F443287

General Info

Members Datasets Scaffolds Average Seq Length
435 309 870 59

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100882510|Ga0068855_1008825102
Length 65
Sequence MTMSLGPYASFIVASYAAAGIVVALLTGWVIIDYRNQTARLRELERSGVTRRSGRSAVDTPRPTT

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
251 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
252 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
253 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
254 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
260 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
261 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
262 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
263 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
264 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
265 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
266 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
267 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
268 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
269 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
270 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
271 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
272 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
273 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
274 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
275 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
276 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
277 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
278 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
279 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
280 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
281 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
282 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
283 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
284 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
285 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
286 2904699407
287 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
288 2906610324
289 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
290 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
291 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
292 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
293 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
294 2922425934
295 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
296 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
297 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
298 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
299 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
300 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
301 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
302 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
303 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
304 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
305 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
306 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
307 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
308 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
309 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.66
Metatranscriptomes 0.23
Isolates 11.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.28
Nodule 7.13
Rhizoplane 7.82
Rhizosphere 66.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100882510 3300005563 Bacteria 946
2 JGI25165J46597_1018314 3300003214 Bacteria 927
3 Ga0055524_1024666 3300003775 Bacteria 1901
4 Ga0055531_10009183 3300003794 Bacteria 5091
5 Ga0065165_1017434 3300005262 Bacteria 2646
6 Ga0070680_101309526 3300005336 Bacteria 627
7 Ga0070682_100909717 3300005337 Bacteria 724
8 Ga0068868_100745267 3300005338 Bacteria 880
9 Ga0070660_100323095 3300005339 Bacteria 1268
10 Ga0070691_10848137 3300005341 Bacteria 560
11 Ga0070661_100030649 3300005344 Bacteria 3886
12 Ga0070671_101024527 3300005355 Bacteria 724
13 Ga0070671_101666474 3300005355 Bacteria 566
14 Ga0070667_100953263 3300005367 Bacteria 800
15 Ga0070709_10973037 3300005434 Bacteria 674
16 Ga0070714_100297921 3300005435 Bacteria 1502
17 Ga0070714_100329444 3300005435 Bacteria 1430
18 Ga0070714_101785476 3300005435 Bacteria 600
19 Ga0070713_100268725 3300005436 Bacteria 1561
20 Ga0070710_10032568 3300005437 Bacteria 2824
21 Ga0070711_100875249 3300005439 Bacteria 765
22 Ga0070708_102126763 3300005445 Bacteria 519
23 Ga0070663_100119031 3300005455 Bacteria 1993
24 Ga0070678_100688626 3300005456 Bacteria 920
25 Ga0068867_101646657 3300005459 Bacteria 601
26 Ga0068867_101970050 3300005459 Bacteria 552
27 Ga0070706_100493067 3300005467 Bacteria 1140
28 Ga0070698_100358464 3300005471 Bacteria 1390
29 Ga0068853_102409305 3300005539 Bacteria 510
30 Ga0070665_100918877 3300005548 Bacteria 888
31 Ga0070665_101363334 3300005548 Bacteria 719
32 Ga0068855_100088102 3300005563 Bacteria 3586
33 Ga0068855_101979061 3300005563 Bacteria 589
34 Ga0068857_101839219 3300005577 Bacteria 593
35 Ga0068854_100883122 3300005578 Bacteria 785
36 Ga0068856_100523011 3300005614 Bacteria 1208
37 Ga0068856_101263979 3300005614 Bacteria 754
38 Ga0068856_102521191 3300005614 Bacteria 521
39 Ga0068858_100241885 3300005842 Bacteria 1713
40 Ga0068862_102369456 3300005844 Bacteria 542
41 Ga0081540_1350184 3300005983 Bacteria 505
42 Ga0070717_10442537 3300006028 Bacteria 1171
43 Ga0075363_100500566 3300006048 Bacteria 721
44 Ga0075363_100507598 3300006048 Bacteria 716
45 Ga0075432_10417257 3300006058 Bacteria 583
46 Ga0070715_10055783 3300006163 Bacteria 1717
47 Ga0070712_101060753 3300006175 Bacteria 702
48 Ga0070712_101300174 3300006175 Bacteria 634
49 Ga0075362_10195461 3300006177 Bacteria 983
50 Ga0075369_10117891 3300006186 Bacteria 1200
51 Ga0075369_10469090 3300006186 Bacteria 597
52 Ga0075366_10617872 3300006195 Bacteria 672
53 Ga0075366_10664862 3300006195 Bacteria 647
54 Ga0075428_100770175 3300006844 Bacteria 1023
55 Ga0105245_11413155 3300009098 Bacteria 746
56 Ga0105245_11954286 3300009098 Bacteria 640
57 Ga0114129_10862706 3300009147 Bacteria 1150
58 Ga0105241_10118603 3300009174 Bacteria 2128
59 Ga0105242_10253350 3300009176 Bacteria 1587
60 Ga0105248_13056864 3300009177 Bacteria 533
61 Ga0105237_10745912 3300009545 Bacteria 986
62 Ga0105238_10733423 3300009551 Bacteria 1001
63 Ga0105238_11479327 3300009551 Bacteria 707
64 Ga0105239_10059039 3300010375 Bacteria 4210
65 Ga0105239_10199912 3300010375 Bacteria 2239
66 Ga0105239_11260416 3300010375 Bacteria 852
67 Ga0105239_13464510 3300010375 Bacteria 513
68 Ga0105246_10535069 3300011119 Bacteria 1001
69 Ga0105246_11935035 3300011119 Bacteria 567
70 Ga0157369_11599887 3300013105 Bacteria 662
71 Ga0157374_11886509 3300013296 Bacteria 623
72 Ga0163162_11198538 3300013306 Bacteria 862
73 Ga0163162_11806765 3300013306 Bacteria 699
74 Ga0163162_12806857 3300013306 Bacteria 561
75 Ga0157380_12015672 3300014326 Bacteria 639
76 Ga0182008_10493968 3300014497 Bacteria 672
77 Ga0157379_10897685 3300014968 Bacteria 840
78 Ga0157376_12794315 3300014969 Bacteria 528
79 Ga0154015_1634589 3300020610 Bacteria 511
80 Ga0213874_10107733 3300021377 Bacteria 933
81 Ga0207425_1005702 3300025245 Bacteria 3511
82 Ga0209233_1001471 3300025261 Bacteria 9282
83 Ga0209564_1024859 3300025295 Bacteria 2035
84 Ga0209758_1000069 3300025297 Bacteria 286161
85 Ga0209758_1029554 3300025297 Bacteria 2288
86 Ga0209256_1003351 3300025299 Bacteria 11357
87 Ga0207426_1010668 3300025302 Bacteria 3551
88 Ga0209051_1112461 3300025303 Bacteria 707
89 Ga0209257_1004231 3300025304 Bacteria 11347
90 Ga0209257_1035057 3300025304 Bacteria 1556
91 Ga0207692_10015925 3300025898 Bacteria 3317
92 Ga0207688_10214283 3300025901 Bacteria 1158
93 Ga0207680_10198417 3300025903 Bacteria 1366
94 Ga0207685_10025600 3300025905 Bacteria 2039
95 Ga0207699_10038009 3300025906 Bacteria 2755
96 Ga0207705_10075493 3300025909 Bacteria 2448
97 Ga0207684_10672315 3300025910 Bacteria 881
98 Ga0207654_10078908 3300025911 Bacteria 1976
99 Ga0207671_11059694 3300025914 Bacteria 638
100 Ga0207693_10040771 3300025915 Bacteria 3657
101 Ga0207694_10347382 3300025924 Bacteria 1227
102 Ga0207700_11636908 3300025928 Bacteria 569
103 Ga0207664_11085231 3300025929 Bacteria 716
104 Ga0207644_10624382 3300025931 Bacteria 896
105 Ga0207644_10763648 3300025931 Bacteria 808
106 Ga0207686_10674434 3300025934 Bacteria 820
107 Ga0207704_10649801 3300025938 Bacteria 869
108 Ga0207665_10029737 3300025939 Bacteria 3610
109 Ga0207711_10971736 3300025941 Bacteria 788
110 Ga0207661_10740693 3300025944 Bacteria 904
111 Ga0207667_10526902 3300025949 Bacteria 1197
112 Ga0207667_10744548 3300025949 Bacteria 980
113 Ga0207667_11307160 3300025949 Bacteria 701
114 Ga0207640_10893120 3300025981 Bacteria 776
115 Ga0207703_10474763 3300026035 Bacteria 1171
116 Ga0207678_10035784 3300026067 Bacteria 4323
117 Ga0207678_11024657 3300026067 Bacteria 731
118 Ga0207648_10596975 3300026089 Bacteria 1017
119 Ga0207674_10257739 3300026116 Bacteria 1691
120 Ga0207674_11655630 3300026116 Bacteria 608
121 Ga0207683_10444443 3300026121 Bacteria 1195
122 Ga0207683_11029971 3300026121 Bacteria 764
123 Ga0268266_11833654 3300028379 Bacteria 581
124 Ga0268264_10558776 3300028381 Bacteria 1123
125 Ga0307515_10056825 3300028794 Bacteria 5677
126 Ga0307513_10386192 3300031456 Bacteria 1138
127 Ga0307508_10455655 3300031616 Bacteria 872
128 Ga0307508_10534050 3300031616 Bacteria 770
129 Ga0307510_10356396 3300033180 Bacteria 912
130 Ga0373938_0013567 3300034957 Bacteria 1549
131 Ga0373944_0453065 3300035089 Bacteria 500
132 Ga0373949_0099246 3300035090 Bacteria 796
133 Ga0373952_0009814 3300035092 Bacteria 1841
134 Ga0373932_0065094 3300035112 Bacteria 1117
135 Ga0373945_0149493 3300035116 Bacteria 946
136 Ga0373960_0165142 3300035121 Bacteria 765
137 Ga0373955_0730195 3300035172 Bacteria 608
138 Ga0373931_0028440 3300035691 Bacteria 2862
139 Ga0373931_0313435 3300035691 Bacteria 972
140 Ga0373935_0306180 3300035692 Bacteria 1124
141 Ga0373927_0041236 3300035695 Bacteria 2994
142 Ga0373947_0663893 3300035725 Bacteria 711
143 Ga0373937_1426383 3300036401 Bacteria 640
144 Ga0373925_0949283 3300037068 Bacteria 708
145 Ga0395899_0096380 3300037312 Bacteria 2139
146 Ga0395899_0157005 3300037312 Bacteria 1609
147 Ga0395900_0005138 3300037418 Bacteria 13747
148 Ga0395900_0106625 3300037418 Bacteria 2878
149 Ga0395898_0179356 3300037466 Bacteria 2024
150 Ga0395898_0188134 3300037466 Bacteria 1973
151 Ga0395898_0741928 3300037466 Bacteria 923
152 Ga0395901_0031964 3300038443 Bacteria 5429
153 Ga0395901_0563098 3300038443 Bacteria 1154
154 Ga0436365_0119133 3300039437 Bacteria 2572
155 Ga0436365_0251417 3300039437 Bacteria 582
156 Ga0436365_1052272 3300039437 Bacteria 560
157 Ga0436361_0474226 3300039447 Bacteria 3446
158 Ga0436361_0535188 3300039447 Bacteria 526
159 Ga0436363_1556288 3300039450 Bacteria 2499
160 Ga0439465_0072718 3300041413 Bacteria 1154
161 Ga0439441_107832 3300042001 Bacteria 630
162 Ga0439432_202550 3300042006 Bacteria 575
163 Ga0466966_0265714 3300044684 Bacteria 1033
164 Ga0466963_0050147 3300044694 Bacteria 2763
165 Ga0466963_0358876 3300044694 Bacteria 1027
166 Ga0466964_0064243 3300044706 Bacteria 1535
167 Ga0466964_0423722 3300044706 Bacteria 700
168 Ga0466968_0002099 3300044735 Bacteria 7255
169 Ga0466968_0138174 3300044735 Bacteria 1113
170 Ga0466970_0937098 3300044765 Bacteria 510
171 Ga0466957_0172312 3300044842 Bacteria 1410
172 Ga0466957_0403959 3300044842 Bacteria 935
173 Ga0466960_0070395 3300044901 Bacteria 1740
174 Ga0466959_0453345 3300045049 Bacteria 869
175 Ga0466967_0037225 3300045976 Bacteria 4162
176 Ga0495592_0120587 3300046454 Bacteria 1845
177 Ga0495592_0467600 3300046454 Bacteria 788
178 Ga0495590_0227439 3300046457 Bacteria 690
179 Ga0495629_0004360 3300046459 Bacteria 10610
180 Ga0495651_0011368 3300046462 Bacteria 6839
181 Ga0495653_0257815 3300046463 Bacteria 1154
182 Ga0495582_0243498 3300046473 Bacteria 1031
183 Ga0495662_0489650 3300046476 Bacteria 603
184 Ga0495664_0135087 3300046477 Bacteria 1494
185 Ga0495664_0226461 3300046477 Bacteria 1132
186 Ga0495664_0467092 3300046477 Bacteria 755
187 Ga0495585_0609919 3300046492 Bacteria 513
188 Ga0495583_0158891 3300046506 Bacteria 933
189 Ga0495606_0045053 3300046507 Bacteria 2927
190 Ga0495606_0180574 3300046507 Bacteria 1217
191 Ga0495608_0026264 3300046511 Bacteria 3971
192 Ga0495608_0735446 3300046511 Bacteria 585
193 Ga0495618_0096944 3300046514 Bacteria 1886
194 Ga0495620_0161286 3300046515 Bacteria 871
195 Ga0495628_0010065 3300046516 Bacteria 8047
196 Ga0495628_0373073 3300046516 Bacteria 1046
197 Ga0495628_0618492 3300046516 Bacteria 772
198 Ga0495628_0891883 3300046516 Bacteria 618
199 Ga0495630_0372443 3300046517 Bacteria 1094
200 Ga0495630_1064275 3300046517 Bacteria 614
201 Ga0495632_0140895 3300046519 Bacteria 1119
202 Ga0495648_0048636 3300046524 Bacteria 2608
203 Ga0495648_0303925 3300046524 Bacteria 746
204 Ga0495652_0083035 3300046529 Bacteria 2638
205 Ga0495652_0723529 3300046529 Bacteria 668
206 Ga0495652_0819881 3300046529 Bacteria 618
207 Ga0495640_0017203 3300046533 Bacteria 5394
208 Ga0495640_0403156 3300046533 Bacteria 839
209 Ga0495587_0381176 3300046536 Bacteria 784
210 Ga0495587_0644717 3300046536 Bacteria 582
211 Ga0495609_0177331 3300046538 Bacteria 898
212 Ga0495645_0010501 3300046543 Bacteria 6494
213 Ga0495622_0016260 3300046557 Bacteria 3464
214 Ga0495667_0019545 3300046559 Bacteria 4570
215 Ga0495667_0729970 3300046559 Bacteria 613
216 Ga0495668_0831949 3300046616 Bacteria 511
217 Ga0495634_0347757 3300046642 Bacteria 888
218 Ga0495625_0033297 3300046660 Bacteria 3813
219 Ga0495635_0011731 3300046663 Bacteria 6145
220 Ga0495635_1030702 3300046663 Bacteria 523
221 Ga0495657_0011486 3300046675 Bacteria 6619
222 Ga0495657_0044366 3300046675 Bacteria 3024
223 Ga0495599_0215823 3300046678 Bacteria 1175
224 Ga0495623_0002368 3300046679 Bacteria 12532
225 Ga0495646_0105360 3300046680 Bacteria 1611
226 Ga0495646_0158625 3300046680 Bacteria 1254
227 Ga0495624_0120338 3300046690 Bacteria 1612
228 Ga0495624_0152211 3300046690 Bacteria 1415
229 Ga0495624_0458129 3300046690 Bacteria 764
230 Ga0495649_0127915 3300046694 Bacteria 1341
231 Ga0495600_0026451 3300046809 Bacteria 3744
232 Ga0495600_0027277 3300046809 Bacteria 3690
233 Ga0495600_0496690 3300046809 Bacteria 750
234 Ga0495660_0396864 3300046810 Bacteria 605
235 Ga0495581_0572535 3300047315 Bacteria 655
236 Ga0495604_0001746 3300047317 Bacteria 17757
237 Ga0495604_0022421 3300047317 Bacteria 5041
238 Ga0495604_0550252 3300047317 Bacteria 744
239 Ga0495674_0015087 3300047319 Bacteria 7230
240 Ga0495674_0369853 3300047319 Bacteria 1161
241 Ga0495676_0055908 3300047321 Bacteria 3125
242 Ga0495680_0000836 3300047322 Bacteria 34084
243 Ga0495680_0422874 3300047322 Bacteria 916
244 Ga0495680_0435940 3300047322 Bacteria 899
245 Ga0495675_0007267 3300047444 Bacteria 6824
246 Ga0495675_0319051 3300047444 Bacteria 919
247 Ga0495684_0224286 3300047471 Bacteria 1377
248 Ga0495686_0045518 3300047472 Bacteria 2776
249 Ga0495686_0242914 3300047472 Bacteria 1015
250 Ga0495686_0675028 3300047472 Bacteria 529
251 Ga0495593_0059491 3300047673 Bacteria 2002
252 Ga0495602_0037944 3300048088 Bacteria 4461
253 Ga0496100_0909059 3300048903 Bacteria 691
254 Ga0496100_0962396 3300048903 Bacteria 671
255 Ga0496100_1301946 3300048903 Bacteria 573
256 Ga0496101_0518913 3300048904 Bacteria 941
257 Ga0496102_0056059 3300048905 Bacteria 3594
258 Ga0496103_0112361 3300048906 Bacteria 1731
259 Ga0496104_0005504 3300048907 Bacteria 11092
260 Ga0496104_0026256 3300048907 Bacteria 5375
261 Ga0496104_1529447 3300048907 Bacteria 570
262 Ga0496105_0009661 3300048908 Bacteria 7553
263 Ga0496105_0029151 3300048908 Bacteria 4516
264 Ga0496106_0097308 3300048909 Bacteria 2278
265 Ga0496106_0210884 3300048909 Bacteria 1547
266 Ga0496107_0018435 3300048910 Bacteria 4914
267 Ga0496107_1288941 3300048910 Bacteria 523
268 Ga0496108_0608781 3300048911 Bacteria 952
269 Ga0496109_0183976 3300048912 Bacteria 1963
270 Ga0496109_0488274 3300048912 Bacteria 1163
271 Ga0496110_0009633 3300048913 Bacteria 7821
272 Ga0496111_0109128 3300048914 Bacteria 2037
273 Ga0496112_0113014 3300048915 Bacteria 2686
274 Ga0496112_0131012 3300048915 Bacteria 2479
275 Ga0496112_0551168 3300048915 Bacteria 1087
276 Ga0496112_1088877 3300048915 Bacteria 717
277 Ga0496113_0107111 3300048916 Bacteria 2171
278 Ga0496113_0446472 3300048916 Bacteria 1039
279 Ga0496114_0034415 3300048917 Bacteria 4179
280 Ga0496114_0196312 3300048917 Bacteria 1767
281 Ga0496114_0362919 3300048917 Bacteria 1281
282 Ga0496114_0817206 3300048917 Bacteria 811
283 Ga0496115_0030898 3300048918 Bacteria 4217
284 Ga0496115_1117010 3300048918 Bacteria 597
285 Ga0496115_1124410 3300048918 Bacteria 594
286 Ga0496119_0026131 3300048922 Bacteria 4056
287 Ga0496119_0444865 3300048922 Bacteria 611
288 Ga0496120_0012939 3300048923 Bacteria 5648
289 Ga0496121_0134935 3300048924 Bacteria 1840
290 Ga0496121_0144081 3300048924 Bacteria 1763
291 Ga0496121_0192669 3300048924 Bacteria 1460
292 Ga0496122_0240289 3300048925 Bacteria 1022
293 Ga0496123_0339904 3300048926 Bacteria 702
294 Ga0496124_0137540 3300048927 Bacteria 1932
295 Ga0496125_0000869 3300048928 Bacteria 48286
296 Ga0496125_0088511 3300048928 Bacteria 2333
297 Ga0496126_0011123 3300048929 Bacteria 9346
298 Ga0496126_0020298 3300048929 Bacteria 6519
299 Ga0496126_0284193 3300048929 Bacteria 1370
300 Ga0496126_0329626 3300048929 Bacteria 1253
301 Ga0496126_0461138 3300048929 Bacteria 1021
302 Ga0495682_0007878 3300049460 Bacteria 4213
303 Ga0501031_0000207 3300049568 Bacteria 33573
304 Ga0501032_0000252 3300049569 Bacteria 44619
305 Ga0501033_0000082 3300049570 Bacteria 89837
306 Ga0501033_0129666 3300049570 Bacteria 1827
307 Ga0501034_0000198 3300049571 Bacteria 113672
308 Ga0501034_0046721 3300049571 Bacteria 4374
309 Ga0501036_0001281 3300049572 Bacteria 19291
310 Ga0501036_0209648 3300049572 Bacteria 1637
311 Ga0501037_0000050 3300049573 Bacteria 112824
312 Ga0501038_0000538 3300049574 Bacteria 33271
313 Ga0501038_0181613 3300049574 Bacteria 1697
314 Ga0501038_0376877 3300049574 Bacteria 1101
315 Ga0501039_0000366 3300049575 Bacteria 32333
316 Ga0501039_0896240 3300049575 Bacteria 690
317 Ga0501040_0512977 3300049576 Bacteria 864
318 Ga0501040_0604754 3300049576 Bacteria 792
319 Ga0501041_0271940 3300049577 Bacteria 1066
320 Ga0501042_0081623 3300049578 Bacteria 2317
321 Ga0501043_0002344 3300049579 Bacteria 16056
322 Ga0501043_0025533 3300049579 Bacteria 4636
323 Ga0501043_0304514 3300049579 Bacteria 1217
324 Ga0501046_0000434 3300049580 Bacteria 41950
325 Ga0501046_0284590 3300049580 Bacteria 1210
326 Ga0501047_0000131 3300049581 Bacteria 91079
327 Ga0501047_0106601 3300049581 Bacteria 2683
328 Ga0501047_0144382 3300049581 Bacteria 2257
329 Ga0501047_1294769 3300049581 Bacteria 543
330 Ga0501048_0000531 3300049582 Bacteria 26809
331 Ga0501048_0055078 3300049582 Bacteria 2824
332 Ga0501048_0259209 3300049582 Bacteria 1235
333 Ga0501067_0000628 3300049583 Bacteria 18974
334 Ga0501068_0000080 3300049584 Bacteria 39376
335 Ga0501069_0001211 3300049585 Bacteria 12577
336 Ga0501069_0481738 3300049585 Bacteria 739
337 Ga0501070_0005971 3300049586 Bacteria 10376
338 Ga0501070_0223992 3300049586 Bacteria 1542
339 Ga0501070_0344471 3300049586 Bacteria 1210
340 Ga0501071_0148282 3300049587 Bacteria 1749
341 Ga0501071_1168676 3300049587 Bacteria 594
342 Ga0501072_0000378 3300049588 Bacteria 31856
343 Ga0501073_0000062 3300049589 Bacteria 66884
344 Ga0501074_0003814 3300049590 Bacteria 10720
345 Ga0501076_0191460 3300049592 Bacteria 1669
346 Ga0501076_1497544 3300049592 Bacteria 554
347 Ga0501079_0001399 3300049741 Bacteria 17010
348 Ga0501080_0009398 3300049742 Bacteria 8917
349 Ga0501080_0431121 3300049742 Bacteria 1183
350 Ga0501080_0458441 3300049742 Bacteria 1142
351 Ga0501083_0000341 3300049744 Bacteria 29641
352 Ga0501035_0000123 3300049822 Bacteria 93734
353 Ga0501035_0256269 3300049822 Bacteria 1484
354 Ga0501035_0656953 3300049822 Bacteria 849
355 Ga0501044_0000100 3300049823 Bacteria 106729
356 Ga0501044_0030904 3300049823 Bacteria 5640
357 Ga0501044_0258970 3300049823 Bacteria 1678
358 Ga0501045_0437318 3300049824 Bacteria 973
359 nmdc:mga03683_63731_c1 3300050489 Bacteria 1563
360 nmdc:mga00v17_193210_c1 3300050491 Bacteria 1315
361 nmdc:mga0k408_411478_c1 3300050493 Bacteria 804
362 nmdc:mga0k408_544712_c1 3300050493 Bacteria 686
363 nmdc:mga05p37_153170_c1 3300050507 Bacteria 2818
364 nmdc:mga08y16_568990_c1 3300050511 Bacteria 1145
365 nmdc:mga0sz30_59676_c1 3300050516 Bacteria 1628
366 Ga0495601_0096469 3300053077 Bacteria 1907
367 Ga0495612_0160375 3300053078 Bacteria 982
368 Ga0495655_0010151 3300053083 Bacteria 1849
369 Ga0495595_0013262 3300053084 Bacteria 3480
370 Ga0495619_0136649 3300053085 Bacteria 1686
371 Ga0500578_0218664 3300053086 Bacteria 1159
372 Ga0500595_065454 3300053119 Bacteria 1088
373 Ga0500626_088127 3300053128 Bacteria 1365
374 Ga0500559_0177901 3300053136 Bacteria 1001
375 Ga0500590_088980 3300053148 Bacteria 1503
376 Ga0500620_105747 3300053155 Bacteria 985
377 Ga0500636_0524392 3300053177 Bacteria 518
378 Ga0500649_155537 3300053722 Bacteria 813
379 Ga0500552_037235 3300053733 Bacteria 777
380 Ga0501084_0033906 3300054114 Bacteria 4269
381 Ga0501084_0658363 3300054114 Bacteria 884
382 Ga0500661_002444 3300055283 Bacteria 3499
383 Ga0501082_0001776 3300060353 Bacteria 18967
384 Ga0466962_0574447 3300061719 Bacteria 574
385 2509152163 2508501128 Bacteria 8613869
386 2513642172 2513237094 Bacteria 8789602
387 2513659494 2513237096 Bacteria 8722461
388 2513718224 2513237104 Bacteria 10034502
389 2513859399 2513237137 Bacteria 9558895
390 2513888596 2513237141 Bacteria 8496279
391 2513921573 2513237145 Bacteria 8979722
392 2517889035 2517572143 Bacteria 9484767
393 2524441425 2524023205 Bacteria 8918781
394 2524537469 2524023228 Bacteria 10118060
395 2671122631 2667528175 Bacteria 7532676
396 2728748448 2728368998 Bacteria 8720350
397 2745077559 2744054633 Bacteria 8678936
398 2793072727 2791355197 Bacteria 8420563
399 2818237838 2816332527 Bacteria 8933356
400 2824609008 2824600985 Bacteria 8488197
401 2824617726 2824609381 Bacteria 8672835
402 2824661015 2824653114 Bacteria 8493680
403 2844315526 2844315083 Bacteria 8138177
404 2857516371 2857509624 Bacteria 7472071
405 2876769623 2876761206 Bacteria 10111113
406 2885418586 2885409591 Bacteria 9235467
407 2888390518 2888388044 Bacteria 7304136
408 2888420140 2888419890 Bacteria 7857137
409 2903733706 2903727486 Bacteria 8281579
410 2903758813 2903748898 Bacteria 9972761
411 2904691022 2904690495 Bacteria 9412302
412 2904708419
413 2906609478 2906602504 Bacteria 8295279
414 2906613592
415 2906635815 2906635258 Bacteria 8601019
416 2906650290 2906643746 Bacteria 8722424
417 2906668124 2906660503 Bacteria 8595048
418 2908747636 2908739725 Bacteria 8628932
419 2908757080 2908756301 Bacteria 8864324
420 2922434028
421 2932809237 2932801729 Bacteria 7987968
422 2935636055 2935630451 Bacteria 8169952
423 2935966738 2935959822 Bacteria 7869783
424 2941512641 2941507105 Bacteria 8166816
425 2941520521 2941515067 Bacteria 8166720
426 2941528535 2941523033 Bacteria 8169134
427 2941535360 2941531003 Bacteria 7653939
428 3005475257 3005474847 Bacteria 9259049
429 3005508997 3005506211 Bacteria 6943378
430 3005595217 3005594810 Bacteria 8716512
431 8006931939 8006926726 Bacteria 6749210
432 8019562634 8019555841 Bacteria 9642137
433 8019572713 8019565922 Bacteria 9639779
434 8056691127 8056689827 Bacteria 6712655
435 8056971474 8056967851 Bacteria 9038162
436 Ga0068855_100882510
437 JGI25165J46597_1018314
438 Ga0055524_1024666
439 Ga0055531_10009183
440 Ga0065165_1017434
441 Ga0070680_101309526
442 Ga0070682_100909717
443 Ga0068868_100745267
444 Ga0070660_100323095
445 Ga0070691_10848137
446 Ga0070661_100030649
447 Ga0070671_101024527
448 Ga0070671_101666474
449 Ga0070667_100953263
450 Ga0070709_10973037
451 Ga0070714_100297921
452 Ga0070714_100329444
453 Ga0070714_101785476
454 Ga0070713_100268725
455 Ga0070710_10032568
456 Ga0070711_100875249
457 Ga0070708_102126763
458 Ga0070663_100119031
459 Ga0070678_100688626
460 Ga0068867_101646657
461 Ga0068867_101970050
462 Ga0070706_100493067
463 Ga0070698_100358464
464 Ga0068853_102409305
465 Ga0070665_100918877
466 Ga0070665_101363334
467 Ga0068855_100088102
468 Ga0068855_101979061
469 Ga0068857_101839219
470 Ga0068854_100883122
471 Ga0068856_100523011
472 Ga0068856_101263979
473 Ga0068856_102521191
474 Ga0068858_100241885
475 Ga0068862_102369456
476 Ga0081540_1350184
477 Ga0070717_10442537
478 Ga0075363_100500566
479 Ga0075363_100507598
480 Ga0075432_10417257
481 Ga0070715_10055783
482 Ga0070712_101060753
483 Ga0070712_101300174
484 Ga0075362_10195461
485 Ga0075369_10117891
486 Ga0075369_10469090
487 Ga0075366_10617872
488 Ga0075366_10664862
489 Ga0075428_100770175
490 Ga0105245_11413155
491 Ga0105245_11954286
492 Ga0114129_10862706
493 Ga0105241_10118603
494 Ga0105242_10253350
495 Ga0105248_13056864
496 Ga0105237_10745912
497 Ga0105238_10733423
498 Ga0105238_11479327
499 Ga0105239_10059039
500 Ga0105239_10199912
501 Ga0105239_11260416
502 Ga0105239_13464510
503 Ga0105246_10535069
504 Ga0105246_11935035
505 Ga0157369_11599887
506 Ga0157374_11886509
507 Ga0163162_11198538
508 Ga0163162_11806765
509 Ga0163162_12806857
510 Ga0157380_12015672
511 Ga0182008_10493968
512 Ga0157379_10897685
513 Ga0157376_12794315
514 Ga0154015_1634589
515 Ga0213874_10107733
516 Ga0207425_1005702
517 Ga0209233_1001471
518 Ga0209564_1024859
519 Ga0209758_1000069
520 Ga0209758_1029554
521 Ga0209256_1003351
522 Ga0207426_1010668
523 Ga0209051_1112461
524 Ga0209257_1004231
525 Ga0209257_1035057
526 Ga0207692_10015925
527 Ga0207688_10214283
528 Ga0207680_10198417
529 Ga0207685_10025600
530 Ga0207699_10038009
531 Ga0207705_10075493
532 Ga0207684_10672315
533 Ga0207654_10078908
534 Ga0207671_11059694
535 Ga0207693_10040771
536 Ga0207694_10347382
537 Ga0207700_11636908
538 Ga0207664_11085231
539 Ga0207644_10624382
540 Ga0207644_10763648
541 Ga0207686_10674434
542 Ga0207704_10649801
543 Ga0207665_10029737
544 Ga0207711_10971736
545 Ga0207661_10740693
546 Ga0207667_10526902
547 Ga0207667_10744548
548 Ga0207667_11307160
549 Ga0207640_10893120
550 Ga0207703_10474763
551 Ga0207678_10035784
552 Ga0207678_11024657
553 Ga0207648_10596975
554 Ga0207674_10257739
555 Ga0207674_11655630
556 Ga0207683_10444443
557 Ga0207683_11029971
558 Ga0268266_11833654
559 Ga0268264_10558776
560 Ga0307515_10056825
561 Ga0307513_10386192
562 Ga0307508_10455655
563 Ga0307508_10534050
564 Ga0307510_10356396
565 Ga0373938_0013567
566 Ga0373944_0453065
567 Ga0373949_0099246
568 Ga0373952_0009814
569 Ga0373932_0065094
570 Ga0373945_0149493
571 Ga0373960_0165142
572 Ga0373955_0730195
573 Ga0373931_0028440
574 Ga0373931_0313435
575 Ga0373935_0306180
576 Ga0373927_0041236
577 Ga0373947_0663893
578 Ga0373937_1426383
579 Ga0373925_0949283
580 Ga0395899_0096380
581 Ga0395899_0157005
582 Ga0395900_0005138
583 Ga0395900_0106625
584 Ga0395898_0179356
585 Ga0395898_0188134
586 Ga0395898_0741928
587 Ga0395901_0031964
588 Ga0395901_0563098
589 Ga0436365_0119133
590 Ga0436365_0251417
591 Ga0436365_1052272
592 Ga0436361_0474226
593 Ga0436361_0535188
594 Ga0436363_1556288
595 Ga0439465_0072718
596 Ga0439441_107832
597 Ga0439432_202550
598 Ga0466966_0265714
599 Ga0466963_0050147
600 Ga0466963_0358876
601 Ga0466964_0064243
602 Ga0466964_0423722
603 Ga0466968_0002099
604 Ga0466968_0138174
605 Ga0466970_0937098
606 Ga0466957_0172312
607 Ga0466957_0403959
608 Ga0466960_0070395
609 Ga0466959_0453345
610 Ga0466967_0037225
611 Ga0495592_0120587
612 Ga0495592_0467600
613 Ga0495590_0227439
614 Ga0495629_0004360
615 Ga0495651_0011368
616 Ga0495653_0257815
617 Ga0495582_0243498
618 Ga0495662_0489650
619 Ga0495664_0135087
620 Ga0495664_0226461
621 Ga0495664_0467092
622 Ga0495585_0609919
623 Ga0495583_0158891
624 Ga0495606_0045053
625 Ga0495606_0180574
626 Ga0495608_0026264
627 Ga0495608_0735446
628 Ga0495618_0096944
629 Ga0495620_0161286
630 Ga0495628_0010065
631 Ga0495628_0373073
632 Ga0495628_0618492
633 Ga0495628_0891883
634 Ga0495630_0372443
635 Ga0495630_1064275
636 Ga0495632_0140895
637 Ga0495648_0048636
638 Ga0495648_0303925
639 Ga0495652_0083035
640 Ga0495652_0723529
641 Ga0495652_0819881
642 Ga0495640_0017203
643 Ga0495640_0403156
644 Ga0495587_0381176
645 Ga0495587_0644717
646 Ga0495609_0177331
647 Ga0495645_0010501
648 Ga0495622_0016260
649 Ga0495667_0019545
650 Ga0495667_0729970
651 Ga0495668_0831949
652 Ga0495634_0347757
653 Ga0495625_0033297
654 Ga0495635_0011731
655 Ga0495635_1030702
656 Ga0495657_0011486
657 Ga0495657_0044366
658 Ga0495599_0215823
659 Ga0495623_0002368
660 Ga0495646_0105360
661 Ga0495646_0158625
662 Ga0495624_0120338
663 Ga0495624_0152211
664 Ga0495624_0458129
665 Ga0495649_0127915
666 Ga0495600_0026451
667 Ga0495600_0027277
668 Ga0495600_0496690
669 Ga0495660_0396864
670 Ga0495581_0572535
671 Ga0495604_0001746
672 Ga0495604_0022421
673 Ga0495604_0550252
674 Ga0495674_0015087
675 Ga0495674_0369853
676 Ga0495676_0055908
677 Ga0495680_0000836
678 Ga0495680_0422874
679 Ga0495680_0435940
680 Ga0495675_0007267
681 Ga0495675_0319051
682 Ga0495684_0224286
683 Ga0495686_0045518
684 Ga0495686_0242914
685 Ga0495686_0675028
686 Ga0495593_0059491
687 Ga0495602_0037944
688 Ga0496100_0909059
689 Ga0496100_0962396
690 Ga0496100_1301946
691 Ga0496101_0518913
692 Ga0496102_0056059
693 Ga0496103_0112361
694 Ga0496104_0005504
695 Ga0496104_0026256
696 Ga0496104_1529447
697 Ga0496105_0009661
698 Ga0496105_0029151
699 Ga0496106_0097308
700 Ga0496106_0210884
701 Ga0496107_0018435
702 Ga0496107_1288941
703 Ga0496108_0608781
704 Ga0496109_0183976
705 Ga0496109_0488274
706 Ga0496110_0009633
707 Ga0496111_0109128
708 Ga0496112_0113014
709 Ga0496112_0131012
710 Ga0496112_0551168
711 Ga0496112_1088877
712 Ga0496113_0107111
713 Ga0496113_0446472
714 Ga0496114_0034415
715 Ga0496114_0196312
716 Ga0496114_0362919
717 Ga0496114_0817206
718 Ga0496115_0030898
719 Ga0496115_1117010
720 Ga0496115_1124410
721 Ga0496119_0026131
722 Ga0496119_0444865
723 Ga0496120_0012939
724 Ga0496121_0134935
725 Ga0496121_0144081
726 Ga0496121_0192669
727 Ga0496122_0240289
728 Ga0496123_0339904
729 Ga0496124_0137540
730 Ga0496125_0000869
731 Ga0496125_0088511
732 Ga0496126_0011123
733 Ga0496126_0020298
734 Ga0496126_0284193
735 Ga0496126_0329626
736 Ga0496126_0461138
737 Ga0495682_0007878
738 Ga0501031_0000207
739 Ga0501032_0000252
740 Ga0501033_0000082
741 Ga0501033_0129666
742 Ga0501034_0000198
743 Ga0501034_0046721
744 Ga0501036_0001281
745 Ga0501036_0209648
746 Ga0501037_0000050
747 Ga0501038_0000538
748 Ga0501038_0181613
749 Ga0501038_0376877
750 Ga0501039_0000366
751 Ga0501039_0896240
752 Ga0501040_0512977
753 Ga0501040_0604754
754 Ga0501041_0271940
755 Ga0501042_0081623
756 Ga0501043_0002344
757 Ga0501043_0025533
758 Ga0501043_0304514
759 Ga0501046_0000434
760 Ga0501046_0284590
761 Ga0501047_0000131
762 Ga0501047_0106601
763 Ga0501047_0144382
764 Ga0501047_1294769
765 Ga0501048_0000531
766 Ga0501048_0055078
767 Ga0501048_0259209
768 Ga0501067_0000628
769 Ga0501068_0000080
770 Ga0501069_0001211
771 Ga0501069_0481738
772 Ga0501070_0005971
773 Ga0501070_0223992
774 Ga0501070_0344471
775 Ga0501071_0148282
776 Ga0501071_1168676
777 Ga0501072_0000378
778 Ga0501073_0000062
779 Ga0501074_0003814
780 Ga0501076_0191460
781 Ga0501076_1497544
782 Ga0501079_0001399
783 Ga0501080_0009398
784 Ga0501080_0431121
785 Ga0501080_0458441
786 Ga0501083_0000341
787 Ga0501035_0000123
788 Ga0501035_0256269
789 Ga0501035_0656953
790 Ga0501044_0000100
791 Ga0501044_0030904
792 Ga0501044_0258970
793 Ga0501045_0437318
794 nmdc:mga03683_63731_c1
795 nmdc:mga00v17_193210_c1
796 nmdc:mga0k408_411478_c1
797 nmdc:mga0k408_544712_c1
798 nmdc:mga05p37_153170_c1
799 nmdc:mga08y16_568990_c1
800 nmdc:mga0sz30_59676_c1
801 Ga0495601_0096469
802 Ga0495612_0160375
803 Ga0495655_0010151
804 Ga0495595_0013262
805 Ga0495619_0136649
806 Ga0500578_0218664
807 Ga0500595_065454
808 Ga0500626_088127
809 Ga0500559_0177901
810 Ga0500590_088980
811 Ga0500620_105747
812 Ga0500636_0524392
813 Ga0500649_155537
814 Ga0500552_037235
815 Ga0501084_0033906
816 Ga0501084_0658363
817 Ga0500661_002444
818 Ga0501082_0001776
819 Ga0466962_0574447
820 2509152163
821 2513642172
822 2513659494
823 2513718224
824 2513859399
825 2513888596
826 2513921573
827 2517889035
828 2524441425
829 2524537469
830 2671122631
831 2728748448
832 2745077559
833 2793072727
834 2818237838
835 2824609008
836 2824617726
837 2824661015
838 2844315526
839 2857516371
840 2876769623
841 2885418586
842 2888390518
843 2888420140
844 2903733706
845 2903758813
846 2904691022
847 2904708419
848 2906609478
849 2906613592
850 2906635815
851 2906650290
852 2906668124
853 2908747636
854 2908757080
855 2922434028
856 2932809237
857 2935636055
858 2935966738
859 2941512641
860 2941520521
861 2941528535
862 2941535360
863 3005475257
864 3005508997
865 3005595217
866 8006931939
867 8019562634
868 8019572713
869 8056691127
870 8056971474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04995

CcmD

Heme exporter protein D (CcmD)

6

49

0.98

Map