F443289

General Info

Members Datasets Scaffolds Average Seq Length
435 191 435 161

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100781208|Ga0068864_1007812082
Length 194
Sequence LRAVGCRSAILRNGSLSSNAIFKSIRRISGAVIDRMEQIAWILWLILGVALIIAEVFTLGFVLFWFGIGALAAALAGFIGAGPVWQFLVFFVVSGSLTAMSRTIFARYLPHNEGDGIKTGVDSLPGQVGTVTTPSKGALQEGAVKVFGSTWTAFPEDGETDLIEGEKVEVVRVKGSSIYVRRVTHELPEWRQES

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
178 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
179 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
187 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1010433 3300000546 Bacteria 990
2 Ga0065704_10083236 3300005289 Unclassified 3491
3 Ga0065704_10129875 3300005289 Bacteria 1609
4 Ga0065704_10166086 3300005289 Bacteria 1321
5 Ga0065707_10089158 3300005295 Bacteria 4451
6 Ga0065707_10090182 3300005295 Unclassified 4194
7 Ga0070658_10181881 3300005327 Bacteria 1769
8 Ga0070676_10156479 3300005328 Unclassified 1463
9 Ga0070683_100573396 3300005329 Bacteria 1079
10 Ga0070683_101436081 3300005329 Unclassified 663
11 Ga0070690_100001233 3300005330 Bacteria 13254
12 Ga0070690_100009096 3300005330 Bacteria 5746
13 Ga0070690_100125961 3300005330 Bacteria 1724
14 Ga0070690_100723617 3300005330 Unclassified 766
15 Ga0070690_100769506 3300005330 Unclassified 744
16 Ga0070670_100016547 3300005331 Bacteria 6330
17 Ga0070670_100502780 3300005331 Bacteria 1078
18 Ga0070670_101252238 3300005331 Bacteria 678
19 Ga0070677_10096727 3300005333 Bacteria 1294
20 Ga0070677_10477420 3300005333 Bacteria 672
21 Ga0070677_10510281 3300005333 Bacteria 653
22 Ga0068869_100013417 3300005334 Bacteria 5449
23 Ga0068869_100111806 3300005334 Unclassified 2079
24 Ga0068869_100222176 3300005334 Bacteria 1498
25 Ga0068869_100440523 3300005334 Bacteria 1078
26 Ga0068869_100821840 3300005334 Unclassified 800
27 Ga0070666_10005797 3300005335 Bacteria 7590
28 Ga0070666_11104889 3300005335 Unclassified 589
29 Ga0070680_100058745 3300005336 Bacteria 3146
30 Ga0070680_100164589 3300005336 Bacteria 1865
31 Ga0068868_100144713 3300005338 Bacteria 1954
32 Ga0070660_100013184 3300005339 Bacteria 5923
33 Ga0070691_10150104 3300005341 Unclassified 1194
34 Ga0070687_100035263 3300005343 Unclassified 2482
35 Ga0070661_100022451 3300005344 Bacteria 4518
36 Ga0070661_100411591 3300005344 Bacteria 1071
37 Ga0070692_10353940 3300005345 Bacteria 913
38 Ga0070668_100286796 3300005347 Bacteria 1377
39 Ga0070669_100018358 3300005353 Unclassified 4999
40 Ga0070669_100052083 3300005353 Bacteria 2993
41 Ga0070669_101134951 3300005353 Bacteria 674
42 Ga0070669_101258889 3300005353 Unclassified 640
43 Ga0070675_100428503 3300005354 Bacteria 1184
44 Ga0070671_100009114 3300005355 Bacteria 7968
45 Ga0070671_100034598 3300005355 Bacteria 4182
46 Ga0070671_100137302 3300005355 Bacteria 2061
47 Ga0070671_100240232 3300005355 Bacteria 1537
48 Ga0070671_100711659 3300005355 Bacteria 872
49 Ga0070673_101005170 3300005364 Bacteria 777
50 Ga0070673_101607516 3300005364 Bacteria 614
51 Ga0070688_100211596 3300005365 Bacteria 1361
52 Ga0070688_101165405 3300005365 Bacteria 618
53 Ga0070659_100002308 3300005366 Bacteria 13579
54 Ga0070659_100488179 3300005366 Bacteria 1049
55 Ga0070667_100043701 3300005367 Bacteria 3761
56 Ga0070667_100105486 3300005367 Bacteria 2438
57 Ga0070667_100440616 3300005367 Bacteria 1189
58 Ga0070703_10300097 3300005406 Bacteria 669
59 Ga0070701_10039378 3300005438 Bacteria 2397
60 Ga0070701_10068623 3300005438 Unclassified 1889
61 Ga0070701_10125214 3300005438 Bacteria 1453
62 Ga0070701_10625515 3300005438 Unclassified 716
63 Ga0070700_100206000 3300005441 Bacteria 1385
64 Ga0070694_100019996 3300005444 Bacteria 4264
65 Ga0070694_100107471 3300005444 Unclassified 1983
66 Ga0070694_100150309 3300005444 Bacteria 1700
67 Ga0070694_100228557 3300005444 Unclassified 1399
68 Ga0070694_100886364 3300005444 Unclassified 736
69 Ga0070708_100339041 3300005445 Bacteria 1417
70 Ga0070663_100037986 3300005455 Bacteria 3356
71 Ga0070663_100817513 3300005455 Unclassified 800
72 Ga0070678_100417031 3300005456 Bacteria 1169
73 Ga0070678_100674880 3300005456 Bacteria 929
74 Ga0070662_100028471 3300005457 Bacteria 3888
75 Ga0070662_100048132 3300005457 Bacteria 3070
76 Ga0070662_100061700 3300005457 Bacteria 2737
77 Ga0070662_100651372 3300005457 Bacteria 888
78 Ga0070681_10027145 3300005458 Bacteria 5756
79 Ga0070681_10103147 3300005458 Bacteria 2797
80 Ga0070681_10760046 3300005458 Bacteria 886
81 Ga0070685_10140324 3300005466 Bacteria 1520
82 Ga0070698_100477003 3300005471 Bacteria 1184
83 Ga0070699_100019154 3300005518 Bacteria 5888
84 Ga0070679_100039152 3300005530 Bacteria 4712
85 Ga0070679_100062682 3300005530 Bacteria 3707
86 Ga0070679_100074406 3300005530 Bacteria 3388
87 Ga0070684_100276948 3300005535 Bacteria 1536
88 Ga0068853_100001559 3300005539 Bacteria 16683
89 Ga0068853_100315447 3300005539 Bacteria 1448
90 Ga0068853_101010535 3300005539 Bacteria 801
91 Ga0070672_100099490 3300005543 Unclassified 2357
92 Ga0070672_100792243 3300005543 Bacteria 834
93 Ga0070695_100063600 3300005545 Bacteria 2399
94 Ga0070696_100094749 3300005546 Bacteria 2131
95 Ga0070696_101064978 3300005546 Unclassified 678
96 Ga0070693_100292057 3300005547 Bacteria 1096
97 Ga0070693_100689209 3300005547 Bacteria 747
98 Ga0070704_100049100 3300005549 Unclassified 2958
99 Ga0070704_100814231 3300005549 Bacteria 835
100 Ga0068855_100052046 3300005563 Bacteria 4821
101 Ga0068855_100117578 3300005563 Bacteria 3046
102 Ga0070664_100004272 3300005564 Bacteria 11488
103 Ga0070664_100058465 3300005564 Bacteria 3279
104 Ga0070664_100109770 3300005564 Bacteria 2406
105 Ga0070664_100121377 3300005564 Bacteria 2289
106 Ga0070664_100126497 3300005564 Bacteria 2242
107 Ga0070664_102268285 3300005564 Unclassified 515
108 Ga0068857_100047657 3300005577 Bacteria 3805
109 Ga0068857_100114742 3300005577 Bacteria 2423
110 Ga0068857_101297125 3300005577 Bacteria 707
111 Ga0068854_100031610 3300005578 Bacteria 3680
112 Ga0068854_100080734 3300005578 Bacteria 2400
113 Ga0068854_100309016 3300005578 Bacteria 1282
114 Ga0068854_100413542 3300005578 Bacteria 1119
115 Ga0068856_100643550 3300005614 Bacteria 1081
116 Ga0070702_100146840 3300005615 Bacteria 1509
117 Ga0070702_100269123 3300005615 Bacteria 1164
118 Ga0068852_100137702 3300005616 Bacteria 2255
119 Ga0068859_100004126 3300005617 Bacteria 14825
120 Ga0068859_100096363 3300005617 Bacteria 3011
121 Ga0068859_100252083 3300005617 Bacteria 1856
122 Ga0068864_100028509 3300005618 Bacteria 4720
123 Ga0068864_100060865 3300005618 Bacteria 3269
124 Ga0068864_100781208 3300005618 Bacteria 937
125 Ga0068864_100788317 3300005618 Unclassified 933
126 Ga0068864_101131098 3300005618 Unclassified 780
127 Ga0068861_100057135 3300005719 Bacteria 2980
128 Ga0068861_100114791 3300005719 Bacteria 2163
129 Ga0068861_101580222 3300005719 Bacteria 646
130 Ga0068863_100021488 3300005841 Bacteria 6158
131 Ga0068863_100049862 3300005841 Bacteria 3970
132 Ga0068863_100187263 3300005841 Bacteria 1988
133 Ga0068863_100963072 3300005841 Unclassified 855
134 Ga0068863_101445708 3300005841 Bacteria 696
135 Ga0068863_101937056 3300005841 Bacteria 599
136 Ga0068858_100026365 3300005842 Bacteria 5402
137 Ga0068858_100390534 3300005842 Bacteria 1336
138 Ga0068860_100264044 3300005843 Bacteria 1679
139 Ga0068860_100647912 3300005843 Unclassified 1064
140 Ga0068860_101088029 3300005843 Unclassified 819
141 Ga0068862_100003012 3300005844 Bacteria 14692
142 Ga0068862_100065426 3300005844 Unclassified 3131
143 Ga0068862_100078555 3300005844 Bacteria 2859
144 Ga0068862_100618602 3300005844 Unclassified 1042
145 Ga0068862_100622412 3300005844 Bacteria 1039
146 Ga0068862_100816248 3300005844 Bacteria 912
147 Ga0097621_100026092 3300006237 Bacteria 4580
148 Ga0097621_100135545 3300006237 Bacteria 2099
149 Ga0068871_100054989 3300006358 Bacteria 3231
150 Ga0068871_100158800 3300006358 Viruses 1932
151 Ga0068871_100171983 3300006358 Unclassified 1858
152 Ga0075428_100702934 3300006844 Bacteria 1077
153 Ga0075429_100155601 3300006880 Bacteria 2002
154 Ga0068865_100091964 3300006881 Bacteria 2203
155 Ga0097620_100004124 3300006931 Bacteria 14825
156 Ga0097620_100096356 3300006931 Bacteria 3011
157 Ga0097620_100252085 3300006931 Bacteria 1856
158 Ga0105240_10087788 3300009093 Bacteria 3807
159 Ga0111539_10037504 3300009094 Bacteria 5852
160 Ga0111539_10185549 3300009094 Bacteria 2429
161 Ga0111539_10224219 3300009094 Bacteria 2189
162 Ga0111539_10493646 3300009094 Bacteria 1426
163 Ga0105247_10004966 3300009101 Bacteria 8457
164 Ga0105247_10188412 3300009101 Bacteria 1380
165 Ga0105247_10208395 3300009101 Bacteria 1317
166 Ga0114129_10222326 3300009147 Bacteria 2546
167 Ga0105243_10603504 3300009148 Bacteria 1057
168 Ga0105243_10898005 3300009148 Bacteria 881
169 Ga0105241_10011997 3300009174 Bacteria 6363
170 Ga0105241_10022935 3300009174 Unclassified 4627
171 Ga0105241_10077417 3300009174 Bacteria 2596
172 Ga0105241_10112166 3300009174 Bacteria 2184
173 Ga0105242_10064395 3300009176 Bacteria 3022
174 Ga0105242_10377097 3300009176 Bacteria 1317
175 Ga0105242_10604785 3300009176 Bacteria 1060
176 Ga0105242_11677202 3300009176 Unclassified 671
177 Ga0105248_10033625 3300009177 Bacteria 5728
178 Ga0105248_10145525 3300009177 Bacteria 2674
179 Ga0105248_10192781 3300009177 Bacteria 2296
180 Ga0105248_10246879 3300009177 Bacteria 2009
181 Ga0105248_10840996 3300009177 Bacteria 1036
182 Ga0105248_11043576 3300009177 Bacteria 923
183 Ga0105237_10493519 3300009545 Bacteria 1231
184 Ga0105249_10002936 3300009553 Bacteria 14709
185 Ga0105249_10028573 3300009553 Bacteria 5034
186 Ga0105249_10036062 3300009553 Bacteria 4486
187 Ga0105249_10242059 3300009553 Unclassified 1784
188 Ga0105239_10623691 3300010375 Bacteria 1231
189 Ga0105246_11866683 3300011119 Unclassified 576
190 Ga0157373_10030875 3300013100 Bacteria 3855
191 Ga0157373_10791384 3300013100 Bacteria 699
192 Ga0157370_10285435 3300013104 Bacteria 1525
193 Ga0157370_10390453 3300013104 Bacteria 1281
194 Ga0157369_10288194 3300013105 Bacteria 1709
195 Ga0157374_10054334 3300013296 Bacteria 3736
196 Ga0157374_11004450 3300013296 Bacteria 853
197 Ga0157378_10010386 3300013297 Bacteria 8130
198 Ga0157378_10049536 3300013297 Bacteria 3738
199 Ga0157378_10151474 3300013297 Bacteria 2161
200 Ga0157378_10452588 3300013297 Bacteria 1274
201 Ga0163162_10028615 3300013306 Bacteria 5515
202 Ga0163162_10059586 3300013306 Unclassified 3850
203 Ga0163162_10061759 3300013306 Bacteria 3785
204 Ga0163162_10074519 3300013306 Bacteria 3453
205 Ga0163162_10293081 3300013306 Bacteria 1759
206 Ga0163162_10327671 3300013306 Bacteria 1664
207 Ga0163162_10439606 3300013306 Bacteria 1436
208 Ga0163162_10590294 3300013306 Bacteria 1237
209 Ga0163162_10739293 3300013306 Unclassified 1104
210 Ga0163162_11490702 3300013306 Bacteria 770
211 Ga0163162_11672397 3300013306 Unclassified 727
212 Ga0157372_10043035 3300013307 Bacteria 4998
213 Ga0157372_10540884 3300013307 Bacteria 1358
214 Ga0157372_10588318 3300013307 Bacteria 1297
215 Ga0157372_11364507 3300013307 Unclassified 817
216 Ga0157372_11870014 3300013307 Unclassified 690
217 Ga0157372_12238227 3300013307 Unclassified 628
218 Ga0157375_10017735 3300013308 Bacteria 6435
219 Ga0157375_10036226 3300013308 Bacteria 4718
220 Ga0157375_10126077 3300013308 Bacteria 2675
221 Ga0157375_10208234 3300013308 Bacteria 2112
222 Ga0157375_10770752 3300013308 Bacteria 1112
223 Ga0157375_10776020 3300013308 Unclassified 1108
224 Ga0157375_11316030 3300013308 Unclassified 850
225 Ga0157375_12569332 3300013308 Unclassified 608
226 Ga0163163_10028374 3300014325 Bacteria 5373
227 Ga0163163_10031283 3300014325 Bacteria 5136
228 Ga0163163_10051812 3300014325 Bacteria 4047
229 Ga0163163_10118885 3300014325 Bacteria 2676
230 Ga0163163_10425046 3300014325 Bacteria 1388
231 Ga0163163_10768788 3300014325 Bacteria 1027
232 Ga0163163_12761970 3300014325 Unclassified 548
233 Ga0157380_10001708 3300014326 Bacteria 14494
234 Ga0157380_10031635 3300014326 Unclassified 4064
235 Ga0157380_10033552 3300014326 Unclassified 3953
236 Ga0157380_10102972 3300014326 Bacteria 2381
237 Ga0157380_10817708 3300014326 Bacteria 950
238 Ga0157380_10908225 3300014326 Bacteria 907
239 Ga0157380_12409629 3300014326 Unclassified 591
240 Ga0157377_10709022 3300014745 Bacteria 731
241 Ga0157379_10246379 3300014968 Bacteria 1621
242 Ga0157379_10348563 3300014968 Bacteria 1355
243 Ga0157376_10035323 3300014969 Bacteria 4043
244 Ga0157376_10557922 3300014969 Unclassified 1134
245 Ga0157376_10566648 3300014969 Bacteria 1126
246 Ga0163161_10047849 3300017792 Bacteria 3088
247 Ga0163161_10070804 3300017792 Bacteria 2550
248 Ga0213876_10243313 3300021384 Bacteria 956
249 Ga0207656_10346230 3300025321 Bacteria 741
250 Ga0207682_10026765 3300025893 Bacteria 2295
251 Ga0207710_10004775 3300025900 Bacteria 5879
252 Ga0207710_10105023 3300025900 Bacteria 1336
253 Ga0207645_10131962 3300025907 Unclassified 1626
254 Ga0207643_10278758 3300025908 Bacteria 1036
255 Ga0207654_10097307 3300025911 Bacteria 1807
256 Ga0207654_10607079 3300025911 Bacteria 781
257 Ga0207707_10130142 3300025912 Bacteria 2201
258 Ga0207707_10735075 3300025912 Bacteria 826
259 Ga0207671_10223459 3300025914 Bacteria 1476
260 Ga0207660_10021474 3300025917 Bacteria 4341
261 Ga0207662_10016327 3300025918 Bacteria 4189
262 Ga0207657_10305006 3300025919 Bacteria 1261
263 Ga0207657_10980131 3300025919 Unclassified 649
264 Ga0207649_10134821 3300025920 Bacteria 1682
265 Ga0207649_10378994 3300025920 Unclassified 1054
266 Ga0207652_10055198 3300025921 Bacteria 3416
267 Ga0207652_10311958 3300025921 Bacteria 1420
268 Ga0207652_10491099 3300025921 Bacteria 1106
269 Ga0207681_10011406 3300025923 Bacteria 5462
270 Ga0207650_10089321 3300025925 Bacteria 2351
271 Ga0207650_10118941 3300025925 Bacteria 2054
272 Ga0207650_10468037 3300025925 Bacteria 1050
273 Ga0207659_10299404 3300025926 Bacteria 1320
274 Ga0207644_10010877 3300025931 Bacteria 6008
275 Ga0207644_10100280 3300025931 Bacteria 2174
276 Ga0207690_10024966 3300025932 Bacteria 3747
277 Ga0207706_10009157 3300025933 Bacteria 9105
278 Ga0207706_10583038 3300025933 Bacteria 961
279 Ga0207691_10019176 3300025940 Bacteria 6475
280 Ga0207691_10471524 3300025940 Bacteria 1067
281 Ga0207691_10599575 3300025940 Bacteria 932
282 Ga0207691_10642745 3300025940 Bacteria 897
283 Ga0207711_10065366 3300025941 Bacteria 3144
284 Ga0207711_10550641 3300025941 Bacteria 1076
285 Ga0207689_10046335 3300025942 Bacteria 3593
286 Ga0207689_10049121 3300025942 Bacteria 3481
287 Ga0207661_10243421 3300025944 Bacteria 1597
288 Ga0207679_10130897 3300025945 Bacteria 2013
289 Ga0207679_10194955 3300025945 Bacteria 1687
290 Ga0207667_10093673 3300025949 Bacteria 3102
291 Ga0207667_10217118 3300025949 Bacteria 1959
292 Ga0207651_10315161 3300025960 Bacteria 1306
293 Ga0207712_10019845 3300025961 Bacteria 4394
294 Ga0207712_10026438 3300025961 Bacteria 3867
295 Ga0207712_10059140 3300025961 Bacteria 2711
296 Ga0207640_10075974 3300025981 Bacteria 2278
297 Ga0207640_10293828 3300025981 Bacteria 1282
298 Ga0207640_10442465 3300025981 Bacteria 1069
299 Ga0207658_10102183 3300025986 Bacteria 2248
300 Ga0207658_10133554 3300025986 Bacteria 1998
301 Ga0207703_10112588 3300026035 Bacteria 2325
302 Ga0207703_10457808 3300026035 Bacteria 1193
303 Ga0207703_10461860 3300026035 Bacteria 1187
304 Ga0207639_10003863 3300026041 Bacteria 10093
305 Ga0207639_10202023 3300026041 Bacteria 1705
306 Ga0207678_10048387 3300026067 Bacteria 3675
307 Ga0207708_10687589 3300026075 Unclassified 873
308 Ga0207702_10432176 3300026078 Bacteria 1275
309 Ga0207641_10043081 3300026088 Bacteria 3789
310 Ga0207641_10335556 3300026088 Bacteria 1437
311 Ga0207641_10762661 3300026088 Bacteria 955
312 Ga0207641_11761175 3300026088 Bacteria 621
313 Ga0207648_10214352 3300026089 Unclassified 1710
314 Ga0207676_10356294 3300026095 Bacteria 1354
315 Ga0207676_10396696 3300026095 Bacteria 1288
316 Ga0207676_10433516 3300026095 Bacteria 1235
317 Ga0207676_11028554 3300026095 Unclassified 812
318 Ga0207674_10014713 3300026116 Bacteria 8629
319 Ga0207674_10173084 3300026116 Bacteria 2112
320 Ga0207675_100031117 3300026118 Unclassified 4969
321 Ga0207675_100061215 3300026118 Bacteria 3514
322 Ga0207675_100117485 3300026118 Bacteria 2515
323 Ga0207675_100124384 3300026118 Bacteria 2442
324 Ga0207683_10406486 3300026121 Bacteria 1253
325 Ga0207698_10182749 3300026142 Bacteria 1859
326 Ga0207698_10850170 3300026142 Bacteria 917
327 Ga0209974_10114785 3300027876 Bacteria 950
328 Ga0268265_10013904 3300028380 Bacteria 5478
329 Ga0268265_10545111 3300028380 Bacteria 1100
330 Ga0268265_10871090 3300028380 Bacteria 882
331 Ga0268265_11235995 3300028380 Bacteria 745
332 Ga0268264_10000803 3300028381 Bacteria 33877
333 Ga0268264_10185599 3300028381 Bacteria 1892
334 Ga0268264_10279449 3300028381 Bacteria 1563
335 Ga0268264_10279825 3300028381 Bacteria 1562
336 Ga0268264_11101102 3300028381 Bacteria 803
337 Ga0307513_10370745 3300031456 Bacteria 1174
338 Ga0307408_100091743 3300031548 Bacteria 2295
339 Ga0307408_100371264 3300031548 Bacteria 1220
340 Ga0307408_100681216 3300031548 Bacteria 922
341 Ga0307405_10006490 3300031731 Bacteria 5757
342 Ga0307405_11226360 3300031731 Unclassified 650
343 Ga0307413_10010552 3300031824 Bacteria 4489
344 Ga0307413_10219967 3300031824 Bacteria 1386
345 Ga0307413_10332726 3300031824 Bacteria 1165
346 Ga0307413_10701163 3300031824 Unclassified 841
347 Ga0307413_10806364 3300031824 Bacteria 789
348 Ga0307413_10840053 3300031824 Bacteria 775
349 Ga0307413_11045126 3300031824 Unclassified 702
350 Ga0307410_10003076 3300031852 Bacteria 8260
351 Ga0307410_10017999 3300031852 Bacteria 4257
352 Ga0307410_10044229 3300031852 Unclassified 2957
353 Ga0307410_10045973 3300031852 Bacteria 2911
354 Ga0307410_10076799 3300031852 Bacteria 2332
355 Ga0307410_10103981 3300031852 Bacteria 2041
356 Ga0307410_10179273 3300031852 Bacteria 1603
357 Ga0307410_10650767 3300031852 Bacteria 884
358 Ga0307410_10942247 3300031852 Bacteria 742
359 Ga0307406_10014532 3300031901 Bacteria 4533
360 Ga0307406_10014638 3300031901 Bacteria 4516
361 Ga0307406_10373077 3300031901 Bacteria 1122
362 Ga0307407_10001622 3300031903 Bacteria 8315
363 Ga0307407_10129427 3300031903 Bacteria 1612
364 Ga0307407_10400228 3300031903 Unclassified 985
365 Ga0307407_10434134 3300031903 Bacteria 949
366 Ga0307407_10668960 3300031903 Bacteria 779
367 Ga0307412_10044658 3300031911 Bacteria 2892
368 Ga0307412_10053128 3300031911 Bacteria 2685
369 Ga0307412_10588530 3300031911 Bacteria 940
370 Ga0307412_11157870 3300031911 Unclassified 691
371 Ga0307409_100023396 3300031995 Bacteria 4280
372 Ga0307409_100272985 3300031995 Bacteria 1558
373 Ga0307409_100500163 3300031995 Bacteria 1183
374 Ga0307416_100010909 3300032002 Bacteria 6027
375 Ga0307416_100039764 3300032002 Bacteria 3646
376 Ga0307416_100192310 3300032002 Bacteria 1926
377 Ga0307416_101201022 3300032002 Bacteria 864
378 Ga0307414_10011235 3300032004 Bacteria 5242
379 Ga0307414_10236152 3300032004 Unclassified 1510
380 Ga0307414_10409394 3300032004 Bacteria 1180
381 Ga0307414_11111920 3300032004 Unclassified 730
382 Ga0307411_10000928 3300032005 Bacteria 11160
383 Ga0307411_10338319 3300032005 Bacteria 1222
384 Ga0307411_11099422 3300032005 Unclassified 716
385 Ga0307415_100005021 3300032126 Bacteria 6966
386 Ga0307415_100447520 3300032126 Bacteria 1116
387 Ga0307415_100500247 3300032126 Bacteria 1062
388 Ga0307415_100632495 3300032126 Bacteria 957
389 Ga0307415_100866957 3300032126 Bacteria 830
390 Ga0373937_0355644 3300036401 Bacteria 1388
391 Ga0395900_0221104 3300037418 Unclassified 1909
392 Ga0395900_0676542 3300037418 Bacteria 967
393 Ga0395898_0854841 3300037466 Unclassified 849
394 Ga0395905_0067198 3300037471 Unclassified 3358
395 Ga0395905_0292227 3300037471 Bacteria 1516
396 Ga0436364_0257790 3300037853 Bacteria 1761
397 Ga0395901_0865862 3300038443 Bacteria 888
398 Ga0436365_1329905 3300039437 Bacteria 2188
399 Ga0439438_097126 3300041405 Unclassified 716
400 Ga0439433_0135516 3300041999 Bacteria 628
401 Ga0439432_019655 3300042006 Bacteria 2249
402 Ga0439446_0111604 3300042156 Bacteria 873
403 Ga0495598_0006467 3300046537 Bacteria 2649
404 Ga0495621_0176042 3300046539 Bacteria 852
405 Ga0495599_0243509 3300046678 Bacteria 1096
406 Ga0495658_0129416 3300046683 Bacteria 1535
407 Ga0495672_0017968 3300047320 Bacteria 4711
408 Ga0495684_0397774 3300047471 Bacteria 968
409 Ga0496101_0372462 3300048904 Bacteria 1123
410 Ga0496104_0990659 3300048907 Unclassified 745
411 Ga0496108_0313560 3300048911 Bacteria 1367
412 Ga0496109_1077989 3300048912 Unclassified 740
413 Ga0501069_0390445 3300049585 Bacteria 823
414 Ga0501072_0050065 3300049588 Bacteria 3289
415 Ga0501217_004309 3300049661 Bacteria 2918
416 Ga0501217_240845 3300049661 Bacteria 579
417 Ga0501224_047384 3300049664 Bacteria 655
418 Ga0501235_002379 3300049669 Bacteria 4055
419 Ga0501239_019325 3300049672 Bacteria 825
420 Ga0501242_030400 3300049674 Bacteria 729
421 Ga0501243_063021 3300049675 Unclassified 691
422 Ga0501249_002566 3300049679 Bacteria 3663
423 Ga0501261_025597 3300049690 Bacteria 869
424 Ga0501221_006898 3300049704 Bacteria 1931
425 Ga0501221_070350 3300049704 Bacteria 825
426 Ga0501229_019352 3300049706 Bacteria 896
427 Ga0501262_015132 3300049759 Bacteria 1010
428 Ga0501268_000577 3300049765 Bacteria 4073
429 Ga0501270_002733 3300049767 Bacteria 1835
430 Ga0501272_002393 3300049769 Bacteria 1854
431 nmdc:mga09592_218043_c1 3300050508 Bacteria 1653
432 nmdc:mga08y16_50274_c1 3300050511 Unclassified 4363
433 nmdc:mga08y16_606525_c1 3300050511 Bacteria 1103
434 Ga0495619_0246376 3300053085 Bacteria 1238
435 Ga0500651_0621102 3300053093 Unclassified 584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0854841 Ga0395898_0854841_398_829 138
2 3300005543 Ga0070672_100792243 Ga0070672_1007922432 147
3 3300026089 Ga0207648_10214352 Ga0207648_102143522 149
4 3300005327 Ga0070658_10181881 Ga0070658_101818813 153
5 3300031852 Ga0307410_10942247 Ga0307410_109422471 153
6 3300005364 Ga0070673_101607516 Ga0070673_1016075161 155
7 3300005471 Ga0070698_100477003 Ga0070698_1004770032 155
8 3300005578 Ga0068854_100309016 Ga0068854_1003090162 155
9 3300013307 Ga0157372_10588318 Ga0157372_105883182 155
10 3300013308 Ga0157375_12569332 Ga0157375_125693322 155
11 3300025981 Ga0207640_10293828 Ga0207640_102938282 155
12 3300036401 Ga0373937_0355644 Ga0373937_0355644_430_900 155
13 3300046678 Ga0495599_0243509 Ga0495599_0243509_281_751 155
14 3300047471 Ga0495684_0397774 Ga0495684_0397774_248_718 155
15 3300053085 Ga0495619_0246376 Ga0495619_0246376_590_1060 155
16 3300005329 Ga0070683_100573396 Ga0070683_1005733962 156
17 3300005336 Ga0070680_100058745 Ga0070680_1000587451 156
18 3300005338 Ga0068868_100144713 Ga0068868_1001447133 156
19 3300005355 Ga0070671_100711659 Ga0070671_1007116591 156
20 3300005364 Ga0070673_101005170 Ga0070673_1010051702 156
21 3300005366 Ga0070659_100488179 Ga0070659_1004881792 156
22 3300005457 Ga0070662_100061700 Ga0070662_1000617003 156
23 3300005457 Ga0070662_100651372 Ga0070662_1006513722 156
24 3300005458 Ga0070681_10760046 Ga0070681_107600462 156
25 3300005530 Ga0070679_100062682 Ga0070679_1000626825 156
26 3300005535 Ga0070684_100276948 Ga0070684_1002769483 156
27 3300005564 Ga0070664_100058465 Ga0070664_1000584654 156
28 3300005564 Ga0070664_100126497 Ga0070664_1001264973 156
29 3300005577 Ga0068857_100114742 Ga0068857_1001147422 156
30 3300005578 Ga0068854_100080734 Ga0068854_1000807344 156
31 3300005578 Ga0068854_100413542 Ga0068854_1004135421 156
32 3300005614 Ga0068856_100643550 Ga0068856_1006435502 156
33 3300005617 Ga0068859_100252083 Ga0068859_1002520832 156
34 3300005841 Ga0068863_101937056 Ga0068863_1019370561 156
35 3300005843 Ga0068860_100264044 Ga0068860_1002640442 156
36 3300005843 Ga0068860_101088029 Ga0068860_1010880291 156
37 3300006931 Ga0097620_100252085 Ga0097620_1002520853 156
38 3300009093 Ga0105240_10087788 Ga0105240_100877882 156
39 3300009101 Ga0105247_10208395 Ga0105247_102083952 156
40 3300009174 Ga0105241_10077417 Ga0105241_100774173 156
41 3300009545 Ga0105237_10493519 Ga0105237_104935192 156
42 3300013100 Ga0157373_10791384 Ga0157373_107913841 156
43 3300013105 Ga0157369_10288194 Ga0157369_102881943 156
44 3300013296 Ga0157374_10054334 Ga0157374_100543344 156
45 3300013306 Ga0163162_10293081 Ga0163162_102930813 156
46 3300013306 Ga0163162_10590294 Ga0163162_105902941 156
47 3300013307 Ga0157372_10540884 Ga0157372_105408841 156
48 3300013307 Ga0157372_12238227 Ga0157372_122382272 156
49 3300013308 Ga0157375_10770752 Ga0157375_107707521 156
50 3300014325 Ga0163163_12761970 Ga0163163_127619701 156
51 3300014745 Ga0157377_10709022 Ga0157377_107090221 156
52 3300021384 Ga0213876_10243313 Ga0213876_102433133 156
53 3300025321 Ga0207656_10346230 Ga0207656_103462301 156
54 3300025900 Ga0207710_10105023 Ga0207710_101050232 156
55 3300025911 Ga0207654_10607079 Ga0207654_106070791 156
56 3300025912 Ga0207707_10735075 Ga0207707_107350752 156
57 3300025914 Ga0207671_10223459 Ga0207671_102234592 156
58 3300025917 Ga0207660_10021474 Ga0207660_100214745 156
59 3300025921 Ga0207652_10491099 Ga0207652_104910992 156
60 3300025925 Ga0207650_10089321 Ga0207650_100893213 156
61 3300025933 Ga0207706_10583038 Ga0207706_105830382 156
62 3300025940 Ga0207691_10019176 Ga0207691_100191762 156
63 3300025944 Ga0207661_10243421 Ga0207661_102434212 156
64 3300025945 Ga0207679_10194955 Ga0207679_101949552 156
65 3300025960 Ga0207651_10315161 Ga0207651_103151612 156
66 3300025981 Ga0207640_10442465 Ga0207640_104424652 156
67 3300026078 Ga0207702_10432176 Ga0207702_104321762 156
68 3300026088 Ga0207641_11761175 Ga0207641_117611751 156
69 3300026116 Ga0207674_10173084 Ga0207674_101730843 156
70 3300026142 Ga0207698_10182749 Ga0207698_101827494 156
71 3300026142 Ga0207698_10850170 Ga0207698_108501702 156
72 3300027876 Ga0209974_10114785 Ga0209974_101147851 156
73 3300028381 Ga0268264_11101102 Ga0268264_111011022 156
74 3300031824 Ga0307413_10840053 Ga0307413_108400532 156
75 3300031852 Ga0307410_10044229 Ga0307410_100442293 156
76 3300031852 Ga0307410_10045973 Ga0307410_100459732 156
77 3300031911 Ga0307412_11157870 Ga0307412_111578701 156
78 3300032002 Ga0307416_100192310 Ga0307416_1001923102 156
79 3300032004 Ga0307414_10409394 Ga0307414_104093942 156
80 3300032004 Ga0307414_11111920 Ga0307414_111119202 156
81 3300032005 Ga0307411_10338319 Ga0307411_103383192 156
82 3300032126 Ga0307415_100447520 Ga0307415_1004475202 156
83 3300039437 Ga0436365_1329905 Ga0436365_1329905_1009_1482 156
84 3300049675 Ga0501243_063021 Ga0501243_063021_122_604 156
85 3300005289 Ga0065704_10166086 Ga0065704_101660862 157
86 3300005295 Ga0065707_10089158 Ga0065707_100891584 157
87 3300005331 Ga0070670_100016547 Ga0070670_1000165472 157
88 3300005331 Ga0070670_101252238 Ga0070670_1012522381 157
89 3300005333 Ga0070677_10096727 Ga0070677_100967272 157
90 3300005333 Ga0070677_10477420 Ga0070677_104774201 157
91 3300005347 Ga0070668_100286796 Ga0070668_1002867962 157
92 3300005353 Ga0070669_101134951 Ga0070669_1011349511 157
93 3300005353 Ga0070669_101258889 Ga0070669_1012588891 157
94 3300005354 Ga0070675_100428503 Ga0070675_1004285032 157
95 3300005355 Ga0070671_100034598 Ga0070671_1000345983 157
96 3300005365 Ga0070688_100211596 Ga0070688_1002115962 157
97 3300005367 Ga0070667_100440616 Ga0070667_1004406162 157
98 3300005445 Ga0070708_100339041 Ga0070708_1003390412 157
99 3300005455 Ga0070663_100037986 Ga0070663_1000379863 157
100 3300005456 Ga0070678_100417031 Ga0070678_1004170311 157
101 3300005466 Ga0070685_10140324 Ga0070685_101403243 157
102 3300005539 Ga0068853_101010535 Ga0068853_1010105351 157
103 3300005545 Ga0070695_100063600 Ga0070695_1000636002 157
104 3300005547 Ga0070693_100689209 Ga0070693_1006892091 157
105 3300005564 Ga0070664_100121377 Ga0070664_1001213772 157
106 3300005577 Ga0068857_101297125 Ga0068857_1012971251 157
107 3300005617 Ga0068859_100004126 Ga0068859_10000412613 157
108 3300005618 Ga0068864_100028509 Ga0068864_1000285095 157
109 3300005618 Ga0068864_100060865 Ga0068864_1000608653 157
110 3300005719 Ga0068861_101580222 Ga0068861_1015802221 157
111 3300005841 Ga0068863_100049862 Ga0068863_1000498623 157
112 3300005841 Ga0068863_101445708 Ga0068863_1014457082 157
113 3300005842 Ga0068858_100026365 Ga0068858_1000263653 157
114 3300005844 Ga0068862_100078555 Ga0068862_1000785552 157
115 3300005844 Ga0068862_100622412 Ga0068862_1006224122 157
116 3300006358 Ga0068871_100158800 Ga0068871_1001588003 157
117 3300006844 Ga0075428_100702934 Ga0075428_1007029342 157
118 3300006931 Ga0097620_100004124 Ga0097620_10000412413 157
119 3300009094 Ga0111539_10185549 Ga0111539_101855493 157
120 3300009101 Ga0105247_10004966 Ga0105247_100049664 157
121 3300009174 Ga0105241_10011997 Ga0105241_100119974 157
122 3300009176 Ga0105242_10604785 Ga0105242_106047851 157
123 3300009553 Ga0105249_10002936 Ga0105249_1000293612 157
124 3300011119 Ga0105246_11866683 Ga0105246_118666831 157
125 3300013297 Ga0157378_10151474 Ga0157378_101514742 157
126 3300013297 Ga0157378_10452588 Ga0157378_104525883 157
127 3300013306 Ga0163162_10327671 Ga0163162_103276712 157
128 3300013306 Ga0163162_10439606 Ga0163162_104396063 157
129 3300013306 Ga0163162_11490702 Ga0163162_114907022 157
130 3300013308 Ga0157375_11316030 Ga0157375_113160301 157
131 3300014325 Ga0163163_10051812 Ga0163163_100518122 157
132 3300014325 Ga0163163_10425046 Ga0163163_104250462 157
133 3300014326 Ga0157380_10817708 Ga0157380_108177082 157
134 3300014968 Ga0157379_10246379 Ga0157379_102463792 157
135 3300025893 Ga0207682_10026765 Ga0207682_100267653 157
136 3300025900 Ga0207710_10004775 Ga0207710_100047754 157
137 3300025908 Ga0207643_10278758 Ga0207643_102787583 157
138 3300025911 Ga0207654_10097307 Ga0207654_100973072 157
139 3300025919 Ga0207657_10980131 Ga0207657_109801311 157
140 3300025925 Ga0207650_10118941 Ga0207650_101189413 157
141 3300025926 Ga0207659_10299404 Ga0207659_102994043 157
142 3300025931 Ga0207644_10100280 Ga0207644_101002803 157
143 3300025940 Ga0207691_10599575 Ga0207691_105995752 157
144 3300025945 Ga0207679_10130897 Ga0207679_101308972 157
145 3300025961 Ga0207712_10019845 Ga0207712_100198456 157
146 3300025961 Ga0207712_10026438 Ga0207712_100264384 157
147 3300025986 Ga0207658_10133554 Ga0207658_101335544 157
148 3300026035 Ga0207703_10457808 Ga0207703_104578082 157
149 3300026067 Ga0207678_10048387 Ga0207678_100483874 157
150 3300026088 Ga0207641_10043081 Ga0207641_100430813 157
151 3300026095 Ga0207676_10396696 Ga0207676_103966961 157
152 3300026095 Ga0207676_10433516 Ga0207676_104335163 157
153 3300026118 Ga0207675_100124384 Ga0207675_1001243844 157
154 3300026121 Ga0207683_10406486 Ga0207683_104064863 157
155 3300028380 Ga0268265_10013904 Ga0268265_100139042 157
156 3300028380 Ga0268265_10545111 Ga0268265_105451112 157
157 3300028381 Ga0268264_10000803 Ga0268264_1000080311 157
158 3300031548 Ga0307408_100681216 Ga0307408_1006812162 157
159 3300031731 Ga0307405_10006490 Ga0307405_100064906 157
160 3300031731 Ga0307405_11226360 Ga0307405_112263602 157
161 3300031824 Ga0307413_10010552 Ga0307413_100105522 157
162 3300031824 Ga0307413_10219967 Ga0307413_102199671 157
163 3300031824 Ga0307413_10332726 Ga0307413_103327262 157
164 3300031824 Ga0307413_10806364 Ga0307413_108063641 157
165 3300031824 Ga0307413_11045126 Ga0307413_110451261 157
166 3300031852 Ga0307410_10003076 Ga0307410_100030763 157
167 3300031852 Ga0307410_10017999 Ga0307410_100179993 157
168 3300031852 Ga0307410_10076799 Ga0307410_100767993 157
169 3300031852 Ga0307410_10103981 Ga0307410_101039812 157
170 3300031852 Ga0307410_10179273 Ga0307410_101792731 157
171 3300031852 Ga0307410_10650767 Ga0307410_106507672 157
172 3300031901 Ga0307406_10014532 Ga0307406_100145324 157
173 3300031901 Ga0307406_10014638 Ga0307406_100146385 157
174 3300031901 Ga0307406_10373077 Ga0307406_103730773 157
175 3300031903 Ga0307407_10001622 Ga0307407_100016228 157
176 3300031903 Ga0307407_10129427 Ga0307407_101294272 157
177 3300031903 Ga0307407_10400228 Ga0307407_104002282 157
178 3300031903 Ga0307407_10434134 Ga0307407_104341341 157
179 3300031911 Ga0307412_10044658 Ga0307412_100446582 157
180 3300031911 Ga0307412_10053128 Ga0307412_100531283 157
181 3300031911 Ga0307412_10588530 Ga0307412_105885302 157
182 3300031995 Ga0307409_100023396 Ga0307409_1000233965 157
183 3300031995 Ga0307409_100272985 Ga0307409_1002729851 157
184 3300031995 Ga0307409_100500163 Ga0307409_1005001632 157
185 3300032002 Ga0307416_100010909 Ga0307416_1000109093 157
186 3300032002 Ga0307416_100039764 Ga0307416_1000397643 157
187 3300032004 Ga0307414_10011235 Ga0307414_100112352 157
188 3300032004 Ga0307414_10236152 Ga0307414_102361522 157
189 3300032005 Ga0307411_10000928 Ga0307411_100009283 157
190 3300032005 Ga0307411_11099422 Ga0307411_110994222 157
191 3300032126 Ga0307415_100005021 Ga0307415_1000050213 157
192 3300032126 Ga0307415_100500247 Ga0307415_1005002472 157
193 3300032126 Ga0307415_100866957 Ga0307415_1008669571 157
194 3300041405 Ga0439438_097126 Ga0439438_097126_196_672 157
195 3300042006 Ga0439432_019655 Ga0439432_019655_797_1273 157
196 3300046537 Ga0495598_0006467 Ga0495598_0006467_1316_1798 157
197 3300046539 Ga0495621_0176042 Ga0495621_0176042_88_564 157
198 3300049588 Ga0501072_0050065 Ga0501072_0050065_2136_2612 157
199 3300049661 Ga0501217_004309 Ga0501217_004309_1145_1621 157
200 3300049664 Ga0501224_047384 Ga0501224_047384_158_634 157
201 3300049669 Ga0501235_002379 Ga0501235_002379_2824_3300 157
202 3300049672 Ga0501239_019325 Ga0501239_019325_254_730 157
203 3300049674 Ga0501242_030400 Ga0501242_030400_205_681 157
204 3300049679 Ga0501249_002566 Ga0501249_002566_249_725 157
205 3300049690 Ga0501261_025597 Ga0501261_025597_348_824 157
206 3300049704 Ga0501221_006898 Ga0501221_006898_1328_1804 157
207 3300049704 Ga0501221_070350 Ga0501221_070350_154_630 157
208 3300049706 Ga0501229_019352 Ga0501229_019352_70_546 157
209 3300049759 Ga0501262_015132 Ga0501262_015132_227_703 157
210 3300049765 Ga0501268_000577 Ga0501268_000577_374_850 157
211 3300049767 Ga0501270_002733 Ga0501270_002733_316_792 157
212 3300049769 Ga0501272_002393 Ga0501272_002393_1345_1821 157
213 3300005329 Ga0070683_101436081 Ga0070683_1014360811 158
214 3300005330 Ga0070690_100125961 Ga0070690_1001259611 158
215 3300005334 Ga0068869_100440523 Ga0068869_1004405231 158
216 3300005335 Ga0070666_10005797 Ga0070666_100057971 158
217 3300005336 Ga0070680_100164589 Ga0070680_1001645892 158
218 3300005339 Ga0070660_100013184 Ga0070660_1000131845 158
219 3300005344 Ga0070661_100022451 Ga0070661_1000224513 158
220 3300005344 Ga0070661_100411591 Ga0070661_1004115912 158
221 3300005355 Ga0070671_100137302 Ga0070671_1001373021 158
222 3300005366 Ga0070659_100002308 Ga0070659_1000023086 158
223 3300005367 Ga0070667_100105486 Ga0070667_1001054862 158
224 3300005455 Ga0070663_100817513 Ga0070663_1008175132 158
225 3300005457 Ga0070662_100048132 Ga0070662_1000481323 158
226 3300005458 Ga0070681_10027145 Ga0070681_100271454 158
227 3300005458 Ga0070681_10103147 Ga0070681_101031472 158
228 3300005530 Ga0070679_100039152 Ga0070679_1000391523 158
229 3300005530 Ga0070679_100074406 Ga0070679_1000744063 158
230 3300005539 Ga0068853_100001559 Ga0068853_1000015594 158
231 3300005539 Ga0068853_100315447 Ga0068853_1003154471 158
232 3300005547 Ga0070693_100292057 Ga0070693_1002920571 158
233 3300005549 Ga0070704_100814231 Ga0070704_1008142312 158
234 3300005563 Ga0068855_100052046 Ga0068855_1000520462 158
235 3300005563 Ga0068855_100117578 Ga0068855_1001175782 158
236 3300005564 Ga0070664_100004272 Ga0070664_1000042726 158
237 3300005564 Ga0070664_100109770 Ga0070664_1001097702 158
238 3300005577 Ga0068857_100047657 Ga0068857_1000476575 158
239 3300005578 Ga0068854_100031610 Ga0068854_1000316103 158
240 3300005615 Ga0070702_100146840 Ga0070702_1001468401 158
241 3300005616 Ga0068852_100137702 Ga0068852_1001377022 158
242 3300005617 Ga0068859_100096363 Ga0068859_1000963633 158
243 3300005618 Ga0068864_100781208 Ga0068864_1007812082 158
244 3300005841 Ga0068863_100187263 Ga0068863_1001872632 158
245 3300006237 Ga0097621_100026092 Ga0097621_1000260923 158
246 3300006881 Ga0068865_100091964 Ga0068865_1000919643 158
247 3300006931 Ga0097620_100096356 Ga0097620_1000963563 158
248 3300009101 Ga0105247_10188412 Ga0105247_101884122 158
249 3300009174 Ga0105241_10112166 Ga0105241_101121662 158
250 3300009177 Ga0105248_10145525 Ga0105248_101455254 158
251 3300009177 Ga0105248_11043576 Ga0105248_110435762 158
252 3300013100 Ga0157373_10030875 Ga0157373_100308753 158
253 3300013104 Ga0157370_10390453 Ga0157370_103904532 158
254 3300013296 Ga0157374_11004450 Ga0157374_110044501 158
255 3300013297 Ga0157378_10049536 Ga0157378_100495364 158
256 3300013307 Ga0157372_10043035 Ga0157372_100430356 158
257 3300013308 Ga0157375_10036226 Ga0157375_100362266 158
258 3300014325 Ga0163163_10031283 Ga0163163_100312831 158
259 3300014326 Ga0157380_10908225 Ga0157380_109082252 158
260 3300014969 Ga0157376_10035323 Ga0157376_100353234 158
261 3300017792 Ga0163161_10070804 Ga0163161_100708044 158
262 3300025912 Ga0207707_10130142 Ga0207707_101301424 158
263 3300025919 Ga0207657_10305006 Ga0207657_103050061 158
264 3300025920 Ga0207649_10134821 Ga0207649_101348211 158
265 3300025920 Ga0207649_10378994 Ga0207649_103789942 158
266 3300025921 Ga0207652_10055198 Ga0207652_100551983 158
267 3300025921 Ga0207652_10311958 Ga0207652_103119582 158
268 3300025932 Ga0207690_10024966 Ga0207690_100249662 158
269 3300025933 Ga0207706_10009157 Ga0207706_1000915711 158
270 3300025949 Ga0207667_10093673 Ga0207667_100936732 158
271 3300025949 Ga0207667_10217118 Ga0207667_102171183 158
272 3300025981 Ga0207640_10075974 Ga0207640_100759744 158
273 3300026041 Ga0207639_10003863 Ga0207639_100038638 158
274 3300026041 Ga0207639_10202023 Ga0207639_102020232 158
275 3300026116 Ga0207674_10014713 Ga0207674_100147138 158
276 3300028381 Ga0268264_10279449 Ga0268264_102794492 158
277 3300031548 Ga0307408_100371264 Ga0307408_1003712643 158
278 3300031824 Ga0307413_10701163 Ga0307413_107011631 158
279 3300031903 Ga0307407_10668960 Ga0307407_106689602 158
280 3300048907 Ga0496104_0990659 Ga0496104_0990659_11_490 158
281 3300048911 Ga0496108_0313560 Ga0496108_0313560_559_1038 158
282 3300048912 Ga0496109_1077989 Ga0496109_1077989_69_548 158
283 3300053093 Ga0500651_0621102 Ga0500651_0621102_95_574 158
284 3300005331 Ga0070670_100502780 Ga0070670_1005027802 159
285 3300005334 Ga0068869_100111806 Ga0068869_1001118063 159
286 3300005355 Ga0070671_100240232 Ga0070671_1002402322 159
287 3300005367 Ga0070667_100043701 Ga0070667_1000437014 159
288 3300005456 Ga0070678_100674880 Ga0070678_1006748802 159
289 3300005564 Ga0070664_102268285 Ga0070664_1022682851 159
290 3300005841 Ga0068863_100021488 Ga0068863_1000214886 159
291 3300005844 Ga0068862_100816248 Ga0068862_1008162482 159
292 3300006358 Ga0068871_100054989 Ga0068871_1000549894 159
293 3300009148 Ga0105243_10603504 Ga0105243_106035041 159
294 3300009176 Ga0105242_10064395 Ga0105242_100643954 159
295 3300009177 Ga0105248_10192781 Ga0105248_101927813 159
296 3300009177 Ga0105248_10246879 Ga0105248_102468793 159
297 3300009553 Ga0105249_10028573 Ga0105249_100285733 159
298 3300013104 Ga0157370_10285435 Ga0157370_102854352 159
299 3300013306 Ga0163162_10061759 Ga0163162_100617593 159
300 3300013306 Ga0163162_10074519 Ga0163162_100745193 159
301 3300013307 Ga0157372_11364507 Ga0157372_113645072 159
302 3300013308 Ga0157375_10017735 Ga0157375_100177356 159
303 3300013308 Ga0157375_10208234 Ga0157375_102082341 159
304 3300014325 Ga0163163_10118885 Ga0163163_101188854 159
305 3300014325 Ga0163163_10768788 Ga0163163_107687881 159
306 3300014969 Ga0157376_10566648 Ga0157376_105666482 159
307 3300025925 Ga0207650_10468037 Ga0207650_104680372 159
308 3300025940 Ga0207691_10471524 Ga0207691_104715242 159
309 3300025941 Ga0207711_10065366 Ga0207711_100653664 159
310 3300025942 Ga0207689_10046335 Ga0207689_100463353 159
311 3300025986 Ga0207658_10102183 Ga0207658_101021833 159
312 3300026088 Ga0207641_10762661 Ga0207641_107626612 159
313 3300026095 Ga0207676_10356294 Ga0207676_103562942 159
314 3300028381 Ga0268264_10279825 Ga0268264_102798253 159
315 3300037418 Ga0395900_0676542 Ga0395900_0676542_389_871 159
316 3300037471 Ga0395905_0292227 Ga0395905_0292227_892_1374 159
317 3300038443 Ga0395901_0865862 Ga0395901_0865862_51_533 159
318 3300005334 Ga0068869_100013417 Ga0068869_1000134176 160
319 3300005343 Ga0070687_100035263 Ga0070687_1000352633 160
320 3300005355 Ga0070671_100009114 Ga0070671_1000091147 160
321 3300005438 Ga0070701_10125214 Ga0070701_101252141 160
322 3300005618 Ga0068864_101131098 Ga0068864_1011310981 160
323 3300005841 Ga0068863_100963072 Ga0068863_1009630722 160
324 3300006237 Ga0097621_100135545 Ga0097621_1001355452 160
325 3300006358 Ga0068871_100171983 Ga0068871_1001719832 160
326 3300009174 Ga0105241_10022935 Ga0105241_100229356 160
327 3300013308 Ga0157375_10126077 Ga0157375_101260773 160
328 3300014325 Ga0163163_10028374 Ga0163163_100283743 160
329 3300014326 Ga0157380_10031635 Ga0157380_100316355 160
330 3300014969 Ga0157376_10557922 Ga0157376_105579222 160
331 3300025931 Ga0207644_10010877 Ga0207644_100108775 160
332 3300025942 Ga0207689_10049121 Ga0207689_100491212 160
333 3300026088 Ga0207641_10335556 Ga0207641_103355563 160
334 3300026095 Ga0207676_11028554 Ga0207676_110285541 160
335 3300046683 Ga0495658_0129416 Ga0495658_0129416_1008_1490 160
336 3300048904 Ga0496101_0372462 Ga0496101_0372462_260_742 160
337 3300005289 Ga0065704_10129875 Ga0065704_101298751 163
338 3300005330 Ga0070690_100009096 Ga0070690_1000090964 163
339 3300005330 Ga0070690_100769506 Ga0070690_1007695061 163
340 3300005335 Ga0070666_11104889 Ga0070666_111048891 163
341 3300005341 Ga0070691_10150104 Ga0070691_101501042 163
342 3300005353 Ga0070669_100052083 Ga0070669_1000520833 163
343 3300005438 Ga0070701_10039378 Ga0070701_100393783 163
344 3300005444 Ga0070694_100019996 Ga0070694_1000199965 163
345 3300005549 Ga0070704_100049100 Ga0070704_1000491005 163
346 3300005615 Ga0070702_100269123 Ga0070702_1002691232 163
347 3300005719 Ga0068861_100114791 Ga0068861_1001147914 163
348 3300005842 Ga0068858_100390534 Ga0068858_1003905342 163
349 3300005844 Ga0068862_100065426 Ga0068862_1000654265 163
350 3300005844 Ga0068862_100618602 Ga0068862_1006186022 163
351 3300009176 Ga0105242_11677202 Ga0105242_116772022 163
352 3300009177 Ga0105248_10033625 Ga0105248_100336252 163
353 3300009553 Ga0105249_10036062 Ga0105249_100360625 163
354 3300009553 Ga0105249_10242059 Ga0105249_102420592 163
355 3300013306 Ga0163162_10028615 Ga0163162_100286155 163
356 3300013306 Ga0163162_10059586 Ga0163162_100595863 163
357 3300013306 Ga0163162_11672397 Ga0163162_116723972 163
358 3300014326 Ga0157380_10033552 Ga0157380_100335523 163
359 3300014968 Ga0157379_10348563 Ga0157379_103485632 163
360 3300025923 Ga0207681_10011406 Ga0207681_100114064 163
361 3300025961 Ga0207712_10059140 Ga0207712_100591402 163
362 3300026035 Ga0207703_10112588 Ga0207703_101125882 163
363 3300026118 Ga0207675_100117485 Ga0207675_1001174853 163
364 3300028380 Ga0268265_10871090 Ga0268265_108710902 163
365 3300028381 Ga0268264_10185599 Ga0268264_101855992 163
366 3300031548 Ga0307408_100091743 Ga0307408_1000917432 163
367 3300032002 Ga0307416_101201022 Ga0307416_1012010222 163
368 3300032126 Ga0307415_100632495 Ga0307415_1006324952 163
369 3300037853 Ga0436364_0257790 Ga0436364_0257790_818_1354 163
370 3300041999 Ga0439433_0135516 Ga0439433_0135516_105_596 163
371 3300042156 Ga0439446_0111604 Ga0439446_0111604_284_775 163
372 3300049585 Ga0501069_0390445 Ga0501069_0390445_232_723 163
373 3300049661 Ga0501217_240845 Ga0501217_240845_22_513 163
374 3300000546 LJNas_1010433 LJNas_10104332 164
375 3300005289 Ga0065704_10083236 Ga0065704_100832365 164
376 3300005295 Ga0065707_10090182 Ga0065707_100901824 164
377 3300005328 Ga0070676_10156479 Ga0070676_101564792 164
378 3300005330 Ga0070690_100001233 Ga0070690_1000012337 164
379 3300005330 Ga0070690_100723617 Ga0070690_1007236171 164
380 3300005333 Ga0070677_10510281 Ga0070677_105102812 164
381 3300005334 Ga0068869_100222176 Ga0068869_1002221761 164
382 3300005334 Ga0068869_100821840 Ga0068869_1008218401 164
383 3300005345 Ga0070692_10353940 Ga0070692_103539401 164
384 3300005353 Ga0070669_100018358 Ga0070669_1000183586 164
385 3300005365 Ga0070688_101165405 Ga0070688_1011654051 164
386 3300005406 Ga0070703_10300097 Ga0070703_103000971 164
387 3300005438 Ga0070701_10068623 Ga0070701_100686232 164
388 3300005438 Ga0070701_10625515 Ga0070701_106255151 164
389 3300005441 Ga0070700_100206000 Ga0070700_1002060001 164
390 3300005444 Ga0070694_100107471 Ga0070694_1001074712 164
391 3300005444 Ga0070694_100150309 Ga0070694_1001503092 164
392 3300005444 Ga0070694_100228557 Ga0070694_1002285572 164
393 3300005444 Ga0070694_100886364 Ga0070694_1008863641 164
394 3300005457 Ga0070662_100028471 Ga0070662_1000284713 164
395 3300005518 Ga0070699_100019154 Ga0070699_1000191545 164
396 3300005543 Ga0070672_100099490 Ga0070672_1000994902 164
397 3300005546 Ga0070696_100094749 Ga0070696_1000947491 164
398 3300005546 Ga0070696_101064978 Ga0070696_1010649781 164
399 3300005618 Ga0068864_100788317 Ga0068864_1007883171 164
400 3300005719 Ga0068861_100057135 Ga0068861_1000571355 164
401 3300005843 Ga0068860_100647912 Ga0068860_1006479122 164
402 3300005844 Ga0068862_100003012 Ga0068862_1000030124 164
403 3300006880 Ga0075429_100155601 Ga0075429_1001556013 164
404 3300009094 Ga0111539_10037504 Ga0111539_100375047 164
405 3300009094 Ga0111539_10224219 Ga0111539_102242192 164
406 3300009094 Ga0111539_10493646 Ga0111539_104936462 164
407 3300009147 Ga0114129_10222326 Ga0114129_102223263 164
408 3300009148 Ga0105243_10898005 Ga0105243_108980052 164
409 3300009176 Ga0105242_10377097 Ga0105242_103770972 164
410 3300009177 Ga0105248_10840996 Ga0105248_108409961 164
411 3300010375 Ga0105239_10623691 Ga0105239_106236912 164
412 3300013297 Ga0157378_10010386 Ga0157378_100103869 164
413 3300013306 Ga0163162_10739293 Ga0163162_107392931 164
414 3300013307 Ga0157372_11870014 Ga0157372_118700141 164
415 3300013308 Ga0157375_10776020 Ga0157375_107760202 164
416 3300014326 Ga0157380_10001708 Ga0157380_100017082 164
417 3300014326 Ga0157380_10102972 Ga0157380_101029721 164
418 3300014326 Ga0157380_12409629 Ga0157380_124096291 164
419 3300017792 Ga0163161_10047849 Ga0163161_100478493 164
420 3300025907 Ga0207645_10131962 Ga0207645_101319622 164
421 3300025918 Ga0207662_10016327 Ga0207662_100163273 164
422 3300025940 Ga0207691_10642745 Ga0207691_106427451 164
423 3300025941 Ga0207711_10550641 Ga0207711_105506411 164
424 3300026035 Ga0207703_10461860 Ga0207703_104618602 164
425 3300026075 Ga0207708_10687589 Ga0207708_106875892 164
426 3300026118 Ga0207675_100031117 Ga0207675_1000311177 164
427 3300026118 Ga0207675_100061215 Ga0207675_1000612152 164
428 3300028380 Ga0268265_11235995 Ga0268265_112359951 164
429 3300031456 Ga0307513_10370745 Ga0307513_103707451 164
430 3300037418 Ga0395900_0221104 Ga0395900_0221104_785_1294 164
431 3300037471 Ga0395905_0067198 Ga0395905_0067198_1668_2177 164
432 3300047320 Ga0495672_0017968 Ga0495672_0017968_3387_3890 164
433 3300050508 nmdc:mga09592_218043_c1 nmdc:mga09592_218043_c1_1015_1515 164
434 3300050511 nmdc:mga08y16_50274_c1 nmdc:mga08y16_50274_c1_691_1191 164
435 3300050511 nmdc:mga08y16_606525_c1 nmdc:mga08y16_606525_c1_531_1031 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01957

NfeD

NfeD-like C-terminal, partner-binding

89

182

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.9138 89 151
3cp0-assembly1.cif.gz_A crystal structure of the soluble domain of membrane protein implicated in regulation of membrane protease activity from corynebacterium glutamicum 0.8959 89 147
3wwv-assembly1.cif.gz_A-2 c-terminal domain of stomatin operon partner protein 1510-c from pyrococcus horikoshii 0.8337 89 151
2k5h-assembly1.cif.gz_A solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a 0.8073 80 151
2exd-assembly1.cif.gz_A the solution structure of the c-terminal domain of a nfed homolog from pyrococcus horikoshii 0.8065 90 155
ID Description Score Start End Superfamily
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9167 90 151 2.40.50.140
3wwvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9138 89 151 2.40.50.140
3cp0A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8934 89 147 2.40.50.140
af_P71767_83_144_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8754 90 151 2.40.50.140
af_Q2FXZ8_166_227_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8675 82 151 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3D4NEX6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.942 92 150
AF-A0A3D4NEX6-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9114 92 150
AF-A0A7C7C497-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.9019 88 153
AF-A0A7V3FYP2-F1-model_v4 Nodulation protein NfeD 0.8754 85 150 GO:0005886
AF-A0A354MUG3-F1-model_v4 NfeD-like C-terminal domain-containing protein 0.8751 89 149

Feature Viewer

pLDDT pTM Quality
81.4 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map