F443457

General Info

Members Datasets Scaffolds Average Seq Length
436 143 872 101

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10035240|JGI25406J46586_100352403
Length 106
Sequence MLFGRVHGNAVCTVRYPGTEGVKFLVVQPLNKKMEPIGILQVAADVVQAGPGDLCVMVRAREAALAMKDEKFVPIDLALVGIVDELEVKPDGTFDYTLRVGQNYFT

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
105 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
106 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
107 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
133 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 2.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.94
Stem 0
Stem Tuber 0
Unclassified 36.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10035240 3300003203 Bacteria 1828
2 SwRhRL3b_contig_1194491 2162886006 Bacteria 1798
3 SwRhRL2b_contig_534714 2162886007 Bacteria 12237
4 Ga0065704_10072379 3300005289 Bacteria 8637
5 Ga0065704_10258351 3300005289 Bacteria 971
6 Ga0065712_10820439 3300005290 Unclassified 506
7 Ga0065707_10000753 3300005295 Bacteria 16597
8 Ga0065707_10098717 3300005295 Bacteria 3063
9 Ga0065707_10336210 3300005295 Unclassified 941
10 Ga0070680_100200020 3300005336 Unclassified 1685
11 Ga0070680_100507391 3300005336 Bacteria 1032
12 Ga0070689_100086464 3300005340 Bacteria 2466
13 Ga0070689_100239358 3300005340 Bacteria 1494
14 Ga0070689_100552928 3300005340 Bacteria 992
15 Ga0070687_100035544 3300005343 Bacteria 2475
16 Ga0070687_100847357 3300005343 Unclassified 651
17 Ga0070688_100822482 3300005365 Unclassified 728
18 Ga0070701_11341151 3300005438 Unclassified 512
19 Ga0070705_100598880 3300005440 Bacteria 852
20 Ga0070700_100010558 3300005441 Bacteria 5102
21 Ga0070700_101632566 3300005441 Unclassified 551
22 Ga0070694_100078183 3300005444 Bacteria 2294
23 Ga0070678_102218081 3300005456 Unclassified 521
24 Ga0070706_100259227 3300005467 Bacteria 1623
25 Ga0070706_100365785 3300005467 Bacteria 1344
26 Ga0070707_100253755 3300005468 Bacteria 1712
27 Ga0070707_101375725 3300005468 Unclassified 672
28 Ga0070698_100021465 3300005471 Bacteria 6763
29 Ga0070698_100101047 3300005471 Bacteria 2856
30 Ga0070698_100270884 3300005471 Unclassified 1630
31 Ga0070698_100478439 3300005471 Bacteria 1182
32 Ga0070698_100602008 3300005471 Bacteria 1039
33 Ga0070699_100002761 3300005518 Bacteria 15654
34 Ga0070699_100015677 3300005518 Bacteria 6508
35 Ga0070699_100230949 3300005518 Bacteria 1650
36 Ga0070699_101006807 3300005518 Unclassified 764
37 Ga0070697_100351043 3300005536 Unclassified 1274
38 Ga0070696_100382769 3300005546 Unclassified 1097
39 Ga0070696_100586936 3300005546 Unclassified 897
40 Ga0070704_100133009 3300005549 Bacteria 1931
41 Ga0070704_102034014 3300005549 Bacteria 533
42 Ga0070702_100351729 3300005615 Unclassified 1038
43 Ga0068859_100102764 3300005617 Bacteria 2916
44 Ga0068864_101824805 3300005618 Unclassified 613
45 Ga0068861_100133753 3300005719 Bacteria 2016
46 Ga0068860_100992426 3300005843 Unclassified 857
47 Ga0068862_100108665 3300005844 Bacteria 2432
48 Ga0068862_100146272 3300005844 Unclassified 2100
49 Ga0068862_100266743 3300005844 Bacteria 1565
50 Ga0081539_10015351 3300005985 Bacteria 5573
51 Ga0075427_10001016 3300006194 Bacteria 3496
52 Ga0075428_100038113 3300006844 Bacteria 5290
53 Ga0075428_100228379 3300006844 Bacteria 2009
54 Ga0075428_100454754 3300006844 Unclassified 1371
55 Ga0075430_100069822 3300006846 Bacteria 2947
56 Ga0075430_100383370 3300006846 Bacteria 1160
57 Ga0075430_101724234 3300006846 Unclassified 514
58 Ga0075431_100043810 3300006847 Bacteria 4615
59 Ga0075431_100050751 3300006847 Unclassified 4277
60 Ga0075431_100307065 3300006847 Bacteria 1602
61 Ga0075431_100609467 3300006847 Bacteria 1075
62 Ga0075433_10023157 3300006852 Bacteria 5223
63 Ga0075433_10351268 3300006852 Unclassified 1303
64 Ga0075433_11864504 3300006852 Unclassified 516
65 Ga0075434_100115698 3300006871 Bacteria 2694
66 Ga0075434_101310851 3300006871 Unclassified 735
67 Ga0075429_100001972 3300006880 Bacteria 17070
68 Ga0075429_100016448 3300006880 Bacteria 6410
69 Ga0075429_100067558 3300006880 Bacteria 3111
70 Ga0075429_100079888 3300006880 Bacteria 2851
71 Ga0075429_100529265 3300006880 Bacteria 1033
72 Ga0075429_100998924 3300006880 Bacteria 732
73 Ga0075429_101134680 3300006880 Unclassified 683
74 Ga0075436_101558096 3300006914 Bacteria 502
75 Ga0097620_100102765 3300006931 Bacteria 2916
76 Ga0111539_10304339 3300009094 Bacteria 1855
77 Ga0111539_11589350 3300009094 Unclassified 758
78 Ga0105245_10058368 3300009098 Bacteria 3473
79 Ga0114129_10059562 3300009147 Bacteria 5338
80 Ga0114129_10065190 3300009147 Bacteria 5084
81 Ga0114129_10198858 3300009147 Bacteria 2716
82 Ga0114129_10362255 3300009147 Bacteria 1918
83 Ga0114129_10707206 3300009147 Bacteria 1294
84 Ga0114129_11134174 3300009147 Unclassified 977
85 Ga0105243_10065758 3300009148 Bacteria 2914
86 Ga0105243_10096179 3300009148 Unclassified 2449
87 Ga0105243_10477654 3300009148 Unclassified 1176
88 Ga0105241_10234093 3300009174 Unclassified 1549
89 Ga0105249_10076636 3300009553 Bacteria 3100
90 Ga0105249_10097694 3300009553 Bacteria 2757
91 Ga0105249_10674757 3300009553 Bacteria 1092
92 Ga0105249_11089057 3300009553 Unclassified 869
93 Ga0105246_10524224 3300011119 Bacteria 1010
94 Ga0105246_12395338 3300011119 Unclassified 518
95 Ga0163163_11539533 3300014325 Bacteria 726
96 Ga0157380_10748944 3300014326 Unclassified 988
97 Ga0207653_10454240 3300025885 Unclassified 503
98 Ga0207684_10023203 3300025910 Bacteria 5299
99 Ga0207660_10624211 3300025917 Bacteria 878
100 Ga0207662_11010550 3300025918 Unclassified 590
101 Ga0207662_11173699 3300025918 Unclassified 546
102 Ga0207646_10176617 3300025922 Bacteria 1929
103 Ga0207646_10635069 3300025922 Unclassified 957
104 Ga0207687_10980875 3300025927 Unclassified 724
105 Ga0207709_10080835 3300025935 Bacteria 2094
106 Ga0207670_10656685 3300025936 Unclassified 865
107 Ga0207670_10819222 3300025936 Unclassified 776
108 Ga0207712_10175504 3300025961 Unclassified 1679
109 Ga0207703_12018030 3300026035 Unclassified 553
110 Ga0207708_10025625 3300026075 Unclassified 4463
111 Ga0207708_10302594 3300026075 Bacteria 1301
112 Ga0207641_12517108 3300026088 Unclassified 513
113 Ga0207676_10173492 3300026095 Bacteria 1881
114 Ga0207676_10676648 3300026095 Bacteria 998
115 Ga0207675_100047059 3300026118 Bacteria 4029
116 Ga0209999_1077068 3300027543 Unclassified 641
117 Ga0268265_10331805 3300028380 Bacteria 1382
118 Ga0268265_10409500 3300028380 Bacteria 1256
119 Ga0268265_11164642 3300028380 Bacteria 767
120 Ga0265323_10086891 3300028653 Bacteria 1050
121 Ga0265323_10114029 3300028653 Unclassified 885
122 Ga0265320_10336334 3300031240 Unclassified 667
123 Ga0265316_10472054 3300031344 Unclassified 898
124 Ga0307408_100242601 3300031548 Unclassified 1482
125 Ga0316575_10112309 3300031665 Unclassified 1112
126 Ga0316579_10006743 3300031691 Bacteria 4702
127 Ga0316579_10013135 3300031691 Unclassified 3560
128 Ga0316579_10035518 3300031691 Bacteria 2298
129 Ga0316579_10192572 3300031691 Unclassified 986
130 Ga0316579_10215560 3300031691 Bacteria 928
131 Ga0316576_10027329 3300031727 Bacteria 4011
132 Ga0316576_10056832 3300031727 Bacteria 2859
133 Ga0316576_10086644 3300031727 Bacteria 2329
134 Ga0316576_10198384 3300031727 Bacteria 1512
135 Ga0316576_10225764 3300031727 Bacteria 1408
136 Ga0316576_10383907 3300031727 Bacteria 1043
137 Ga0316576_10394866 3300031727 Bacteria 1025
138 Ga0316576_10592466 3300031727 Unclassified 810
139 Ga0316576_10907003 3300031727 Bacteria 631
140 Ga0316578_10000900 3300031728 Bacteria 11223
141 Ga0316578_10005439 3300031728 Bacteria 6176
142 Ga0316578_10011094 3300031728 Bacteria 4699
143 Ga0316578_10036752 3300031728 Bacteria 2820
144 Ga0316578_10061597 3300031728 Unclassified 2211
145 Ga0316578_10124604 3300031728 Bacteria 1549
146 Ga0316578_10226818 3300031728 Bacteria 1123
147 Ga0316578_10603596 3300031728 Unclassified 643
148 Ga0307405_11666585 3300031731 Unclassified 564
149 Ga0316577_10000901 3300031733 Bacteria 13126
150 Ga0316577_10001179 3300031733 Bacteria 12032
151 Ga0316577_10022636 3300031733 Unclassified 3490
152 Ga0316577_10037634 3300031733 Bacteria 2705
153 Ga0316577_10048984 3300031733 Bacteria 2358
154 Ga0316577_10052125 3300031733 Bacteria 2282
155 Ga0316577_10075308 3300031733 Bacteria 1884
156 Ga0316577_10093242 3300031733 Unclassified 1686
157 Ga0316577_10120958 3300031733 Bacteria 1471
158 Ga0316577_10157450 3300031733 Bacteria 1281
159 Ga0316577_10197151 3300031733 Unclassified 1138
160 Ga0316577_10264769 3300031733 Unclassified 972
161 Ga0316577_10411958 3300031733 Bacteria 768
162 Ga0316577_10469765 3300031733 Bacteria 715
163 Ga0316577_10522101 3300031733 Bacteria 675
164 Ga0307406_11334415 3300031901 Unclassified 627
165 Ga0307407_10231555 3300031903 Bacteria 1255
166 Ga0307407_10419836 3300031903 Bacteria 964
167 Ga0307412_10107205 3300031911 Unclassified 1988
168 Ga0307412_11499588 3300031911 Bacteria 613
169 Ga0307409_100743208 3300031995 Bacteria 984
170 Ga0307416_100176777 3300032002 Unclassified 1995
171 Ga0307416_102220538 3300032002 Bacteria 650
172 Ga0307414_10847062 3300032004 Unclassified 836
173 Ga0307411_10075234 3300032005 Unclassified 2305
174 Ga0307415_100017343 3300032126 Bacteria 4315
175 Ga0316585_10015158 3300032137 Bacteria 2308
176 Ga0316585_10019643 3300032137 Bacteria 2061
177 Ga0316585_10101525 3300032137 Bacteria 944
178 Ga0316585_10305503 3300032137 Unclassified 529
179 Ga0316580_10000536 3300032139 Bacteria 8816
180 Ga0316580_10228271 3300032139 Bacteria 575
181 Ga0316593_10000580 3300032168 Bacteria 6919
182 Ga0316593_10004265 3300032168 Bacteria 3655
183 Ga0316593_10005103 3300032168 Bacteria 3433
184 Ga0316593_10007088 3300032168 Bacteria 3062
185 Ga0316593_10104627 3300032168 Unclassified 1007
186 Ga0316593_10219190 3300032168 Unclassified 706
187 Ga0316596_1000673 3300033541 Bacteria 6157
188 Ga0316596_1023275 3300033541 Bacteria 1586
189 Ga0316596_1023357 3300033541 Unclassified 1584
190 Ga0316574_0006177 3300035398 Bacteria 6452
191 Ga0316574_0006979 3300035398 Bacteria 6153
192 Ga0316574_0100134 3300035398 Bacteria 1854
193 Ga0316574_0251267 3300035398 Bacteria 1130
194 Ga0316574_0294251 3300035398 Unclassified 1033
195 Ga0316574_0376009 3300035398 Bacteria 897
196 Ga0316574_0380754 3300035398 Unclassified 890
197 Ga0316574_0716775 3300035398 Unclassified 613
198 Ga0316574_0931309 3300035398 Unclassified 525
199 Ga0316582_0000134 3300036647 Bacteria 21692
200 Ga0316582_0000914 3300036647 Bacteria 12123
201 Ga0316582_0001875 3300036647 Bacteria 9550
202 Ga0316582_0020392 3300036647 Bacteria 3898
203 Ga0316582_0029369 3300036647 Unclassified 3340
204 Ga0316582_0081315 3300036647 Bacteria 2116
205 Ga0316582_0096755 3300036647 Bacteria 1950
206 Ga0316582_0176788 3300036647 Bacteria 1451
207 Ga0316582_0185057 3300036647 Bacteria 1418
208 Ga0316582_0204295 3300036647 Bacteria 1348
209 Ga0316582_0267715 3300036647 Unclassified 1172
210 Ga0316582_0349550 3300036647 Bacteria 1017
211 Ga0316582_0452134 3300036647 Bacteria 885
212 Ga0316582_0550913 3300036647 Unclassified 794
213 Ga0316582_1002679 3300036647 Unclassified 570
214 Ga0316584_0010435 3300036712 Bacteria 6490
215 Ga0316584_0011251 3300036712 Bacteria 6281
216 Ga0316584_0011297 3300036712 Bacteria 6268
217 Ga0316584_0011904 3300036712 Bacteria 6129
218 Ga0316584_0023134 3300036712 Bacteria 4538
219 Ga0316584_0074098 3300036712 Bacteria 2552
220 Ga0316584_0076837 3300036712 Bacteria 2502
221 Ga0316584_0082957 3300036712 Bacteria 2401
222 Ga0316584_0085958 3300036712 Bacteria 2355
223 Ga0316584_0090380 3300036712 Bacteria 2292
224 Ga0316584_0118547 3300036712 Bacteria 1979
225 Ga0316584_0124571 3300036712 Bacteria 1925
226 Ga0316584_0133426 3300036712 Bacteria 1854
227 Ga0316584_0241179 3300036712 Bacteria 1323
228 Ga0316584_0256007 3300036712 Bacteria 1278
229 Ga0316584_0476446 3300036712 Bacteria 880
230 Ga0316584_0548426 3300036712 Bacteria 807
231 Ga0316584_0552135 3300036712 Bacteria 804
232 Ga0316584_0614868 3300036712 Unclassified 752
233 Ga0316584_0904350 3300036712 Unclassified 594
234 Ga0316584_0938731 3300036712 Bacteria 581
235 Ga0316584_1024843 3300036712 Bacteria 550
236 Ga0316581_0007095 3300037588 Unclassified 2991
237 Ga0316581_0015977 3300037588 Bacteria 2152
238 Ga0316581_0018554 3300037588 Bacteria 2022
239 Ga0316581_0075153 3300037588 Bacteria 1038
240 Ga0316581_0077070 3300037588 Bacteria 1024
241 Ga0316581_0086522 3300037588 Bacteria 964
242 Ga0316581_0089712 3300037588 Bacteria 946
243 Ga0316581_0175122 3300037588 Unclassified 661
244 Ga0316581_0223529 3300037588 Bacteria 579
245 Ga0316581_0242673 3300037588 Bacteria 554
246 Ga0400489_12604 3300039093 Unclassified 1980
247 Ga0400489_19632 3300039093 Bacteria 2484
248 Ga0400489_28568 3300039093 Bacteria 71526
249 Ga0439433_0095631 3300041999 Bacteria 734
250 Ga0439441_023106 3300042001 Bacteria 1160
251 Ga0439446_0111039 3300042156 Bacteria 875
252 Ga0451577_0019058 3300042876 Bacteria 6316
253 Ga0451577_0023032 3300042876 Bacteria 5684
254 Ga0451577_0061771 3300042876 Bacteria 3341
255 Ga0451577_0244797 3300042876 Bacteria 1623
256 Ga0451577_0272191 3300042876 Unclassified 1534
257 Ga0451577_0414038 3300042876 Bacteria 1223
258 Ga0451577_0898961 3300042876 Unclassified 797
259 Ga0451577_1181020 3300042876 Bacteria 683
260 Ga0451577_1248130 3300042876 Bacteria 662
261 Ga0451577_1374576 3300042876 Bacteria 627
262 Ga0451577_1604200 3300042876 Bacteria 574
263 Ga0451577_1774199 3300042876 Unclassified 542
264 Ga0453683_0042030 3300044673 Bacteria 2871
265 Ga0453683_0062476 3300044673 Unclassified 2329
266 Ga0453683_0090421 3300044673 Bacteria 1919
267 Ga0453683_0101000 3300044673 Bacteria 1811
268 Ga0453683_0209661 3300044673 Unclassified 1238
269 Ga0453683_0238560 3300044673 Bacteria 1158
270 Ga0453683_0448256 3300044673 Unclassified 834
271 Ga0453683_0484480 3300044673 Unclassified 802
272 Ga0453683_0620672 3300044673 Unclassified 706
273 Ga0453684_0000047 3300044712 Bacteria 560243
274 Ga0453684_0007837 3300044712 Bacteria 19444
275 Ga0453684_0026214 3300044712 Bacteria 8431
276 Ga0453684_0028307 3300044712 Bacteria 8002
277 Ga0453684_0051824 3300044712 Bacteria 5373
278 Ga0453684_0055607 3300044712 Bacteria 5144
279 Ga0453684_0068594 3300044712 Bacteria 4502
280 Ga0453684_0132488 3300044712 Bacteria 2989
281 Ga0453684_0134876 3300044712 Unclassified 2958
282 Ga0453684_0223196 3300044712 Unclassified 2181
283 Ga0453684_0231844 3300044712 Unclassified 2131
284 Ga0453684_0260623 3300044712 Unclassified 1986
285 Ga0453684_0381314 3300044712 Unclassified 1583
286 Ga0453684_0408696 3300044712 Unclassified 1519
287 Ga0453684_0460119 3300044712 Bacteria 1415
288 Ga0453684_0569694 3300044712 Unclassified 1245
289 Ga0453684_0588035 3300044712 Unclassified 1222
290 Ga0453684_0594453 3300044712 Bacteria 1214
291 Ga0453684_0629925 3300044712 Archaea 1172
292 Ga0453684_0665723 3300044712 Bacteria 1134
293 Ga0453684_0889983 3300044712 Unclassified 954
294 Ga0453684_0912799 3300044712 Unclassified 940
295 Ga0453684_1153155 3300044712 Unclassified 816
296 Ga0453684_1361140 3300044712 Unclassified 738
297 Ga0453684_1552653 3300044712 Unclassified 681
298 Ga0453684_1902250 3300044712 Unclassified 602
299 Ga0453684_2460365 3300044712 Unclassified 515
300 Ga0451576_0004208 3300045051 Bacteria 18921
301 Ga0451576_0006799 3300045051 Bacteria 13901
302 Ga0451576_0038661 3300045051 Bacteria 5050
303 Ga0451576_0087002 3300045051 Unclassified 3250
304 Ga0451576_0314754 3300045051 Bacteria 1638
305 Ga0451576_0364839 3300045051 Unclassified 1513
306 Ga0451576_0448987 3300045051 Bacteria 1353
307 Ga0451576_1948429 3300045051 Unclassified 606
308 Ga0496104_0273836 3300048907 Unclassified 1601
309 Ga0496107_1014539 3300048910 Unclassified 602
310 Ga0496109_0167418 3300048912 Unclassified 2061
311 Ga0496110_1246477 3300048913 Unclassified 653
312 Ga0496111_0049121 3300048914 Unclassified 3042
313 Ga0496113_0697563 3300048916 Bacteria 810
314 Ga0501291_062484 3300049514 Unclassified 704
315 Ga0501292_108582 3300049515 Unclassified 556
316 Ga0501298_066222 3300049521 Unclassified 773
317 Ga0501299_149916 3300049522 Unclassified 587
318 Ga0501031_0270895 3300049568 Bacteria 1102
319 Ga0501031_0386662 3300049568 Bacteria 905
320 Ga0501031_1085414 3300049568 Unclassified 511
321 Ga0501036_0029241 3300049572 Bacteria 4658
322 Ga0501036_1417669 3300049572 Unclassified 563
323 Ga0501037_0780729 3300049573 Bacteria 632
324 Ga0501037_1122363 3300049573 Unclassified 509
325 Ga0501039_0030430 3300049575 Bacteria 4163
326 Ga0501039_0525780 3300049575 Bacteria 929
327 Ga0501039_0532157 3300049575 Bacteria 922
328 Ga0501039_0570497 3300049575 Bacteria 888
329 Ga0501039_1395663 3300049575 Unclassified 539
330 Ga0501039_1432042 3300049575 Unclassified 532
331 Ga0501040_0028364 3300049576 Bacteria 3773
332 Ga0501040_0111078 3300049576 Bacteria 1917
333 Ga0501041_0021545 3300049577 Bacteria 3861
334 Ga0501041_0052811 3300049577 Bacteria 2478
335 Ga0501041_0062856 3300049577 Unclassified 2274
336 Ga0501041_0490984 3300049577 Bacteria 781
337 Ga0501042_0029312 3300049578 Bacteria 3881
338 Ga0501042_0480840 3300049578 Bacteria 901
339 Ga0501042_0481887 3300049578 Bacteria 900
340 Ga0501046_0217189 3300049580 Bacteria 1417
341 Ga0501048_0030941 3300049582 Bacteria 3874
342 Ga0501048_0111054 3300049582 Unclassified 1936
343 Ga0501048_0150468 3300049582 Bacteria 1646
344 Ga0501068_0149465 3300049584 Bacteria 1468
345 Ga0501068_0231135 3300049584 Bacteria 1176
346 Ga0501069_0491027 3300049585 Unclassified 732
347 Ga0501070_0647092 3300049586 Unclassified 840
348 Ga0501070_1393012 3300049586 Bacteria 533
349 Ga0501071_0002599 3300049587 Bacteria 11034
350 Ga0501071_0144557 3300049587 Bacteria 1772
351 Ga0501071_0639976 3300049587 Unclassified 818
352 Ga0501071_0992167 3300049587 Unclassified 649
353 Ga0501072_0017560 3300049588 Bacteria 5500
354 Ga0501072_0025209 3300049588 Bacteria 4631
355 Ga0501072_0352707 3300049588 Bacteria 1168
356 Ga0501072_0528580 3300049588 Bacteria 932
357 Ga0501072_0825481 3300049588 Unclassified 725
358 Ga0501073_0016184 3300049589 Bacteria 5404
359 Ga0501073_0779080 3300049589 Unclassified 659
360 Ga0501073_1116575 3300049589 Unclassified 542
361 Ga0501074_0250880 3300049590 Unclassified 1258
362 Ga0501075_0007527 3300049591 Bacteria 7551
363 Ga0501075_0031649 3300049591 Bacteria 3928
364 Ga0501075_0194895 3300049591 Bacteria 1545
365 Ga0501075_0301393 3300049591 Bacteria 1221
366 Ga0501076_0010088 3300049592 Bacteria 6992
367 Ga0501076_0012836 3300049592 Bacteria 6269
368 Ga0501076_0122355 3300049592 Bacteria 2107
369 Ga0501076_0262241 3300049592 Bacteria 1415
370 Ga0501076_0406617 3300049592 Bacteria 1119
371 Ga0501076_0581906 3300049592 Bacteria 923
372 Ga0501076_0823931 3300049592 Unclassified 765
373 Ga0501077_0663934 3300049593 Unclassified 670
374 Ga0501077_1126141 3300049593 Unclassified 505
375 Ga0501227_047452 3300049665 Unclassified 1076
376 Ga0501257_075794 3300049686 Unclassified 863
377 Ga0501257_268139 3300049686 Unclassified 511
378 Ga0501079_0039552 3300049741 Bacteria 3637
379 Ga0501079_0049674 3300049741 Bacteria 3238
380 Ga0501079_0109277 3300049741 Unclassified 2148
381 Ga0501079_0507372 3300049741 Bacteria 948
382 Ga0501080_0111855 3300049742 Bacteria 2531
383 Ga0501080_0207641 3300049742 Bacteria 1796
384 Ga0501080_0813281 3300049742 Bacteria 819
385 Ga0501080_1081789 3300049742 Unclassified 693
386 Ga0501080_1591203 3300049742 Unclassified 554
387 Ga0501081_0007142 3300049743 Bacteria 7260
388 Ga0501081_0030239 3300049743 Bacteria 3665
389 Ga0501081_0146509 3300049743 Bacteria 1695
390 Ga0501081_0220276 3300049743 Unclassified 1380
391 Ga0501081_0494827 3300049743 Unclassified 911
392 Ga0501081_0628992 3300049743 Unclassified 804
393 Ga0501081_1123734 3300049743 Unclassified 595
394 Ga0501083_0235024 3300049744 Unclassified 1193
395 Ga0501083_0624854 3300049744 Bacteria 701
396 Ga0501083_0761618 3300049744 Bacteria 630
397 Ga0501283_091273 3300049779 Bacteria 584
398 Ga0501045_0092181 3300049824 Bacteria 2241
399 Ga0501045_0824540 3300049824 Bacteria 683
400 nmdc:mga05p37_3038_c1 3300050507 Bacteria 19477
401 nmdc:mga05p37_4099_c1 3300050507 Bacteria 17027
402 nmdc:mga05p37_608231_c1 3300050507 Bacteria 1232
403 nmdc:mga05p37_69367_c1 3300050507 Bacteria 4336
404 nmdc:mga05p37_855796_c1 3300050507 Unclassified 987
405 nmdc:mga09592_1684768_c1 3300050508 Unclassified 512
406 nmdc:mga09592_322523_c1 3300050508 Bacteria 1338
407 nmdc:mga09592_345271_c1 3300050508 Bacteria 1288
408 nmdc:mga09592_3566_c1 3300050508 Bacteria 12568
409 nmdc:mga09592_46400_c1 3300050508 Bacteria 3661
410 nmdc:mga09592_83128_c1 3300050508 Bacteria 2729
411 nmdc:mga0qj67_390969_c1 3300050509 Unclassified 1123
412 nmdc:mga0qj67_426841_c1 3300050509 Bacteria 1068
413 nmdc:mga0qj67_979420_c1 3300050509 Unclassified 664
414 nmdc:mga06r32_1182607_c1 3300050510 Unclassified 711
415 nmdc:mga06r32_1529057_c1 3300050510 Bacteria 607
416 nmdc:mga06r32_384421_c1 3300050510 Bacteria 1386
417 nmdc:mga06r32_52030_c1 3300050510 Unclassified 3921
418 nmdc:mga06r32_539977_c1 3300050510 Bacteria 1140
419 nmdc:mga0n895_98817_c1 3300050512 Bacteria 2926
420 nmdc:mga0a205_29290_c1 3300050515 Bacteria 5268
421 nmdc:mga0a205_529555_c1 3300050515 Unclassified 1034
422 nmdc:mga0a205_83689_c1 3300050515 Bacteria 3081
423 Ga0501084_0022247 3300054114 Bacteria 5290
424 Ga0501084_0160988 3300054114 Bacteria 1893
425 Ga0501084_0243098 3300054114 Unclassified 1519
426 Ga0501082_0135815 3300060353 Bacteria 2134
427 Ga0501082_0351631 3300060353 Bacteria 1285
428 Ga0501082_0409287 3300060353 Unclassified 1184
429 Ga0501082_0518142 3300060353 Unclassified 1042
430 Ga0501082_0782086 3300060353 Bacteria 835
431 Ga0501082_1400197 3300060353 Unclassified 611
432 Ga0501082_1421080 3300060353 Unclassified 606
433 Ga0530510_0021630 3300061734 Bacteria 4576
434 Ga0530510_0033406 3300061734 Bacteria 3704
435 Ga0530510_0693457 3300061734 Bacteria 776
436 Ga0530510_1428445 3300061734 Unclassified 531
437 JGI25406J46586_10035240
438 SwRhRL3b_contig_1194491
439 SwRhRL2b_contig_534714
440 Ga0065704_10072379
441 Ga0065704_10258351
442 Ga0065712_10820439
443 Ga0065707_10000753
444 Ga0065707_10098717
445 Ga0065707_10336210
446 Ga0070680_100200020
447 Ga0070680_100507391
448 Ga0070689_100086464
449 Ga0070689_100239358
450 Ga0070689_100552928
451 Ga0070687_100035544
452 Ga0070687_100847357
453 Ga0070688_100822482
454 Ga0070701_11341151
455 Ga0070705_100598880
456 Ga0070700_100010558
457 Ga0070700_101632566
458 Ga0070694_100078183
459 Ga0070678_102218081
460 Ga0070706_100259227
461 Ga0070706_100365785
462 Ga0070707_100253755
463 Ga0070707_101375725
464 Ga0070698_100021465
465 Ga0070698_100101047
466 Ga0070698_100270884
467 Ga0070698_100478439
468 Ga0070698_100602008
469 Ga0070699_100002761
470 Ga0070699_100015677
471 Ga0070699_100230949
472 Ga0070699_101006807
473 Ga0070697_100351043
474 Ga0070696_100382769
475 Ga0070696_100586936
476 Ga0070704_100133009
477 Ga0070704_102034014
478 Ga0070702_100351729
479 Ga0068859_100102764
480 Ga0068864_101824805
481 Ga0068861_100133753
482 Ga0068860_100992426
483 Ga0068862_100108665
484 Ga0068862_100146272
485 Ga0068862_100266743
486 Ga0081539_10015351
487 Ga0075427_10001016
488 Ga0075428_100038113
489 Ga0075428_100228379
490 Ga0075428_100454754
491 Ga0075430_100069822
492 Ga0075430_100383370
493 Ga0075430_101724234
494 Ga0075431_100043810
495 Ga0075431_100050751
496 Ga0075431_100307065
497 Ga0075431_100609467
498 Ga0075433_10023157
499 Ga0075433_10351268
500 Ga0075433_11864504
501 Ga0075434_100115698
502 Ga0075434_101310851
503 Ga0075429_100001972
504 Ga0075429_100016448
505 Ga0075429_100067558
506 Ga0075429_100079888
507 Ga0075429_100529265
508 Ga0075429_100998924
509 Ga0075429_101134680
510 Ga0075436_101558096
511 Ga0097620_100102765
512 Ga0111539_10304339
513 Ga0111539_11589350
514 Ga0105245_10058368
515 Ga0114129_10059562
516 Ga0114129_10065190
517 Ga0114129_10198858
518 Ga0114129_10362255
519 Ga0114129_10707206
520 Ga0114129_11134174
521 Ga0105243_10065758
522 Ga0105243_10096179
523 Ga0105243_10477654
524 Ga0105241_10234093
525 Ga0105249_10076636
526 Ga0105249_10097694
527 Ga0105249_10674757
528 Ga0105249_11089057
529 Ga0105246_10524224
530 Ga0105246_12395338
531 Ga0163163_11539533
532 Ga0157380_10748944
533 Ga0207653_10454240
534 Ga0207684_10023203
535 Ga0207660_10624211
536 Ga0207662_11010550
537 Ga0207662_11173699
538 Ga0207646_10176617
539 Ga0207646_10635069
540 Ga0207687_10980875
541 Ga0207709_10080835
542 Ga0207670_10656685
543 Ga0207670_10819222
544 Ga0207712_10175504
545 Ga0207703_12018030
546 Ga0207708_10025625
547 Ga0207708_10302594
548 Ga0207641_12517108
549 Ga0207676_10173492
550 Ga0207676_10676648
551 Ga0207675_100047059
552 Ga0209999_1077068
553 Ga0268265_10331805
554 Ga0268265_10409500
555 Ga0268265_11164642
556 Ga0265323_10086891
557 Ga0265323_10114029
558 Ga0265320_10336334
559 Ga0265316_10472054
560 Ga0307408_100242601
561 Ga0316575_10112309
562 Ga0316579_10006743
563 Ga0316579_10013135
564 Ga0316579_10035518
565 Ga0316579_10192572
566 Ga0316579_10215560
567 Ga0316576_10027329
568 Ga0316576_10056832
569 Ga0316576_10086644
570 Ga0316576_10198384
571 Ga0316576_10225764
572 Ga0316576_10383907
573 Ga0316576_10394866
574 Ga0316576_10592466
575 Ga0316576_10907003
576 Ga0316578_10000900
577 Ga0316578_10005439
578 Ga0316578_10011094
579 Ga0316578_10036752
580 Ga0316578_10061597
581 Ga0316578_10124604
582 Ga0316578_10226818
583 Ga0316578_10603596
584 Ga0307405_11666585
585 Ga0316577_10000901
586 Ga0316577_10001179
587 Ga0316577_10022636
588 Ga0316577_10037634
589 Ga0316577_10048984
590 Ga0316577_10052125
591 Ga0316577_10075308
592 Ga0316577_10093242
593 Ga0316577_10120958
594 Ga0316577_10157450
595 Ga0316577_10197151
596 Ga0316577_10264769
597 Ga0316577_10411958
598 Ga0316577_10469765
599 Ga0316577_10522101
600 Ga0307406_11334415
601 Ga0307407_10231555
602 Ga0307407_10419836
603 Ga0307412_10107205
604 Ga0307412_11499588
605 Ga0307409_100743208
606 Ga0307416_100176777
607 Ga0307416_102220538
608 Ga0307414_10847062
609 Ga0307411_10075234
610 Ga0307415_100017343
611 Ga0316585_10015158
612 Ga0316585_10019643
613 Ga0316585_10101525
614 Ga0316585_10305503
615 Ga0316580_10000536
616 Ga0316580_10228271
617 Ga0316593_10000580
618 Ga0316593_10004265
619 Ga0316593_10005103
620 Ga0316593_10007088
621 Ga0316593_10104627
622 Ga0316593_10219190
623 Ga0316596_1000673
624 Ga0316596_1023275
625 Ga0316596_1023357
626 Ga0316574_0006177
627 Ga0316574_0006979
628 Ga0316574_0100134
629 Ga0316574_0251267
630 Ga0316574_0294251
631 Ga0316574_0376009
632 Ga0316574_0380754
633 Ga0316574_0716775
634 Ga0316574_0931309
635 Ga0316582_0000134
636 Ga0316582_0000914
637 Ga0316582_0001875
638 Ga0316582_0020392
639 Ga0316582_0029369
640 Ga0316582_0081315
641 Ga0316582_0096755
642 Ga0316582_0176788
643 Ga0316582_0185057
644 Ga0316582_0204295
645 Ga0316582_0267715
646 Ga0316582_0349550
647 Ga0316582_0452134
648 Ga0316582_0550913
649 Ga0316582_1002679
650 Ga0316584_0010435
651 Ga0316584_0011251
652 Ga0316584_0011297
653 Ga0316584_0011904
654 Ga0316584_0023134
655 Ga0316584_0074098
656 Ga0316584_0076837
657 Ga0316584_0082957
658 Ga0316584_0085958
659 Ga0316584_0090380
660 Ga0316584_0118547
661 Ga0316584_0124571
662 Ga0316584_0133426
663 Ga0316584_0241179
664 Ga0316584_0256007
665 Ga0316584_0476446
666 Ga0316584_0548426
667 Ga0316584_0552135
668 Ga0316584_0614868
669 Ga0316584_0904350
670 Ga0316584_0938731
671 Ga0316584_1024843
672 Ga0316581_0007095
673 Ga0316581_0015977
674 Ga0316581_0018554
675 Ga0316581_0075153
676 Ga0316581_0077070
677 Ga0316581_0086522
678 Ga0316581_0089712
679 Ga0316581_0175122
680 Ga0316581_0223529
681 Ga0316581_0242673
682 Ga0400489_12604
683 Ga0400489_19632
684 Ga0400489_28568
685 Ga0439433_0095631
686 Ga0439441_023106
687 Ga0439446_0111039
688 Ga0451577_0019058
689 Ga0451577_0023032
690 Ga0451577_0061771
691 Ga0451577_0244797
692 Ga0451577_0272191
693 Ga0451577_0414038
694 Ga0451577_0898961
695 Ga0451577_1181020
696 Ga0451577_1248130
697 Ga0451577_1374576
698 Ga0451577_1604200
699 Ga0451577_1774199
700 Ga0453683_0042030
701 Ga0453683_0062476
702 Ga0453683_0090421
703 Ga0453683_0101000
704 Ga0453683_0209661
705 Ga0453683_0238560
706 Ga0453683_0448256
707 Ga0453683_0484480
708 Ga0453683_0620672
709 Ga0453684_0000047
710 Ga0453684_0007837
711 Ga0453684_0026214
712 Ga0453684_0028307
713 Ga0453684_0051824
714 Ga0453684_0055607
715 Ga0453684_0068594
716 Ga0453684_0132488
717 Ga0453684_0134876
718 Ga0453684_0223196
719 Ga0453684_0231844
720 Ga0453684_0260623
721 Ga0453684_0381314
722 Ga0453684_0408696
723 Ga0453684_0460119
724 Ga0453684_0569694
725 Ga0453684_0588035
726 Ga0453684_0594453
727 Ga0453684_0629925
728 Ga0453684_0665723
729 Ga0453684_0889983
730 Ga0453684_0912799
731 Ga0453684_1153155
732 Ga0453684_1361140
733 Ga0453684_1552653
734 Ga0453684_1902250
735 Ga0453684_2460365
736 Ga0451576_0004208
737 Ga0451576_0006799
738 Ga0451576_0038661
739 Ga0451576_0087002
740 Ga0451576_0314754
741 Ga0451576_0364839
742 Ga0451576_0448987
743 Ga0451576_1948429
744 Ga0496104_0273836
745 Ga0496107_1014539
746 Ga0496109_0167418
747 Ga0496110_1246477
748 Ga0496111_0049121
749 Ga0496113_0697563
750 Ga0501291_062484
751 Ga0501292_108582
752 Ga0501298_066222
753 Ga0501299_149916
754 Ga0501031_0270895
755 Ga0501031_0386662
756 Ga0501031_1085414
757 Ga0501036_0029241
758 Ga0501036_1417669
759 Ga0501037_0780729
760 Ga0501037_1122363
761 Ga0501039_0030430
762 Ga0501039_0525780
763 Ga0501039_0532157
764 Ga0501039_0570497
765 Ga0501039_1395663
766 Ga0501039_1432042
767 Ga0501040_0028364
768 Ga0501040_0111078
769 Ga0501041_0021545
770 Ga0501041_0052811
771 Ga0501041_0062856
772 Ga0501041_0490984
773 Ga0501042_0029312
774 Ga0501042_0480840
775 Ga0501042_0481887
776 Ga0501046_0217189
777 Ga0501048_0030941
778 Ga0501048_0111054
779 Ga0501048_0150468
780 Ga0501068_0149465
781 Ga0501068_0231135
782 Ga0501069_0491027
783 Ga0501070_0647092
784 Ga0501070_1393012
785 Ga0501071_0002599
786 Ga0501071_0144557
787 Ga0501071_0639976
788 Ga0501071_0992167
789 Ga0501072_0017560
790 Ga0501072_0025209
791 Ga0501072_0352707
792 Ga0501072_0528580
793 Ga0501072_0825481
794 Ga0501073_0016184
795 Ga0501073_0779080
796 Ga0501073_1116575
797 Ga0501074_0250880
798 Ga0501075_0007527
799 Ga0501075_0031649
800 Ga0501075_0194895
801 Ga0501075_0301393
802 Ga0501076_0010088
803 Ga0501076_0012836
804 Ga0501076_0122355
805 Ga0501076_0262241
806 Ga0501076_0406617
807 Ga0501076_0581906
808 Ga0501076_0823931
809 Ga0501077_0663934
810 Ga0501077_1126141
811 Ga0501227_047452
812 Ga0501257_075794
813 Ga0501257_268139
814 Ga0501079_0039552
815 Ga0501079_0049674
816 Ga0501079_0109277
817 Ga0501079_0507372
818 Ga0501080_0111855
819 Ga0501080_0207641
820 Ga0501080_0813281
821 Ga0501080_1081789
822 Ga0501080_1591203
823 Ga0501081_0007142
824 Ga0501081_0030239
825 Ga0501081_0146509
826 Ga0501081_0220276
827 Ga0501081_0494827
828 Ga0501081_0628992
829 Ga0501081_1123734
830 Ga0501083_0235024
831 Ga0501083_0624854
832 Ga0501083_0761618
833 Ga0501283_091273
834 Ga0501045_0092181
835 Ga0501045_0824540
836 nmdc:mga05p37_3038_c1
837 nmdc:mga05p37_4099_c1
838 nmdc:mga05p37_608231_c1
839 nmdc:mga05p37_69367_c1
840 nmdc:mga05p37_855796_c1
841 nmdc:mga09592_1684768_c1
842 nmdc:mga09592_322523_c1
843 nmdc:mga09592_345271_c1
844 nmdc:mga09592_3566_c1
845 nmdc:mga09592_46400_c1
846 nmdc:mga09592_83128_c1
847 nmdc:mga0qj67_390969_c1
848 nmdc:mga0qj67_426841_c1
849 nmdc:mga0qj67_979420_c1
850 nmdc:mga06r32_1182607_c1
851 nmdc:mga06r32_1529057_c1
852 nmdc:mga06r32_384421_c1
853 nmdc:mga06r32_52030_c1
854 nmdc:mga06r32_539977_c1
855 nmdc:mga0n895_98817_c1
856 nmdc:mga0a205_29290_c1
857 nmdc:mga0a205_529555_c1
858 nmdc:mga0a205_83689_c1
859 Ga0501084_0022247
860 Ga0501084_0160988
861 Ga0501084_0243098
862 Ga0501082_0135815
863 Ga0501082_0351631
864 Ga0501082_0409287
865 Ga0501082_0518142
866 Ga0501082_0782086
867 Ga0501082_1400197
868 Ga0501082_1421080
869 Ga0530510_0021630
870 Ga0530510_0033406
871 Ga0530510_0693457
872 Ga0530510_1428445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

1

84

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z9h-assembly1.cif.gz_A ethanolamine utilization protein, eutn 0.8747 1 85
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8608 1 87
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8587 1 87
4jw0-assembly1.cif.gz_E structure of gloeobacter violaceus ccml 0.8536 1 88
4i7a-assembly1.cif.gz_C grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8529 1 87
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8587 1 87 2.40.50.220
2rcfD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8426 1 85 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8394 1 87 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.833 1 91 2.40.50.220
2rcfD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.823 1 85 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A0R1TCD0-F1-model_v4 deleted 0.9479 26 87
AF-A0A7C7WSX6-F1-model_v4 Ethanolamine utilization protein EutN 0.9264 21 84 GO:0031469
AF-A0A2N9N6U8-F1-model_v4 Ethanolamine utilization protein EutN/carboxysome structural protein Ccml 0.9234 19 85 GO:0031469
AF-A0A6L7W7Q3-F1-model_v4 Ethanolamine utilization protein EutN 0.9203 20 85 GO:0031469
AF-X1B477-F1-model_v4 Ethanolamine utilization protein EutN 0.9097 1 83 GO:0031469

Map