806
276 Ga0307513_10031419 3300031456 Bacteria 6014
277 Ga0307408_100641041 3300031548 Bacteria 949
278 Ga0316579_10004839 3300031691 Bacteria 5384
279 Ga0316579_10154465 3300031691 Bacteria 1108
280 Ga0307406_10653843 3300031901 Bacteria 873
281 Ga0307407_11083187 3300031903 Bacteria 622
282 Ga0307416_100173070 3300032002 Bacteria 2013
283 Ga0307414_10548635 3300032004 Bacteria 1030
284 Ga0307411_10021867 3300032005 Bacteria 3754
285 Ga0316583_10010152 3300032133 Bacteria 3393
286 Ga0373926_0045023 3300035083 Unclassified 1581
287 Ga0373934_0003295 3300035086 Bacteria 5909
288 Ga0373934_0128665 3300035086 Bacteria 1032
289 Ga0373923_0025661 3300035111 Bacteria 2338
290 Ga0373945_0080052 3300035116 Bacteria 1250
291 Ga0373953_0011523 3300035117 Bacteria 3106
292 Ga0373953_0132455 3300035117 Bacteria 1063
293 Ga0373954_0208545 3300035118 Bacteria 960
294 Ga0373956_0001063 3300035119 Bacteria 11313
295 Ga0373956_0017143 3300035119 Bacteria 3051
296 Ga0373955_0001590 3300035172 Bacteria 9717
297 Ga0373955_0078996 3300035172 Bacteria 1855
298 Ga0373931_0257571 3300035691 Bacteria 1063
299 Ga0373931_0844592 3300035691 Bacteria 613
300 Ga0373935_0006604 3300035692 Bacteria 6931
301 Ga0373935_1104020 3300035692 Bacteria 590
302 Ga0373933_0000279 3300035724 Bacteria 33228
303 Ga0373933_0217704 3300035724 Bacteria 1225
304 Ga0373947_0004183 3300035725 Bacteria 8472
305 Ga0373937_0000044 3300036401 Bacteria 108016
306 Ga0373937_0172012 3300036401 Bacteria 2032
307 Ga0373925_0004045 3300037068 Bacteria 11137
308 Ga0373925_0786441 3300037068 Unclassified 785
309 Ga0395898_1306246 3300037466 Bacteria 655
310 Ga0436363_1371144 3300039450 Bacteria 1116
311 Ga0451802_0440006 3300041460 Bacteria 906
312 Ga0451807_0696336 3300041486 Bacteria 893
313 Ga0451853_2504385 3300041512 Bacteria 744
314 Ga0439446_0207796 3300042156 Bacteria 663
315 Ga0451577_0000017 3300042876 Bacteria 523453
316 Ga0453683_0300681 3300044673 Bacteria 1027
317 Ga0453683_0458999 3300044673 Bacteria 824
318 Ga0466963_0062033 3300044694 Bacteria 2500
319 Ga0466964_0062794 3300044706 Bacteria 1550
320 Ga0466957_0104010 3300044842 Bacteria 1793
321 Ga0451576_0052426 3300045051 Bacteria 4274
322 Ga0466958_0003158 3300045836 Bacteria 8479
323 Ga0495592_0001942 3300046454 Bacteria 14576
324 Ga0495629_0005616 3300046459 Bacteria 9367
325 Ga0495651_0000249 3300046462 Bacteria 41762
326 Ga0495653_0000061 3300046463 Bacteria 97733
327 Ga0495580_0000963 3300046472 Bacteria 25253
328 Ga0495582_0000443 3300046473 Bacteria 22625
329 Ga0495608_0001573 3300046511 Bacteria 16316
330 Ga0495628_0000749 3300046516 Bacteria 30049
331 Ga0495630_0014796 3300046517 Bacteria 5690
332 Ga0495666_0082382 3300046526 Bacteria 1521
333 Ga0495665_0043533 3300046531 Bacteria 2387
334 Ga0495586_0291271 3300046535 Bacteria 935
335 Ga0495587_0000135 3300046536 Bacteria 56041
336 Ga0495621_0057849 3300046539 Bacteria 1401
337 Ga0495645_0000093 3300046543 Bacteria 62632
338 Ga0495667_0000453 3300046559 Bacteria 26216
339 Ga0495667_0042804 3300046559 Bacteria 3003
340 Ga0495635_0000249 3300046663 Bacteria 34259
341 Ga0495657_0000277 3300046675 Bacteria 46246
342 Ga0495599_0000076 3300046678 Bacteria 68820
343 Ga0495623_0000019 3300046679 Bacteria 100610
344 Ga0495646_0001589 3300046680 Bacteria 13547
345 Ga0495613_0089595 3300046689 Bacteria 2229
346 Ga0495613_0223381 3300046689 Bacteria 1322
347 Ga0495600_0000701 3300046809 Bacteria 17544
348 Ga0495581_0402821 3300047315 Bacteria 798
349 Ga0495604_0000042 3300047317 Bacteria 116350
350 Ga0495674_0000518 3300047319 Bacteria 35457
351 Ga0495674_0255516 3300047319 Bacteria 1441
352 Ga0495674_0577357 3300047319 Unclassified 893
353 Ga0495672_0021359 3300047320 Bacteria 4224
354 Ga0495680_0000667 3300047322 Bacteria 38452
355 Ga0495680_0084154 3300047322 Bacteria 2397
356 Ga0495675_0006290 3300047444 Bacteria 7269
357 Ga0495684_0002547 3300047471 Bacteria 14506
358 Ga0495602_0005557 3300048088 Bacteria 13227
359 Ga0496102_0026136 3300048905 Bacteria 5203
360 Ga0496102_0124522 3300048905 Bacteria 2409
361 Ga0496103_0010941 3300048906 Bacteria 5370
362 Ga0496104_0033348 3300048907 Bacteria 4795
363 Ga0496105_0636691 3300048908 Bacteria 824
364 Ga0496106_0063590 3300048909 Bacteria 2805
365 Ga0496106_0085831 3300048909 Bacteria 2424
366 Ga0496107_0049453 3300048910 Bacteria 3030
367 Ga0496108_0062923 3300048911 Bacteria 3124
368 Ga0496108_0596709 3300048911 Bacteria 962
369 Ga0496109_0065261 3300048912 Bacteria 3332
370 Ga0496111_0011165 3300048914 Bacteria 6046
371 Ga0496112_0066209 3300048915 Bacteria 3565
372 Ga0496113_0075889 3300048916 Bacteria 2566
373 Ga0496113_0093505 3300048916 Bacteria 2321
374 Ga0496115_0159850 3300048918 Bacteria 1862
375 Ga0501290_066963 3300049513 Bacteria 589
376 Ga0501291_031874 3300049514 Bacteria 892
377 Ga0501292_001387 3300049515 Bacteria 2985
378 Ga0501293_010584 3300049516 Bacteria 799
379 Ga0501296_000584 3300049519 Bacteria 3595
380 Ga0501298_001295 3300049521 Bacteria 3663
381 Ga0501299_002142 3300049522 Bacteria 2699
382 Ga0501300_007644 3300049523 Bacteria 1585
383 Ga0501039_0032869 3300049575 Bacteria 4001
384 Ga0501068_0137368 3300049584 Bacteria 1531
385 Ga0501069_0147037 3300049585 Bacteria 1353
386 Ga0501071_0000092 3300049587 Bacteria 33638
387 Ga0501071_0355331 3300049587 Bacteria 1115
388 Ga0501072_0025083 3300049588 Bacteria 4642
389 Ga0501072_0083100 3300049588 Bacteria 2539
390 Ga0501073_0204345 3300049589 Bacteria 1366
391 Ga0501075_0018911 3300049591 Bacteria 4993
392 Ga0501075_0142314 3300049591 Bacteria 1828
393 Ga0501075_0605076 3300049591 Bacteria 836
394 Ga0501076_0243277 3300049592 Bacteria 1472
395 Ga0501198_007727 3300049649 Bacteria 1551
396 Ga0501202_011011 3300049652 Bacteria 1688
397 Ga0501209_093408 3300049656 Bacteria 877
398 Ga0501217_003889 3300049661 Bacteria 3042
399 Ga0501217_015622 3300049661 Bacteria 1732
400 Ga0501223_020068 3300049663 Bacteria 1311
401 Ga0501223_024592 3300049663 Bacteria 1172
402 Ga0501233_018492 3300049668 Bacteria 1466
403 Ga0501243_008244 3300049675 Bacteria 1605
404 Ga0501246_020981 3300049676 Bacteria 676
405 Ga0501221_038870 3300049704 Bacteria 1029
406 Ga0501225_0002719 3300049705 Bacteria 5428
407 Ga0501225_0014137 3300049705 Bacteria 2230
408 Ga0501245_005919 3300049708 Bacteria 1701
409 Ga0501080_0000479 3300049742 Bacteria 31129
410 Ga0501080_1083402 3300049742 Bacteria 692
411 Ga0501264_010491 3300049761 Bacteria 892
412 Ga0501266_001643 3300049763 Bacteria 2852
413 Ga0501279_005104 3300049775 Bacteria 1723
414 Ga0501283_002652 3300049779 Bacteria 2330
415 Ga0501212_010978 3300049851 Bacteria 1299
416 Ga0501212_025994 3300049851 Bacteria 927
417 nmdc:mga05p37_634393_c1 3300050507 Bacteria 1200
418 nmdc:mga09592_228857_c1 3300050508 Bacteria 1611
419 nmdc:mga09592_75579_c1 3300050508 Bacteria 2864
420 nmdc:mga09592_93395_c1 3300050508 Bacteria 2573
421 nmdc:mga06r32_247478_c1 3300050510 Bacteria 1770
422 nmdc:mga06r32_62573_c1 3300050510 Bacteria 3585
423 nmdc:mga06r32_780086_c1 3300050510 Bacteria 917
424 nmdc:mga08y16_43870_c1 3300050511 Bacteria 4686
425 nmdc:mga08y16_990034_c1 3300050511 Unclassified 821
426 nmdc:mga0n895_46075_c1 3300050512 Bacteria 3711
427 nmdc:mga0n895_5356_c1 3300050512 Bacteria 10699
428 nmdc:mga0rr50_8923_c1 3300050513 Bacteria 6264
429 nmdc:mga08x19_2399_c1 3300050514 Bacteria 11364
430 nmdc:mga0a205_103228_c1 3300050515 Bacteria 2750
431 nmdc:mga0a205_181495_c1 3300050515 Bacteria 1999
432 Ga0495601_0024323 3300053077 Bacteria 3730
433 Ga0495612_0000676 3300053078 Bacteria 13727
434 Ga0495619_0003024 3300053085 Bacteria 10921
435 Ga0501084_0046187 3300054114 Bacteria 3648
436 Ga0590071_071234 3300059421 Bacteria 857
437 Ga0501082_0111311 3300060353 Bacteria 2370
438 Ga0451577_0423498
439 SwRhRL3b_contig_382124
440 LJNas_1004158
441 rootL2_10120384
442 Ga0065707_10024052
443 Ga0065707_10177466
444 Ga0070676_10420109
445 Ga0070683_100031390
446 Ga0070690_100006800
447 Ga0070690_100119262
448 Ga0070670_100216951
449 Ga0070677_10072167
450 Ga0068869_100053860
451 Ga0068869_100091733
452 Ga0070680_100066443
453 Ga0070660_100191886
454 Ga0070660_100312615
455 Ga0070689_100055975
456 Ga0070689_100898358
457 Ga0070687_100045321
458 Ga0070687_100346012
459 Ga0070661_100010978
460 Ga0070692_10134633
461 Ga0070692_10330114
462 Ga0070669_100258319
463 Ga0070669_100377927
464 Ga0070675_100264138
465 Ga0070673_100721594
466 Ga0070659_100036561
467 Ga0070659_100147857
468 Ga0070659_100274204
469 Ga0070659_100291924
470 Ga0070703_10021760
471 Ga0070714_100764158
472 Ga0070710_10065786
473 Ga0070710_10090785
474 Ga0070701_10154903
475 Ga0070711_100081006
476 Ga0070705_100027732
477 Ga0070705_100098299
478 Ga0070700_100028139
479 Ga0070700_100072257
480 Ga0070700_100523915
481 Ga0070694_100009682
482 Ga0070694_100021139
483 Ga0070694_100036950
484 Ga0070708_100257420
485 Ga0070708_100387433
486 Ga0070678_100047451
487 Ga0070681_10019459
488 Ga0070681_10021041
489 Ga0070681_10646778
490 Ga0070681_10651126
491 Ga0068867_100209609
492 Ga0068867_101251771
493 Ga0070706_100008993
494 Ga0070706_100029683
495 Ga0070706_100139254
496 Ga0070707_100014167
497 Ga0070707_100747972
498 Ga0070707_101376361
499 Ga0070698_100018775
500 Ga0070698_100336993
501 Ga0070699_100123614
502 Ga0070699_100169888
503 Ga0070679_100045385
504 Ga0070679_100277419
505 Ga0070684_100149911
506 Ga0070684_100153484
507 Ga0070697_100446424
508 Ga0070697_100838712
509 Ga0070697_101077980
510 Ga0068853_100033000
511 Ga0068853_100056272
512 Ga0070686_100015079
513 Ga0070695_100024058
514 Ga0070695_100120157
515 Ga0070695_100129812
516 Ga0070695_100143467
517 Ga0070695_100214400
518 Ga0070695_100345228
519 Ga0070696_100026707
520 Ga0070696_100170196
521 Ga0070696_100208464
522 Ga0070696_100323373
523 Ga0070693_100004623
524 Ga0070693_100019192
525 Ga0070693_100043377
526 Ga0070693_100055663
527 Ga0070693_100059603
528 Ga0070693_100175370
529 Ga0070704_100074213
530 Ga0070704_100281112
531 Ga0070704_100348176
532 Ga0068855_100046614
533 Ga0068855_100445841
534 Ga0070664_100003302
535 Ga0068857_100023275
536 Ga0068857_100085301
537 Ga0068857_100138187
538 Ga0068854_100060742
539 Ga0068856_100779317
540 Ga0068852_100290440
541 Ga0068859_100005958
542 Ga0068859_100249671
543 Ga0068859_100254348
544 Ga0068859_100411626
545 Ga0068859_100619010
546 Ga0068864_100034770
547 Ga0068864_101743457
548 Ga0068861_100013241
549 Ga0068861_100563131
550 Ga0068861_100797286
551 Ga0068851_10001281
552 Ga0068870_10011501
553 Ga0068863_100305375
554 Ga0068858_100143726
555 Ga0068858_100611059
556 Ga0068860_100348812
557 Ga0068860_100568607
558 Ga0068862_100055510
559 Ga0068862_100314046
560 Ga0068862_100600706
561 Ga0070717_10106497
562 Ga0070715_10021392
563 Ga0070716_100003711
564 Ga0097621_100006382
565 Ga0097621_100172701
566 Ga0097621_100799144
567 Ga0068871_100974019
568 Ga0075428_100124074
569 Ga0075428_100131447
570 Ga0075428_100529194
571 Ga0075431_100049084
572 Ga0075431_100495830
573 Ga0075433_10032185
574 Ga0075433_10067511
575 Ga0075434_100005288
576 Ga0075434_100039254
577 Ga0075434_100111348
578 Ga0075429_100089820
579 Ga0075429_100129859
580 Ga0075436_100007558
581 Ga0075436_100020184
582 Ga0097620_100005958
583 Ga0097620_100249696
584 Ga0097620_100254359
585 Ga0097620_100411606
586 Ga0097620_100619001
587 Ga0075435_100003247
588 Ga0105240_10044998
589 Ga0105240_10061800
590 Ga0111539_10018502
591 Ga0105245_10092685
592 Ga0114129_10006906
593 Ga0114129_10020879
594 Ga0114129_10574791
595 Ga0114129_10967696
596 Ga0105243_10316872
597 Ga0105241_10016253
598 Ga0105241_10068791
599 Ga0105241_10172107
600 Ga0105241_11042406
601 Ga0105242_10000013
602 Ga0105242_10000365
603 Ga0105237_10000521
604 Ga0105237_10004316
605 Ga0105237_10017713
606 Ga0105238_10174526
607 Ga0105249_10012334
608 Ga0105249_10138373
609 Ga0105249_10220733
610 Ga0105249_10800144
611 Ga0105239_10012573
612 Ga0105239_10031594
613 Ga0105239_10031857
614 Ga0105239_10205866
615 Ga0157373_10111850
616 Ga0157369_10108766
617 Ga0157369_10590192
618 Ga0157374_10181790
619 Ga0157378_10030611
620 Ga0157378_10179438
621 Ga0157378_10848312
622 Ga0163162_10024386
623 Ga0163162_10048653
624 Ga0163162_10057585
625 Ga0163162_10220680
626 Ga0163162_10841754
627 Ga0157372_10001998
628 Ga0157372_10132506
629 Ga0157372_10576240
630 Ga0163163_10002592
631 Ga0157380_10014621
632 Ga0157380_10093583
633 Ga0157380_11238549
634 Ga0157377_10046367
635 Ga0157376_10065468
636 Ga0157376_10640858
637 Ga0207656_10001382
638 Ga0207682_10055676
639 Ga0207692_10008559
640 Ga0207647_10116387
641 Ga0207685_10001608
642 Ga0207645_10085227
643 Ga0207643_10044527
644 Ga0207684_10016095
645 Ga0207684_10179279
646 Ga0207654_10211365
647 Ga0207654_10614005
648 Ga0207707_10012052
649 Ga0207707_10029405
650 Ga0207707_10623900
651 Ga0207707_11059058
652 Ga0207695_10081365
653 Ga0207671_10003001
654 Ga0207693_10023350
655 Ga0207663_10043517
656 Ga0207660_10064723
657 Ga0207662_10054798
658 Ga0207662_10055387
659 Ga0207662_10399307
660 Ga0207657_10090944
661 Ga0207657_10410778
662 Ga0207649_10056087
663 Ga0207652_10118243
664 Ga0207646_10423678
665 Ga0207650_10245727
666 Ga0207690_10028604
667 Ga0207690_10126257
668 Ga0207690_10217207
669 Ga0207706_10320361
670 Ga0207686_10000006
671 Ga0207709_10000037
672 Ga0207670_10393416
673 Ga0207665_10001540
674 Ga0207711_10077444
675 Ga0207661_10195115
676 Ga0207679_10024137
677 Ga0207667_10016944
678 Ga0207667_10147253
679 Ga0207651_10968829
680 Ga0207712_10298027
681 Ga0207668_10561699
682 Ga0207640_10119399
683 Ga0207677_10661127
684 Ga0207703_10123132
685 Ga0207703_10345404
686 Ga0207703_10478006
687 Ga0207639_10025046
688 Ga0207639_10063950
689 Ga0207708_10042102
690 Ga0207708_10068570
691 Ga0207708_10124985
692 Ga0207702_10265026
693 Ga0207702_10553725
694 Ga0207648_10401402
695 Ga0207648_10488149
696 Ga0207648_10949423
697 Ga0207676_10056069
698 Ga0207676_11059131
699 Ga0207676_11196119
700 Ga0207674_10000497
701 Ga0207674_10101833
702 Ga0207675_100009488
703 Ga0207675_100108741
704 Ga0207675_100207745
705 Ga0207683_10023716
706 Ga0268265_10121503
707 Ga0268265_10323612
708 Ga0268265_10750518
709 Ga0268265_10907762
710 Ga0268264_10043002
711 Ga0268264_10369105
712 Ga0268264_11092179
713 Ga0307513_10031419
714 Ga0307408_100641041
715 Ga0316579_10004839
716 Ga0316579_10154465
717 Ga0307406_10653843
718 Ga0307407_11083187
719 Ga0307416_100173070
720 Ga0307414_10548635
721 Ga0307411_10021867
722 Ga0316583_10010152
723 Ga0373926_0045023
724 Ga0373934_0003295
725 Ga0373934_0128665
726 Ga0373923_0025661
727 Ga0373945_0080052
728 Ga0373953_0011523
729 Ga0373953_0132455
730 Ga0373954_0208545
731 Ga0373956_0001063
732 Ga0373956_0017143
733 Ga0373955_0001590
734 Ga0373955_0078996
735 Ga0373931_0257571
736 Ga0373931_0844592
737 Ga0373935_0006604
738 Ga0373935_1104020
739 Ga0373933_0000279
740 Ga0373933_0217704
741 Ga0373947_0004183
742 Ga0373937_0000044
743 Ga0373937_0172012
744 Ga0373925_0004045
745 Ga0373925_0786441
746 Ga0395898_1306246
747 Ga0436363_1371144
748 Ga0451802_0440006
749 Ga0451807_0696336
750 Ga0451853_2504385
751 Ga0439446_0207796
752 Ga0451577_0000017
753 Ga0453683_0300681
754 Ga0453683_0458999
755 Ga0466963_0062033
756 Ga0466964_0062794
757 Ga0466957_0104010
758 Ga0451576_0052426
759 Ga0466958_0003158
760 Ga0495592_0001942
761 Ga0495629_0005616
762 Ga0495651_0000249
763 Ga0495653_0000061
764 Ga0495580_0000963
765 Ga0495582_0000443
766 Ga0495608_0001573
767 Ga0495628_0000749
768 Ga0495630_0014796
769 Ga0495666_0082382
770 Ga0495665_0043533
771 Ga0495586_0291271
772 Ga0495587_0000135
773 Ga0495621_0057849
774 Ga0495645_0000093
775 Ga0495667_0000453
776 Ga0495667_0042804
777 Ga0495635_0000249
778 Ga0495657_0000277
779 Ga0495599_0000076
780 Ga0495623_0000019
781 Ga0495646_0001589
782 Ga0495613_0089595
783 Ga0495613_0223381
784 Ga0495600_0000701
785 Ga0495581_0402821
786 Ga0495604_0000042
787 Ga0495674_0000518
788 Ga0495674_0255516
789 Ga0495674_0577357
790 Ga0495672_0021359
791 Ga0495680_0000667
792 Ga0495680_0084154
793 Ga0495675_0006290
794 Ga0495684_0002547
795 Ga0495602_0005557
796 Ga0496102_0026136
797 Ga0496102_0124522
798 Ga0496103_0010941
799 Ga0496104_0033348
800 Ga0496105_0636691
801 Ga0496106_0063590
802 Ga0496106_0085831
803 Ga0496107_0049453
804 Ga0496108_0062923
805 Ga0496108_0596709
806 Ga0496109_0065261
807 Ga0496111_0011165
808 Ga0496112_0066209
809 Ga0496113_0075889
810 Ga0496113_0093505
811 Ga0496115_0159850
812 Ga0501290_066963
813 Ga0501291_031874
814 Ga0501292_001387
815 Ga0501293_010584
816 Ga0501296_000584
817 Ga0501298_001295
818 Ga0501299_002142
819 Ga0501300_007644
820 Ga0501039_0032869
821 Ga0501068_0137368
822 Ga0501069_0147037
823 Ga0501071_0000092
824 Ga0501071_0355331
825 Ga0501072_0025083
826 Ga0501072_0083100
827 Ga0501073_0204345
828 Ga0501075_0018911
829 Ga0501075_0142314
830 Ga0501075_0605076
831 Ga0501076_0243277
832 Ga0501198_007727
833 Ga0501202_011011
834 Ga0501209_093408
835 Ga0501217_003889
836 Ga0501217_015622
837 Ga0501223_020068
838 Ga0501223_024592
839 Ga0501233_018492
840 Ga0501243_008244
841 Ga0501246_020981
842 Ga0501221_038870
843 Ga0501225_0002719
844 Ga0501225_0014137
845 Ga0501245_005919
846 Ga0501080_0000479
847 Ga0501080_1083402
848 Ga0501264_010491
849 Ga0501266_001643
850 Ga0501279_005104
851 Ga0501283_002652
852 Ga0501212_010978
853 Ga0501212_025994
854 nmdc:mga05p37_634393_c1
855 nmdc:mga09592_228857_c1
856 nmdc:mga09592_75579_c1
857 nmdc:mga09592_93395_c1
858 nmdc:mga06r32_247478_c1
859 nmdc:mga06r32_62573_c1
860 nmdc:mga06r32_780086_c1
861 nmdc:mga08y16_43870_c1
862 nmdc:mga08y16_990034_c1
863 nmdc:mga0n895_46075_c1
864 nmdc:mga0n895_5356_c1
865 nmdc:mga0rr50_8923_c1
866 nmdc:mga08x19_2399_c1
867 nmdc:mga0a205_103228_c1
868 nmdc:mga0a205_181495_c1
869 Ga0495601_0024323
870 Ga0495612_0000676
871 Ga0495619_0003024
872 Ga0501084_0046187
873 Ga0590071_071234
874 Ga0501082_0111311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

14

187

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9521 10 185
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.952 11 185
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9467 9 185
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9394 11 185
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9169 10 185
ID Description Score Start End Superfamily
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9611 10 187 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.957 10 184 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9495 11 185 1.10.340.30
af_A0A1D6I4F4_25_202_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9237 15 186 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9207 10 187 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A1G8KV12-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9847 9 185 GO:0006284
GO:0008725
GO:0046872
AF-A0A1Q7HXB4-F1-model_v4 DNA-3-methyladenine glycosylase 0.9844 10 185 GO:0006284
GO:0008725
GO:0046872
AF-A0A7U9RZX8-F1-model_v4 DNA-3-methyladenine glycosylase 1 (EC 3.2.2.20) 0.9843 12 190 GO:0006284
GO:0008725
GO:0046872
AF-A0A1F5ANT2-F1-model_v4 DNA-3-methyladenine glycosylase 0.9832 21 186 GO:0006284
GO:0008725
GO:0046872
AF-A0A1F4CV02-F1-model_v4 DNA-3-methyladenine glycosylase 0.9829 9 190 GO:0006284
GO:0008725
GO:0046872

Map