F442717

General Info

Members Datasets Scaffolds Average Seq Length
432 202 424 168

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_151478_c1|nmdc:mga06r32_151478_c1_846_1481
Length 203
Sequence LPVESQKSAIRNPQSNLYNPRFPVRHQNQTFNTKGEQMASISFKGNPVTLAGGEVMAGQNAPDFRLQKIDMSDYTLATGAGKTRIIAAVPSLDTPVCDAETRRFNEEAAKLPNVEIVCVSMDLPFAMKRWCGAAGVDKVMAASDHRDASFGSNYGVLIQGGPLDRLHARAVFVIDPDNKVKYAEYVSDIAEHPNYAAALAAAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
5 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
6 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
7 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
8 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
9 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
104 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
129 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
130 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
131 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
132 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
135 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.28
Metatranscriptomes 7.87
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 0.46
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_521879 2162886007 Bacteria 2022
2 Ga0065704_10006464 3300005289 Bacteria 5153
3 Ga0065704_10073766 3300005289 Bacteria 6807
4 Ga0065704_10325701 3300005289 Bacteria 846
5 Ga0065707_10005493 3300005295 Bacteria 4019
6 Ga0065707_10291558 3300005295 Unclassified 1024
7 Ga0070690_101251961 3300005330 Bacteria 593
8 Ga0070680_100052952 3300005336 Bacteria 3312
9 Ga0070680_100420884 3300005336 Bacteria 1140
10 Ga0070703_10000289 3300005406 Bacteria 23238
11 Ga0070709_10000008 3300005434 Bacteria 181034
12 Ga0070705_100003998 3300005440 Bacteria 7201
13 Ga0070694_100138957 3300005444 Bacteria 1762
14 Ga0070694_100186853 3300005444 Bacteria 1536
15 Ga0070694_101188014 3300005444 Bacteria 639
16 Ga0070708_100028757 3300005445 Bacteria 4785
17 Ga0070708_100207721 3300005445 Bacteria 1834
18 Ga0070662_100182109 3300005457 Unclassified 1657
19 Ga0070706_100000020 3300005467 Bacteria 165628
20 Ga0070707_100204805 3300005468 Unclassified 1923
21 Ga0070707_100839017 3300005468 Unclassified 883
22 Ga0070698_100067550 3300005471 Bacteria 3594
23 Ga0070698_100247653 3300005471 Bacteria 1715
24 Ga0070699_100000083 3300005518 Bacteria 89561
25 Ga0070699_100226982 3300005518 Bacteria 1665
26 Ga0070697_100043489 3300005536 Bacteria 3637
27 Ga0070697_100568033 3300005536 Unclassified 995
28 Ga0070697_101046216 3300005536 Bacteria 726
29 Ga0068853_100014061 3300005539 Bacteria 6551
30 Ga0068853_100477287 3300005539 Bacteria 1175
31 Ga0070672_100874403 3300005543 Bacteria 793
32 Ga0070686_100239037 3300005544 Unclassified 1321
33 Ga0070695_100439867 3300005545 Unclassified 997
34 Ga0070695_100981145 3300005545 Viruses 686
35 Ga0070696_100000120 3300005546 Bacteria 41117
36 Ga0070696_100727720 3300005546 Bacteria 811
37 Ga0070693_100048229 3300005547 Bacteria 2425
38 Ga0070665_100000830 3300005548 Bacteria 40352
39 Ga0070665_101441680 3300005548 Unclassified 697
40 Ga0070704_100638436 3300005549 Bacteria 939
41 Ga0070702_100153171 3300005615 Bacteria 1482
42 Ga0068852_100617764 3300005616 Bacteria 1089
43 Ga0068859_100459642 3300005617 Bacteria 1369
44 Ga0068859_100857990 3300005617 Bacteria 994
45 Ga0068864_100439908 3300005618 Bacteria 1245
46 Ga0068863_101655281 3300005841 Archaea 649
47 Ga0068862_100991835 3300005844 Unclassified 830
48 Ga0081455_10002325 3300005937 Bacteria 22678
49 Ga0081455_10010341 3300005937 Bacteria 9480
50 Ga0081455_10174993 3300005937 Bacteria 1631
51 Ga0081455_10198912 3300005937 Bacteria 1502
52 Ga0081540_1214317 3300005983 Bacteria 690
53 Ga0081539_10000924 3300005985 Bacteria 55237
54 Ga0081539_10105318 3300005985 Unclassified 1430
55 Ga0075432_10014531 3300006058 Bacteria 2682
56 Ga0075432_10137851 3300006058 Bacteria 929
57 Ga0070716_100241507 3300006173 Bacteria 1225
58 Ga0070716_100586048 3300006173 Unclassified 837
59 Ga0075427_10044943 3300006194 Bacteria 751
60 Ga0068871_101458033 3300006358 Unclassified 646
61 Ga0075428_100046316 3300006844 Bacteria 4777
62 Ga0075428_100065319 3300006844 Bacteria 3984
63 Ga0075428_100200808 3300006844 Bacteria 2155
64 Ga0075428_100243249 3300006844 Bacteria 1941
65 Ga0075428_100912548 3300006844 Unclassified 931
66 Ga0075428_101116317 3300006844 Bacteria 833
67 Ga0075430_100058381 3300006846 Unclassified 3244
68 Ga0075431_100128994 3300006847 Bacteria 2609
69 Ga0075431_100151758 3300006847 Bacteria 2385
70 Ga0075431_100243806 3300006847 Bacteria 1827
71 Ga0075431_100261096 3300006847 Bacteria 1757
72 Ga0075431_100345671 3300006847 Bacteria 1496
73 Ga0075431_100385171 3300006847 Bacteria 1405
74 Ga0075431_100445291 3300006847 Bacteria 1291
75 Ga0075433_10122599 3300006852 Bacteria 2308
76 Ga0075433_10133121 3300006852 Unclassified 2209
77 Ga0075433_10256722 3300006852 Bacteria 1550
78 Ga0075433_10280412 3300006852 Bacteria 1476
79 Ga0075433_10320314 3300006852 Bacteria 1372
80 Ga0075433_11204839 3300006852 Bacteria 657
81 Ga0075434_100094150 3300006871 Unclassified 3000
82 Ga0075434_100133416 3300006871 Bacteria 2503
83 Ga0075434_100696025 3300006871 Unclassified 1034
84 Ga0075434_101831311 3300006871 Bacteria 613
85 Ga0075429_100038276 3300006880 Bacteria 4175
86 Ga0075429_100337576 3300006880 Bacteria 1319
87 Ga0075429_100526697 3300006880 Bacteria 1036
88 Ga0075429_100559024 3300006880 Bacteria 1003
89 Ga0075429_100821134 3300006880 Unclassified 814
90 Ga0075436_100182126 3300006914 Bacteria 1485
91 Ga0075436_100430271 3300006914 Bacteria 959
92 Ga0097620_100459539 3300006931 Bacteria 1369
93 Ga0097620_100858116 3300006931 Bacteria 994
94 Ga0075435_100150544 3300007076 Bacteria 1956
95 Ga0075435_101020407 3300007076 Bacteria 722
96 Ga0075435_101070595 3300007076 Unclassified 705
97 Ga0075435_101150403 3300007076 Unclassified 679
98 Ga0105240_10120018 3300009093 Unclassified 3167
99 Ga0105240_10381889 3300009093 Bacteria 1591
100 Ga0111539_10166907 3300009094 Bacteria 2573
101 Ga0111539_10171173 3300009094 Bacteria 2537
102 Ga0111539_10239947 3300009094 Bacteria 2110
103 Ga0105245_12125786 3300009098 Unclassified 615
104 Ga0105245_12197616 3300009098 Unclassified 606
105 Ga0114129_10019471 3300009147 Bacteria 9664
106 Ga0114129_10026004 3300009147 Bacteria 8288
107 Ga0114129_10064756 3300009147 Bacteria 5101
108 Ga0114129_10071602 3300009147 Bacteria 4834
109 Ga0114129_10107140 3300009147 Bacteria 3860
110 Ga0114129_10168938 3300009147 Bacteria 2983
111 Ga0114129_10207881 3300009147 Bacteria 2648
112 Ga0114129_10232670 3300009147 Bacteria 2481
113 Ga0114129_10397329 3300009147 Bacteria 1817
114 Ga0114129_10726148 3300009147 Unclassified 1274
115 Ga0114129_10895706 3300009147 Bacteria 1125
116 Ga0114129_11028679 3300009147 Unclassified 1036
117 Ga0114129_11951429 3300009147 Unclassified 711
118 Ga0105243_10000003 3300009148 Bacteria 712931
119 Ga0105242_10520909 3300009176 Unclassified 1134
120 Ga0105248_11180839 3300009177 Unclassified 865
121 Ga0105238_10000580 3300009551 Bacteria 38403
122 Ga0105249_10519704 3300009553 Unclassified 1238
123 Ga0105239_10011879 3300010375 Bacteria 9716
124 Ga0157378_10069479 3300013297 Bacteria 3160
125 Ga0157378_10463697 3300013297 Unclassified 1259
126 Ga0157375_10539599 3300013308 Bacteria 1329
127 Ga0157380_11133939 3300014326 Bacteria 823
128 Ga0157376_10530829 3300014969 Unclassified 1161
129 Ga0207653_10000339 3300025885 Bacteria 24285
130 Ga0207685_10086104 3300025905 Bacteria 1312
131 Ga0207699_10000005 3300025906 Bacteria 534560
132 Ga0207684_10000215 3300025910 Bacteria 89389
133 Ga0207684_11460902 3300025910 Unclassified 558
134 Ga0207707_10548474 3300025912 Bacteria 982
135 Ga0207695_10086844 3300025913 Unclassified 3153
136 Ga0207695_10554094 3300025913 Bacteria 1031
137 Ga0207660_10232884 3300025917 Bacteria 1449
138 Ga0207646_10672638 3300025922 Unclassified 927
139 Ga0207681_11098805 3300025923 Unclassified 668
140 Ga0207694_10010306 3300025924 Bacteria 7046
141 Ga0207664_10403038 3300025929 Bacteria 1217
142 Ga0207709_10000008 3300025935 Bacteria 713099
143 Ga0207665_10166348 3300025939 Bacteria 1590
144 Ga0207665_10212767 3300025939 Unclassified 1413
145 Ga0207711_10810618 3300025941 Unclassified 872
146 Ga0207639_10551847 3300026041 Bacteria 1058
147 Ga0207708_11216283 3300026075 Bacteria 659
148 Ga0209973_1010763 3300027252 Bacteria 1087
149 Ga0210000_1011331 3300027462 Bacteria 1321
150 Ga0209968_1044110 3300027526 Bacteria 766
151 Ga0210002_1025131 3300027617 Bacteria 973
152 Ga0209971_1002517 3300027682 Unclassified 4396
153 Ga0209966_1006911 3300027695 Bacteria 1980
154 Ga0209998_10006123 3300027717 Bacteria 2502
155 Ga0209998_10015203 3300027717 Bacteria 1609
156 Ga0209974_10004904 3300027876 Unclassified 4732
157 Ga0207428_10007637 3300027907 Bacteria 9844
158 Ga0207428_10051139 3300027907 Bacteria 3303
159 Ga0207428_10077765 3300027907 Unclassified 2598
160 Ga0207428_10189547 3300027907 Bacteria 1550
161 Ga0207428_10400017 3300027907 Bacteria 1006
162 Ga0268266_10001828 3300028379 Bacteria 24052
163 Ga0268265_10855497 3300028380 Unclassified 890
164 Ga0268265_11384532 3300028380 Unclassified 705
165 Ga0265318_10015282 3300028577 Bacteria 3197
166 Ga0265323_10006746 3300028653 Bacteria 4810
167 Ga0265322_10011551 3300028654 Bacteria 2559
168 Ga0265760_10003566 3300031090 Bacteria 4513
169 Ga0265327_10006750 3300031251 Bacteria 9075
170 Ga0265316_10400527 3300031344 Bacteria 988
171 Ga0307408_101039861 3300031548 Unclassified 757
172 Ga0316575_10011380 3300031665 Bacteria 3291
173 Ga0316575_10085607 3300031665 Bacteria 1273
174 Ga0316579_10052472 3300031691 Bacteria 1909
175 Ga0316576_10186797 3300031727 Bacteria 1563
176 Ga0316578_10000344 3300031728 Bacteria 14665
177 Ga0316578_10031482 3300031728 Unclassified 3023
178 Ga0316578_10197395 3300031728 Bacteria 1212
179 Ga0316577_10004900 3300031733 Bacteria 6972
180 Ga0316577_10018572 3300031733 Bacteria 3847
181 Ga0316577_10045363 3300031733 Bacteria 2457
182 Ga0307414_10249615 3300032004 Bacteria 1474
183 Ga0307415_101563479 3300032126 Unclassified 633
184 Ga0316583_10000970 3300032133 Bacteria 9242
185 Ga0316585_10002258 3300032137 Bacteria 5181
186 Ga0316593_10000496 3300032168 Bacteria 7311
187 Ga0316593_10017610 3300032168 Bacteria 2182
188 Ga0316593_10019106 3300032168 Bacteria 2114
189 Ga0316593_10025394 3300032168 Unclassified 1886
190 Ga0316593_10031315 3300032168 Bacteria 1733
191 Ga0316593_10040798 3300032168 Bacteria 1543
192 Ga0316593_10044618 3300032168 Bacteria 1484
193 Ga0316593_10061265 3300032168 Bacteria 1287
194 Ga0316593_10080903 3300032168 Unclassified 1134
195 Ga0316593_10151573 3300032168 Bacteria 843
196 Ga0316593_10201144 3300032168 Unclassified 736
197 Ga0316593_10310385 3300032168 Bacteria 598
198 Ga0316593_10356947 3300032168 Bacteria 560
199 Ga0316592_1000779 3300033524 Bacteria 4748
200 Ga0316592_1002966 3300033524 Bacteria 2998
201 Ga0316592_1004028 3300033524 Bacteria 2703
202 Ga0316592_1014291 3300033524 Bacteria 1645
203 Ga0316586_1038168 3300033527 Bacteria 838
204 Ga0316588_1020345 3300033528 Bacteria 1502
205 Ga0316588_1027525 3300033528 Bacteria 1322
206 Ga0316588_1042737 3300033528 Bacteria 1087
207 Ga0316587_1006583 3300033529 Unclassified 1780
208 Ga0316596_1001203 3300033541 Bacteria 5104
209 Ga0316596_1004865 3300033541 Unclassified 3036
210 Ga0316596_1008815 3300033541 Bacteria 2412
211 Ga0316596_1013053 3300033541 Bacteria 2049
212 Ga0316596_1016996 3300033541 Bacteria 1826
213 Ga0316596_1019481 3300033541 Bacteria 1722
214 Ga0316596_1044652 3300033541 Bacteria 1168
215 Ga0316596_1074510 3300033541 Bacteria 910
216 Ga0316596_1130625 3300033541 Bacteria 686
217 Ga0316596_1131899 3300033541 Bacteria 682
218 Ga0316596_1163481 3300033541 Bacteria 613
219 Ga0373928_0149833 3300035084 Bacteria 645
220 Ga0373939_0079636 3300035114 Bacteria 1085
221 Ga0373943_0116991 3300035170 Unclassified 1413
222 Ga0316574_0000051 3300035398 Bacteria 29702
223 Ga0316574_0198643 3300035398 Bacteria 1289
224 Ga0373931_0176748 3300035691 Bacteria 1261
225 Ga0373933_0124927 3300035724 Bacteria 1614
226 Ga0316582_0000298 3300036647 Bacteria 17147
227 Ga0316582_0022801 3300036647 Bacteria 3723
228 Ga0316584_0003125 3300036712 Bacteria 10699
229 Ga0316584_0057142 3300036712 Unclassified 2921
230 Ga0373925_0227794 3300037068 Unclassified 1489
231 Ga0395899_0414231 3300037312 Bacteria 889
232 Ga0316581_0011974 3300037588 Bacteria 2435
233 Ga0316581_0103048 3300037588 Bacteria 879
234 Ga0400484_07871 3300038725 Bacteria 7187
235 Ga0400484_14175 3300038725 Bacteria 2844
236 Ga0400490_48674 3300038726 Unclassified 3972
237 Ga0400491_01966 3300038727 Bacteria 5108
238 Ga0400488_04635 3300038741 Bacteria 1133
239 Ga0400488_20944 3300038741 Unclassified 2404
240 Ga0400483_141944 3300039062 Bacteria 4051
241 Ga0400489_54574 3300039093 Unclassified 1016
242 Ga0400487_64204 3300039110 Bacteria 3162
243 Ga0439453_0035405 3300041408 Bacteria 962
244 Ga0451800_0653148 3300041459 Bacteria 665
245 Ga0451577_0000183 3300042876 Bacteria 133304
246 Ga0451577_0000944 3300042876 Bacteria 42644
247 Ga0451577_0031375 3300042876 Bacteria 4795
248 Ga0451577_0040687 3300042876 Bacteria 4172
249 Ga0451577_0341302 3300042876 Bacteria 1358
250 Ga0451577_0983390 3300042876 Bacteria 758
251 Ga0453683_0000001 3300044673 Bacteria 1384965
252 Ga0453683_0000257 3300044673 Bacteria 69856
253 Ga0453683_0015079 3300044673 Bacteria 5016
254 Ga0453683_0087125 3300044673 Bacteria 1957
255 Ga0453683_0093279 3300044673 Bacteria 1888
256 Ga0453683_0143734 3300044673 Bacteria 1506
257 Ga0453683_0218405 3300044673 Bacteria 1212
258 Ga0453683_0610321 3300044673 Unclassified 712
259 Ga0453684_0000697 3300044712 Bacteria 119515
260 Ga0453684_0002073 3300044712 Bacteria 50911
261 Ga0453684_0009803 3300044712 Bacteria 16609
262 Ga0453684_0028223 3300044712 Bacteria 8019
263 Ga0453684_0030246 3300044712 Bacteria 7656
264 Ga0453684_0055053 3300044712 Bacteria 5174
265 Ga0453684_0184582 3300044712 Bacteria 2446
266 Ga0453684_0197966 3300044712 Bacteria 2344
267 Ga0453684_0269742 3300044712 Bacteria 1945
268 Ga0453684_1076571 3300044712 Bacteria 851
269 Ga0451576_0001340 3300045051 Bacteria 42595
270 Ga0451576_0010191 3300045051 Bacteria 10806
271 Ga0451576_0111456 3300045051 Bacteria 2848
272 Ga0451576_0337241 3300045051 Bacteria 1578
273 Ga0451576_0428285 3300045051 Bacteria 1388
274 Ga0451576_2378404 3300045051 Bacteria 542
275 Ga0495662_0477869 3300046476 Bacteria 611
276 Ga0495630_0258125 3300046517 Bacteria 1331
277 Ga0495658_0284584 3300046683 Unclassified 1044
278 Ga0495669_0539025 3300046684 Bacteria 568
279 Ga0496109_0000050 3300048912 Bacteria 126918
280 Ga0496116_0002152 3300048919 Bacteria 20972
281 Ga0496117_0002900 3300048920 Bacteria 20753
282 Ga0496118_0035618 3300048921 Bacteria 4038
283 Ga0496122_0006969 3300048925 Bacteria 12730
284 Ga0496123_0019470 3300048926 Bacteria 5348
285 Ga0496125_0241902 3300048928 Bacteria 1145
286 Ga0501031_0027626 3300049568 Unclassified 3699
287 Ga0501031_0400325 3300049568 Bacteria 888
288 Ga0501032_0163557 3300049569 Unclassified 1461
289 Ga0501032_0409655 3300049569 Bacteria 870
290 Ga0501033_0031249 3300049570 Unclassified 4002
291 Ga0501033_0669852 3300049570 Bacteria 708
292 Ga0501034_0099968 3300049571 Bacteria 2895
293 Ga0501034_0160830 3300049571 Bacteria 2217
294 Ga0501034_0274619 3300049571 Unclassified 1626
295 Ga0501036_0022682 3300049572 Bacteria 5283
296 Ga0501037_0154072 3300049573 Bacteria 1641
297 Ga0501037_0406256 3300049573 Unclassified 933
298 Ga0501038_0792585 3300049574 Unclassified 704
299 Ga0501039_0001537 3300049575 Bacteria 16958
300 Ga0501039_0396072 3300049575 Unclassified 1084
301 Ga0501039_1110087 3300049575 Bacteria 613
302 Ga0501040_0000164 3300049576 Bacteria 37286
303 Ga0501041_0000225 3300049577 Bacteria 26270
304 Ga0501041_0657822 3300049577 Bacteria 670
305 Ga0501042_0010560 3300049578 Bacteria 6199
306 Ga0501042_0111104 3300049578 Unclassified 1973
307 Ga0501043_0037072 3300049579 Bacteria 3836
308 Ga0501043_0147264 3300049579 Bacteria 1843
309 Ga0501043_0485966 3300049579 Unclassified 924
310 Ga0501043_0575202 3300049579 Unclassified 834
311 Ga0501046_0034256 3300049580 Bacteria 4099
312 Ga0501046_0118465 3300049580 Bacteria 2017
313 Ga0501046_0215486 3300049580 Bacteria 1424
314 Ga0501046_0265633 3300049580 Unclassified 1260
315 Ga0501046_0316510 3300049580 Unclassified 1138
316 Ga0501048_0017829 3300049582 Bacteria 5224
317 Ga0501048_0035456 3300049582 Unclassified 3591
318 Ga0501068_0069684 3300049584 Unclassified 2144
319 Ga0501069_0140107 3300049585 Unclassified 1387
320 Ga0501069_0276717 3300049585 Bacteria 982
321 Ga0501070_0069431 3300049586 Bacteria 2917
322 Ga0501070_0768238 3300049586 Unclassified 758
323 Ga0501071_0001466 3300049587 Bacteria 13692
324 Ga0501071_0056214 3300049587 Bacteria 2842
325 Ga0501071_0208149 3300049587 Unclassified 1470
326 Ga0501071_0256518 3300049587 Unclassified 1320
327 Ga0501072_0001053 3300049588 Bacteria 20439
328 Ga0501072_1061563 3300049588 Bacteria 631
329 Ga0501073_0399274 3300049589 Bacteria 950
330 Ga0501073_0453418 3300049589 Unclassified 886
331 Ga0501074_0028895 3300049590 Bacteria 4016
332 Ga0501075_0034205 3300049591 Bacteria 3783
333 Ga0501075_0101635 3300049591 Unclassified 2183
334 Ga0501076_0000156 3300049592 Bacteria 39388
335 Ga0501076_0037938 3300049592 Unclassified 3781
336 Ga0501076_0292123 3300049592 Bacteria 1335
337 Ga0501076_0905492 3300049592 Bacteria 727
338 Ga0501076_1418071 3300049592 Bacteria 571
339 Ga0501077_0120336 3300049593 Bacteria 1664
340 Ga0501077_0162399 3300049593 Bacteria 1418
341 Ga0501077_0243593 3300049593 Unclassified 1143
342 Ga0501077_0837467 3300049593 Unclassified 591
343 Ga0501079_0003016 3300049741 Bacteria 12313
344 Ga0501079_0104686 3300049741 Unclassified 2195
345 Ga0501079_0130514 3300049741 Bacteria 1955
346 Ga0501079_0301440 3300049741 Unclassified 1254
347 Ga0501079_0801274 3300049741 Unclassified 742
348 Ga0501080_0002771 3300049742 Bacteria 15399
349 Ga0501080_0407018 3300049742 Unclassified 1223
350 Ga0501081_0000611 3300049743 Bacteria 20378
351 Ga0501081_0036986 3300049743 Bacteria 3330
352 Ga0501081_0514602 3300049743 Unclassified 892
353 Ga0501081_0712010 3300049743 Bacteria 754
354 Ga0501083_0017894 3300049744 Bacteria 4943
355 Ga0501083_0171057 3300049744 Unclassified 1420
356 Ga0501035_0145299 3300049822 Unclassified 2060
357 Ga0501044_0032835 3300049823 Bacteria 5456
358 Ga0501045_0041958 3300049824 Unclassified 3329
359 Ga0501045_0142798 3300049824 Bacteria 1780
360 Ga0501045_0210597 3300049824 Unclassified 1448
361 Ga0501045_0486537 3300049824 Bacteria 917
362 nmdc:mga06z11_125596_c1 3300050494 Bacteria 1435
363 nmdc:mga05p37_13848_c1 3300050507 Bacteria 9663
364 nmdc:mga05p37_140276_c1 3300050507 Bacteria 2962
365 nmdc:mga05p37_191667_c1 3300050507 Bacteria 2481
366 nmdc:mga05p37_1918_c1 3300050507 Bacteria 24184
367 nmdc:mga05p37_194656_c1 3300050507 Bacteria 2459
368 nmdc:mga05p37_242848_c1 3300050507 Bacteria 2164
369 nmdc:mga05p37_24470_c1 3300050507 Bacteria 7340
370 nmdc:mga05p37_298860_c1 3300050507 Bacteria 1914
371 nmdc:mga05p37_349797_c1 3300050507 Bacteria 1740
372 nmdc:mga05p37_36772_c1 3300050507 Bacteria 6005
373 nmdc:mga05p37_431552_c1 3300050507 Bacteria 1531
374 nmdc:mga05p37_903605_c1 3300050507 Unclassified 952
375 nmdc:mga05p37_993292_c1 3300050507 Bacteria 893
376 nmdc:mga09592_207357_c1 3300050508 Bacteria 1698
377 nmdc:mga09592_271794_c1 3300050508 Bacteria 1470
378 nmdc:mga09592_278630_c1 3300050508 Bacteria 1450
379 nmdc:mga09592_341731_c1 3300050508 Unclassified 1296
380 nmdc:mga0qj67_21110_c1 3300050509 Bacteria 4993
381 nmdc:mga0qj67_392515_c1 3300050509 Unclassified 1120
382 nmdc:mga06r32_151478_c1 3300050510 Bacteria 2298
383 nmdc:mga06r32_205037_c1 3300050510 Bacteria 1960
384 nmdc:mga06r32_349666_c1 3300050510 Bacteria 1463
385 nmdc:mga06r32_358392_c1 3300050510 Bacteria 1443
386 nmdc:mga06r32_41487_c1 3300050510 Bacteria 4372
387 nmdc:mga08y16_349635_c1 3300050511 Bacteria 1519
388 nmdc:mga08y16_899185_c1 3300050511 Bacteria 871
389 nmdc:mga0n895_184385_c1 3300050512 Bacteria 2118
390 nmdc:mga0n895_194653_c1 3300050512 Bacteria 2059
391 nmdc:mga0n895_217964_c1 3300050512 Bacteria 1938
392 nmdc:mga0n895_27679_c1 3300050512 Bacteria 5387
393 nmdc:mga0n895_387641_c1 3300050512 Unclassified 1413
394 nmdc:mga0n895_396560_c1 3300050512 Bacteria 1396
395 nmdc:mga0rr50_124759_c1 3300050513 Bacteria 2054
396 nmdc:mga0rr50_210016_c1 3300050513 Bacteria 1603
397 nmdc:mga0rr50_96094_c1 3300050513 Bacteria 2318
398 nmdc:mga08x19_79897_c1 3300050514 Bacteria 2145
399 nmdc:mga0a205_11748_c1 3300050515 Bacteria 8077
400 nmdc:mga0a205_226654_c1 3300050515 Unclassified 1753
401 nmdc:mga0a205_711146_c1 3300050515 Unclassified 854
402 nmdc:mga0a205_739088_c1 3300050515 Bacteria 833
403 nmdc:mga0a205_801153_c1 3300050515 Unclassified 790
404 nmdc:mga0a205_80741_c1 3300050515 Bacteria 3142
405 nmdc:mga0a205_97398_c1 3300050515 Bacteria 2418
406 Ga0500610_0291854 3300053079 Bacteria 725
407 Ga0500641_0028238 3300053096 Bacteria 2190
408 Ga0500555_023739 3300053103 Bacteria 1758
409 Ga0500569_049812 3300053109 Bacteria 1260
410 Ga0500594_0110835 3300053118 Bacteria 853
411 Ga0500627_0292350 3300053158 Bacteria 713
412 Ga0501084_0002986 3300054114 Bacteria 13694
413 Ga0501084_0058531 3300054114 Unclassified 3224
414 Ga0501084_0084991 3300054114 Bacteria 2657
415 Ga0501084_1159145 3300054114 Bacteria 648
416 Ga0501082_0000401 3300060353 Bacteria 38430
417 Ga0501082_0303448 3300060353 Unclassified 1390
418 Ga0530510_0008614 3300061734 Bacteria 7125
419 Ga0530510_0049713 3300061734 Unclassified 3029
420 Ga0530510_0138727 3300061734 Bacteria 1791
421 Ga0530510_0224368 3300061734 Bacteria 1397
422 Ga0530510_0317224 3300061734 Bacteria 1168
423 Ga0530510_0434383 3300061734 Bacteria 992
424 Ga0530510_0743062 3300061734 Bacteria 748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2887375801 2887379775 134
2 3300035724 Ga0373933_0124927 Ga0373933_0124927_1067_1516 141
3 3300028654 Ga0265322_10011551 Ga0265322_100115512 145
4 3300045051 Ga0451576_2378404 Ga0451576_2378404_15_467 146
5 3300032168 Ga0316593_10080903 Ga0316593_100809031 150
6 3300033541 Ga0316596_1074510 Ga0316596_10745101 150
7 3300044712 Ga0453684_0028223 Ga0453684_0028223_2214_2699 157
8 3300032126 Ga0307415_101563479 Ga0307415_1015634791 158
9 3300035398 Ga0316574_0198643 Ga0316574_0198643_216_704 158
10 3300050494 nmdc:mga06z11_125596_c1 nmdc:mga06z11_125596_c1_510_1037 158
11 iso_pu_bacteria 2896344016 2896346108 161
12 iso_pu_bacteria 2898713307 2898713691 161
13 3300031665 Ga0316575_10085607 Ga0316575_100856072 162
14 iso_pu_bacteria 2684623219 2687235363 162
15 iso_pu_bacteria 2721755487 2722730811 162
16 iso_pu_bacteria 2890737413 2890740544 162
17 iso_pu_bacteria 2904780799 2904783205 162
18 iso_pu_bacteria 2919177583 2919180813 162
19 3300005295 Ga0065707_10291558 Ga0065707_102915582 163
20 3300005548 Ga0070665_100000830 Ga0070665_10000083042 163
21 3300005548 Ga0070665_101441680 Ga0070665_1014416801 163
22 3300005618 Ga0068864_100439908 Ga0068864_1004399082 163
23 3300006358 Ga0068871_101458033 Ga0068871_1014580331 163
24 3300006844 Ga0075428_100243249 Ga0075428_1002432492 163
25 3300009093 Ga0105240_10120018 Ga0105240_101200182 163
26 3300009093 Ga0105240_10381889 Ga0105240_103818892 163
27 3300009098 Ga0105245_12125786 Ga0105245_121257861 163
28 3300009098 Ga0105245_12197616 Ga0105245_121976161 163
29 3300010375 Ga0105239_10011879 Ga0105239_100118794 163
30 3300014326 Ga0157380_11133939 Ga0157380_111339392 163
31 3300025913 Ga0207695_10086844 Ga0207695_100868442 163
32 3300025913 Ga0207695_10554094 Ga0207695_105540941 163
33 3300028379 Ga0268266_10001828 Ga0268266_1000182819 163
34 3300028380 Ga0268265_11384532 Ga0268265_113845322 163
35 3300028577 Ga0265318_10015282 Ga0265318_100152822 163
36 3300028653 Ga0265323_10006746 Ga0265323_100067463 163
37 3300031344 Ga0265316_10400527 Ga0265316_104005271 163
38 3300031665 Ga0316575_10011380 Ga0316575_100113802 163
39 3300031691 Ga0316579_10052472 Ga0316579_100524722 163
40 3300031727 Ga0316576_10186797 Ga0316576_101867972 163
41 3300031728 Ga0316578_10000344 Ga0316578_100003448 163
42 3300031728 Ga0316578_10031482 Ga0316578_100314822 163
43 3300031728 Ga0316578_10197395 Ga0316578_101973952 163
44 3300031733 Ga0316577_10004900 Ga0316577_100049003 163
45 3300031733 Ga0316577_10018572 Ga0316577_100185724 163
46 3300031733 Ga0316577_10045363 Ga0316577_100453632 163
47 3300032133 Ga0316583_10000970 Ga0316583_100009701 163
48 3300032137 Ga0316585_10002258 Ga0316585_100022583 163
49 3300032168 Ga0316593_10000496 Ga0316593_100004969 163
50 3300032168 Ga0316593_10017610 Ga0316593_100176103 163
51 3300032168 Ga0316593_10019106 Ga0316593_100191064 163
52 3300032168 Ga0316593_10025394 Ga0316593_100253942 163
53 3300032168 Ga0316593_10031315 Ga0316593_100313151 163
54 3300032168 Ga0316593_10040798 Ga0316593_100407982 163
55 3300032168 Ga0316593_10044618 Ga0316593_100446181 163
56 3300032168 Ga0316593_10061265 Ga0316593_100612651 163
57 3300032168 Ga0316593_10151573 Ga0316593_101515731 163
58 3300032168 Ga0316593_10201144 Ga0316593_102011441 163
59 3300032168 Ga0316593_10310385 Ga0316593_103103851 163
60 3300032168 Ga0316593_10356947 Ga0316593_103569471 163
61 3300033524 Ga0316592_1000779 Ga0316592_10007794 163
62 3300033524 Ga0316592_1002966 Ga0316592_10029663 163
63 3300033524 Ga0316592_1004028 Ga0316592_10040284 163
64 3300033524 Ga0316592_1014291 Ga0316592_10142913 163
65 3300033527 Ga0316586_1038168 Ga0316586_10381682 163
66 3300033528 Ga0316588_1020345 Ga0316588_10203454 163
67 3300033528 Ga0316588_1027525 Ga0316588_10275253 163
68 3300033528 Ga0316588_1042737 Ga0316588_10427372 163
69 3300033529 Ga0316587_1006583 Ga0316587_10065831 163
70 3300033541 Ga0316596_1001203 Ga0316596_10012036 163
71 3300033541 Ga0316596_1004865 Ga0316596_10048656 163
72 3300033541 Ga0316596_1008815 Ga0316596_10088151 163
73 3300033541 Ga0316596_1013053 Ga0316596_10130532 163
74 3300033541 Ga0316596_1016996 Ga0316596_10169962 163
75 3300033541 Ga0316596_1019481 Ga0316596_10194814 163
76 3300033541 Ga0316596_1044652 Ga0316596_10446521 163
77 3300033541 Ga0316596_1130625 Ga0316596_11306252 163
78 3300033541 Ga0316596_1131899 Ga0316596_11318991 163
79 3300033541 Ga0316596_1163481 Ga0316596_11634811 163
80 3300035398 Ga0316574_0000051 Ga0316574_0000051_8864_9379 163
81 3300036647 Ga0316582_0000298 Ga0316582_0000298_8860_9375 163
82 3300036647 Ga0316582_0022801 Ga0316582_0022801_3120_3635 163
83 3300036712 Ga0316584_0003125 Ga0316584_0003125_1031_1546 163
84 3300036712 Ga0316584_0057142 Ga0316584_0057142_2167_2682 163
85 3300037312 Ga0395899_0414231 Ga0395899_0414231_141_665 163
86 3300037588 Ga0316581_0011974 Ga0316581_0011974_156_671 163
87 3300037588 Ga0316581_0103048 Ga0316581_0103048_150_722 163
88 3300038725 Ga0400484_07871 Ga0400484_07871_1307_1822 163
89 3300038725 Ga0400484_14175 Ga0400484_14175_1504_2019 163
90 3300038726 Ga0400490_48674 Ga0400490_48674_2963_3478 163
91 3300038727 Ga0400491_01966 Ga0400491_01966_1219_1734 163
92 3300038741 Ga0400488_04635 Ga0400488_04635_364_879 163
93 3300038741 Ga0400488_20944 Ga0400488_20944_92_607 163
94 3300039062 Ga0400483_141944 Ga0400483_141944_3341_3856 163
95 3300039093 Ga0400489_54574 Ga0400489_54574_155_685 163
96 3300039110 Ga0400487_64204 Ga0400487_64204_51_566 163
97 3300042876 Ga0451577_0000183 Ga0451577_0000183_95528_96043 163
98 3300042876 Ga0451577_0000944 Ga0451577_0000944_28867_29382 163
99 3300042876 Ga0451577_0031375 Ga0451577_0031375_2785_3300 163
100 3300042876 Ga0451577_0040687 Ga0451577_0040687_947_1462 163
101 3300042876 Ga0451577_0341302 Ga0451577_0341302_395_910 163
102 3300042876 Ga0451577_0983390 Ga0451577_0983390_207_722 163
103 3300044673 Ga0453683_0000001 Ga0453683_0000001_167752_168267 163
104 3300044673 Ga0453683_0000257 Ga0453683_0000257_25245_25805 163
105 3300044673 Ga0453683_0015079 Ga0453683_0015079_1968_2483 163
106 3300044673 Ga0453683_0093279 Ga0453683_0093279_809_1327 163
107 3300044673 Ga0453683_0143734 Ga0453683_0143734_906_1421 163
108 3300044673 Ga0453683_0218405 Ga0453683_0218405_602_1117 163
109 3300044673 Ga0453683_0610321 Ga0453683_0610321_13_528 163
110 3300044712 Ga0453684_0000697 Ga0453684_0000697_22161_22676 163
111 3300044712 Ga0453684_0002073 Ga0453684_0002073_23595_24110 163
112 3300044712 Ga0453684_0009803 Ga0453684_0009803_7661_8176 163
113 3300044712 Ga0453684_0030246 Ga0453684_0030246_6459_6974 163
114 3300044712 Ga0453684_0055053 Ga0453684_0055053_3397_3930 163
115 3300044712 Ga0453684_0184582 Ga0453684_0184582_1337_1855 163
116 3300044712 Ga0453684_0269742 Ga0453684_0269742_1261_1776 163
117 3300045051 Ga0451576_0001340 Ga0451576_0001340_38436_38951 163
118 3300045051 Ga0451576_0010191 Ga0451576_0010191_7474_7989 163
119 3300045051 Ga0451576_0111456 Ga0451576_0111456_2061_2576 163
120 3300045051 Ga0451576_0337241 Ga0451576_0337241_321_836 163
121 3300045051 Ga0451576_0428285 Ga0451576_0428285_318_833 163
122 3300053109 Ga0500569_049812 Ga0500569_049812_659_1183 163
123 3300053118 Ga0500594_0110835 Ga0500594_0110835_229_753 163
124 3300041459 Ga0451800_0653148 Ga0451800_0653148_102_614 165
125 2162886007 SwRhRL2b_contig_521879 SwRhRL2b_0707.00019080 166
126 3300005289 Ga0065704_10006464 Ga0065704_100064642 166
127 3300005289 Ga0065704_10073766 Ga0065704_100737665 166
128 3300005289 Ga0065704_10325701 Ga0065704_103257012 166
129 3300005295 Ga0065707_10005493 Ga0065707_100054938 166
130 3300005330 Ga0070690_101251961 Ga0070690_1012519611 166
131 3300005336 Ga0070680_100052952 Ga0070680_1000529521 166
132 3300005336 Ga0070680_100420884 Ga0070680_1004208842 166
133 3300005406 Ga0070703_10000289 Ga0070703_1000028911 166
134 3300005434 Ga0070709_10000008 Ga0070709_1000000833 166
135 3300005440 Ga0070705_100003998 Ga0070705_1000039981 166
136 3300005444 Ga0070694_100138957 Ga0070694_1001389572 166
137 3300005444 Ga0070694_100186853 Ga0070694_1001868531 166
138 3300005444 Ga0070694_101188014 Ga0070694_1011880141 166
139 3300005445 Ga0070708_100028757 Ga0070708_1000287576 166
140 3300005445 Ga0070708_100207721 Ga0070708_1002077212 166
141 3300005457 Ga0070662_100182109 Ga0070662_1001821092 166
142 3300005467 Ga0070706_100000020 Ga0070706_10000002075 166
143 3300005468 Ga0070707_100204805 Ga0070707_1002048051 166
144 3300005468 Ga0070707_100839017 Ga0070707_1008390171 166
145 3300005471 Ga0070698_100067550 Ga0070698_1000675505 166
146 3300005471 Ga0070698_100247653 Ga0070698_1002476532 166
147 3300005518 Ga0070699_100000083 Ga0070699_10000008332 166
148 3300005518 Ga0070699_100226982 Ga0070699_1002269822 166
149 3300005536 Ga0070697_100043489 Ga0070697_1000434893 166
150 3300005536 Ga0070697_100568033 Ga0070697_1005680331 166
151 3300005536 Ga0070697_101046216 Ga0070697_1010462161 166
152 3300005539 Ga0068853_100014061 Ga0068853_1000140612 166
153 3300005539 Ga0068853_100477287 Ga0068853_1004772872 166
154 3300005543 Ga0070672_100874403 Ga0070672_1008744032 166
155 3300005544 Ga0070686_100239037 Ga0070686_1002390372 166
156 3300005545 Ga0070695_100439867 Ga0070695_1004398671 166
157 3300005545 Ga0070695_100981145 Ga0070695_1009811451 166
158 3300005546 Ga0070696_100000120 Ga0070696_10000012015 166
159 3300005546 Ga0070696_100727720 Ga0070696_1007277201 166
160 3300005547 Ga0070693_100048229 Ga0070693_1000482292 166
161 3300005549 Ga0070704_100638436 Ga0070704_1006384362 166
162 3300005615 Ga0070702_100153171 Ga0070702_1001531711 166
163 3300005616 Ga0068852_100617764 Ga0068852_1006177641 166
164 3300005617 Ga0068859_100459642 Ga0068859_1004596422 166
165 3300005617 Ga0068859_100857990 Ga0068859_1008579901 166
166 3300005841 Ga0068863_101655281 Ga0068863_1016552811 166
167 3300005844 Ga0068862_100991835 Ga0068862_1009918351 166
168 3300005937 Ga0081455_10002325 Ga0081455_100023257 166
169 3300005937 Ga0081455_10010341 Ga0081455_100103412 166
170 3300005937 Ga0081455_10174993 Ga0081455_101749932 166
171 3300005937 Ga0081455_10198912 Ga0081455_101989122 166
172 3300005983 Ga0081540_1214317 Ga0081540_12143171 166
173 3300005985 Ga0081539_10000924 Ga0081539_100009248 166
174 3300005985 Ga0081539_10105318 Ga0081539_101053181 166
175 3300006058 Ga0075432_10014531 Ga0075432_100145312 166
176 3300006058 Ga0075432_10137851 Ga0075432_101378511 166
177 3300006173 Ga0070716_100241507 Ga0070716_1002415072 166
178 3300006173 Ga0070716_100586048 Ga0070716_1005860482 166
179 3300006194 Ga0075427_10044943 Ga0075427_100449432 166
180 3300006844 Ga0075428_100046316 Ga0075428_1000463166 166
181 3300006844 Ga0075428_100065319 Ga0075428_1000653192 166
182 3300006844 Ga0075428_100200808 Ga0075428_1002008082 166
183 3300006844 Ga0075428_100912548 Ga0075428_1009125482 166
184 3300006844 Ga0075428_101116317 Ga0075428_1011163171 166
185 3300006846 Ga0075430_100058381 Ga0075430_1000583812 166
186 3300006847 Ga0075431_100128994 Ga0075431_1001289943 166
187 3300006847 Ga0075431_100151758 Ga0075431_1001517582 166
188 3300006847 Ga0075431_100243806 Ga0075431_1002438062 166
189 3300006847 Ga0075431_100261096 Ga0075431_1002610963 166
190 3300006847 Ga0075431_100345671 Ga0075431_1003456712 166
191 3300006847 Ga0075431_100385171 Ga0075431_1003851711 166
192 3300006847 Ga0075431_100445291 Ga0075431_1004452911 166
193 3300006852 Ga0075433_10122599 Ga0075433_101225992 166
194 3300006852 Ga0075433_10133121 Ga0075433_101331212 166
195 3300006852 Ga0075433_10256722 Ga0075433_102567223 166
196 3300006852 Ga0075433_10280412 Ga0075433_102804123 166
197 3300006852 Ga0075433_10320314 Ga0075433_103203141 166
198 3300006852 Ga0075433_11204839 Ga0075433_112048391 166
199 3300006871 Ga0075434_100094150 Ga0075434_1000941501 166
200 3300006871 Ga0075434_100133416 Ga0075434_1001334164 166
201 3300006871 Ga0075434_100696025 Ga0075434_1006960251 166
202 3300006871 Ga0075434_101831311 Ga0075434_1018313111 166
203 3300006880 Ga0075429_100038276 Ga0075429_1000382765 166
204 3300006880 Ga0075429_100337576 Ga0075429_1003375763 166
205 3300006880 Ga0075429_100526697 Ga0075429_1005266972 166
206 3300006880 Ga0075429_100559024 Ga0075429_1005590241 166
207 3300006880 Ga0075429_100821134 Ga0075429_1008211341 166
208 3300006914 Ga0075436_100182126 Ga0075436_1001821263 166
209 3300006914 Ga0075436_100430271 Ga0075436_1004302712 166
210 3300006931 Ga0097620_100459539 Ga0097620_1004595392 166
211 3300006931 Ga0097620_100858116 Ga0097620_1008581161 166
212 3300007076 Ga0075435_100150544 Ga0075435_1001505443 166
213 3300007076 Ga0075435_101020407 Ga0075435_1010204071 166
214 3300007076 Ga0075435_101070595 Ga0075435_1010705951 166
215 3300007076 Ga0075435_101150403 Ga0075435_1011504031 166
216 3300009094 Ga0111539_10166907 Ga0111539_101669072 166
217 3300009094 Ga0111539_10171173 Ga0111539_101711733 166
218 3300009094 Ga0111539_10239947 Ga0111539_102399472 166
219 3300009147 Ga0114129_10019471 Ga0114129_100194718 166
220 3300009147 Ga0114129_10026004 Ga0114129_100260048 166
221 3300009147 Ga0114129_10064756 Ga0114129_100647563 166
222 3300009147 Ga0114129_10071602 Ga0114129_100716022 166
223 3300009147 Ga0114129_10107140 Ga0114129_101071402 166
224 3300009147 Ga0114129_10168938 Ga0114129_101689384 166
225 3300009147 Ga0114129_10207881 Ga0114129_102078811 166
226 3300009147 Ga0114129_10232670 Ga0114129_102326702 166
227 3300009147 Ga0114129_10397329 Ga0114129_103973291 166
228 3300009147 Ga0114129_10726148 Ga0114129_107261482 166
229 3300009147 Ga0114129_10895706 Ga0114129_108957062 166
230 3300009147 Ga0114129_11028679 Ga0114129_110286793 166
231 3300009147 Ga0114129_11951429 Ga0114129_119514291 166
232 3300009148 Ga0105243_10000003 Ga0105243_10000003336 166
233 3300009176 Ga0105242_10520909 Ga0105242_105209091 166
234 3300009177 Ga0105248_11180839 Ga0105248_111808392 166
235 3300009551 Ga0105238_10000580 Ga0105238_100005804 166
236 3300009553 Ga0105249_10519704 Ga0105249_105197042 166
237 3300013297 Ga0157378_10069479 Ga0157378_100694792 166
238 3300013297 Ga0157378_10463697 Ga0157378_104636972 166
239 3300013308 Ga0157375_10539599 Ga0157375_105395991 166
240 3300014969 Ga0157376_10530829 Ga0157376_105308293 166
241 3300025885 Ga0207653_10000339 Ga0207653_1000033912 166
242 3300025905 Ga0207685_10086104 Ga0207685_100861041 166
243 3300025906 Ga0207699_10000005 Ga0207699_10000005428 166
244 3300025910 Ga0207684_10000215 Ga0207684_1000021575 166
245 3300025910 Ga0207684_11460902 Ga0207684_114609021 166
246 3300025912 Ga0207707_10548474 Ga0207707_105484742 166
247 3300025917 Ga0207660_10232884 Ga0207660_102328844 166
248 3300025922 Ga0207646_10672638 Ga0207646_106726382 166
249 3300025923 Ga0207681_11098805 Ga0207681_110988051 166
250 3300025924 Ga0207694_10010306 Ga0207694_100103064 166
251 3300025929 Ga0207664_10403038 Ga0207664_104030381 166
252 3300025935 Ga0207709_10000008 Ga0207709_10000008238 166
253 3300025939 Ga0207665_10166348 Ga0207665_101663482 166
254 3300025939 Ga0207665_10212767 Ga0207665_102127672 166
255 3300025941 Ga0207711_10810618 Ga0207711_108106181 166
256 3300026041 Ga0207639_10551847 Ga0207639_105518472 166
257 3300026075 Ga0207708_11216283 Ga0207708_112162832 166
258 3300027252 Ga0209973_1010763 Ga0209973_10107632 166
259 3300027462 Ga0210000_1011331 Ga0210000_10113312 166
260 3300027526 Ga0209968_1044110 Ga0209968_10441101 166
261 3300027617 Ga0210002_1025131 Ga0210002_10251312 166
262 3300027682 Ga0209971_1002517 Ga0209971_10025172 166
263 3300027695 Ga0209966_1006911 Ga0209966_10069112 166
264 3300027717 Ga0209998_10006123 Ga0209998_100061232 166
265 3300027717 Ga0209998_10015203 Ga0209998_100152032 166
266 3300027876 Ga0209974_10004904 Ga0209974_100049043 166
267 3300027907 Ga0207428_10007637 Ga0207428_100076373 166
268 3300027907 Ga0207428_10051139 Ga0207428_100511393 166
269 3300027907 Ga0207428_10077765 Ga0207428_100777655 166
270 3300027907 Ga0207428_10189547 Ga0207428_101895472 166
271 3300027907 Ga0207428_10400017 Ga0207428_104000172 166
272 3300028380 Ga0268265_10855497 Ga0268265_108554972 166
273 3300031090 Ga0265760_10003566 Ga0265760_100035662 166
274 3300031251 Ga0265327_10006750 Ga0265327_100067508 166
275 3300031548 Ga0307408_101039861 Ga0307408_1010398612 166
276 3300032004 Ga0307414_10249615 Ga0307414_102496152 166
277 3300035084 Ga0373928_0149833 Ga0373928_0149833_65_568 166
278 3300035114 Ga0373939_0079636 Ga0373939_0079636_143_646 166
279 3300035170 Ga0373943_0116991 Ga0373943_0116991_263_766 166
280 3300035691 Ga0373931_0176748 Ga0373931_0176748_181_684 166
281 3300037068 Ga0373925_0227794 Ga0373925_0227794_224_727 166
282 3300041408 Ga0439453_0035405 Ga0439453_0035405_399_899 166
283 3300044673 Ga0453683_0087125 Ga0453683_0087125_1339_1839 166
284 3300044712 Ga0453684_0197966 Ga0453684_0197966_20_523 166
285 3300044712 Ga0453684_1076571 Ga0453684_1076571_239_742 166
286 3300046476 Ga0495662_0477869 Ga0495662_0477869_62_565 166
287 3300046517 Ga0495630_0258125 Ga0495630_0258125_497_1093 166
288 3300046683 Ga0495658_0284584 Ga0495658_0284584_453_956 166
289 3300046684 Ga0495669_0539025 Ga0495669_0539025_38_541 166
290 3300048912 Ga0496109_0000050 Ga0496109_0000050_10503_11003 166
291 3300048919 Ga0496116_0002152 Ga0496116_0002152_5675_6175 166
292 3300048920 Ga0496117_0002900 Ga0496117_0002900_5538_6038 166
293 3300048921 Ga0496118_0035618 Ga0496118_0035618_2573_3073 166
294 3300048925 Ga0496122_0006969 Ga0496122_0006969_3979_4479 166
295 3300048926 Ga0496123_0019470 Ga0496123_0019470_3357_3857 166
296 3300048928 Ga0496125_0241902 Ga0496125_0241902_148_648 166
297 3300049568 Ga0501031_0027626 Ga0501031_0027626_97_600 166
298 3300049568 Ga0501031_0400325 Ga0501031_0400325_339_842 166
299 3300049569 Ga0501032_0163557 Ga0501032_0163557_548_1051 166
300 3300049569 Ga0501032_0409655 Ga0501032_0409655_170_673 166
301 3300049570 Ga0501033_0031249 Ga0501033_0031249_1134_1637 166
302 3300049570 Ga0501033_0669852 Ga0501033_0669852_110_613 166
303 3300049571 Ga0501034_0099968 Ga0501034_0099968_72_656 166
304 3300049571 Ga0501034_0160830 Ga0501034_0160830_366_869 166
305 3300049571 Ga0501034_0274619 Ga0501034_0274619_770_1273 166
306 3300049572 Ga0501036_0022682 Ga0501036_0022682_1020_1523 166
307 3300049573 Ga0501037_0154072 Ga0501037_0154072_25_528 166
308 3300049573 Ga0501037_0406256 Ga0501037_0406256_131_634 166
309 3300049574 Ga0501038_0792585 Ga0501038_0792585_112_615 166
310 3300049575 Ga0501039_0001537 Ga0501039_0001537_1013_1516 166
311 3300049575 Ga0501039_0396072 Ga0501039_0396072_29_532 166
312 3300049575 Ga0501039_1110087 Ga0501039_1110087_69_572 166
313 3300049576 Ga0501040_0000164 Ga0501040_0000164_11667_12170 166
314 3300049577 Ga0501041_0000225 Ga0501041_0000225_754_1257 166
315 3300049577 Ga0501041_0657822 Ga0501041_0657822_113_616 166
316 3300049578 Ga0501042_0010560 Ga0501042_0010560_25_528 166
317 3300049578 Ga0501042_0111104 Ga0501042_0111104_323_826 166
318 3300049579 Ga0501043_0037072 Ga0501043_0037072_2595_3098 166
319 3300049579 Ga0501043_0147264 Ga0501043_0147264_244_747 166
320 3300049579 Ga0501043_0485966 Ga0501043_0485966_173_676 166
321 3300049579 Ga0501043_0575202 Ga0501043_0575202_58_561 166
322 3300049580 Ga0501046_0034256 Ga0501046_0034256_2674_3177 166
323 3300049580 Ga0501046_0118465 Ga0501046_0118465_627_1130 166
324 3300049580 Ga0501046_0215486 Ga0501046_0215486_589_1092 166
325 3300049580 Ga0501046_0265633 Ga0501046_0265633_126_626 166
326 3300049580 Ga0501046_0316510 Ga0501046_0316510_602_1105 166
327 3300049582 Ga0501048_0017829 Ga0501048_0017829_3326_3829 166
328 3300049582 Ga0501048_0035456 Ga0501048_0035456_2578_3081 166
329 3300049584 Ga0501068_0069684 Ga0501068_0069684_192_695 166
330 3300049585 Ga0501069_0140107 Ga0501069_0140107_76_579 166
331 3300049585 Ga0501069_0276717 Ga0501069_0276717_244_747 166
332 3300049586 Ga0501070_0069431 Ga0501070_0069431_197_700 166
333 3300049586 Ga0501070_0768238 Ga0501070_0768238_171_674 166
334 3300049587 Ga0501071_0001466 Ga0501071_0001466_7650_8153 166
335 3300049587 Ga0501071_0056214 Ga0501071_0056214_473_976 166
336 3300049587 Ga0501071_0208149 Ga0501071_0208149_351_854 166
337 3300049587 Ga0501071_0256518 Ga0501071_0256518_807_1310 166
338 3300049588 Ga0501072_0001053 Ga0501072_0001053_6017_6520 166
339 3300049588 Ga0501072_1061563 Ga0501072_1061563_112_615 166
340 3300049589 Ga0501073_0399274 Ga0501073_0399274_248_751 166
341 3300049589 Ga0501073_0453418 Ga0501073_0453418_372_875 166
342 3300049590 Ga0501074_0028895 Ga0501074_0028895_45_548 166
343 3300049591 Ga0501075_0034205 Ga0501075_0034205_1025_1528 166
344 3300049591 Ga0501075_0101635 Ga0501075_0101635_1065_1568 166
345 3300049592 Ga0501076_0000156 Ga0501076_0000156_37912_38415 166
346 3300049592 Ga0501076_0037938 Ga0501076_0037938_1056_1559 166
347 3300049592 Ga0501076_0292123 Ga0501076_0292123_562_1065 166
348 3300049592 Ga0501076_0905492 Ga0501076_0905492_96_599 166
349 3300049592 Ga0501076_1418071 Ga0501076_1418071_41_553 166
350 3300049593 Ga0501077_0120336 Ga0501077_0120336_427_930 166
351 3300049593 Ga0501077_0162399 Ga0501077_0162399_767_1270 166
352 3300049593 Ga0501077_0243593 Ga0501077_0243593_522_1022 166
353 3300049593 Ga0501077_0837467 Ga0501077_0837467_31_534 166
354 3300049741 Ga0501079_0003016 Ga0501079_0003016_7345_7848 166
355 3300049741 Ga0501079_0104686 Ga0501079_0104686_223_726 166
356 3300049741 Ga0501079_0130514 Ga0501079_0130514_234_737 166
357 3300049741 Ga0501079_0301440 Ga0501079_0301440_715_1218 166
358 3300049741 Ga0501079_0801274 Ga0501079_0801274_24_527 166
359 3300049742 Ga0501080_0002771 Ga0501080_0002771_371_874 166
360 3300049742 Ga0501080_0407018 Ga0501080_0407018_322_825 166
361 3300049743 Ga0501081_0000611 Ga0501081_0000611_13948_14451 166
362 3300049743 Ga0501081_0036986 Ga0501081_0036986_1513_2016 166
363 3300049743 Ga0501081_0514602 Ga0501081_0514602_277_780 166
364 3300049743 Ga0501081_0712010 Ga0501081_0712010_204_704 166
365 3300049744 Ga0501083_0017894 Ga0501083_0017894_3646_4149 166
366 3300049744 Ga0501083_0171057 Ga0501083_0171057_443_946 166
367 3300049822 Ga0501035_0145299 Ga0501035_0145299_1257_1760 166
368 3300049823 Ga0501044_0032835 Ga0501044_0032835_4372_4956 166
369 3300049824 Ga0501045_0041958 Ga0501045_0041958_1195_1698 166
370 3300049824 Ga0501045_0142798 Ga0501045_0142798_276_779 166
371 3300049824 Ga0501045_0210597 Ga0501045_0210597_262_765 166
372 3300049824 Ga0501045_0486537 Ga0501045_0486537_196_696 166
373 3300050507 nmdc:mga05p37_13848_c1 nmdc:mga05p37_13848_c1_1369_1869 166
374 3300050507 nmdc:mga05p37_140276_c1 nmdc:mga05p37_140276_c1_995_1498 166
375 3300050507 nmdc:mga05p37_191667_c1 nmdc:mga05p37_191667_c1_741_1271 166
376 3300050507 nmdc:mga05p37_1918_c1 nmdc:mga05p37_1918_c1_17355_17855 166
377 3300050507 nmdc:mga05p37_194656_c1 nmdc:mga05p37_194656_c1_414_917 166
378 3300050507 nmdc:mga05p37_242848_c1 nmdc:mga05p37_242848_c1_862_1365 166
379 3300050507 nmdc:mga05p37_24470_c1 nmdc:mga05p37_24470_c1_4143_4673 166
380 3300050507 nmdc:mga05p37_298860_c1 nmdc:mga05p37_298860_c1_819_1322 166
381 3300050507 nmdc:mga05p37_349797_c1 nmdc:mga05p37_349797_c1_1011_1511 166
382 3300050507 nmdc:mga05p37_36772_c1 nmdc:mga05p37_36772_c1_2005_2508 166
383 3300050507 nmdc:mga05p37_431552_c1 nmdc:mga05p37_431552_c1_806_1309 166
384 3300050507 nmdc:mga05p37_903605_c1 nmdc:mga05p37_903605_c1_327_830 166
385 3300050507 nmdc:mga05p37_993292_c1 nmdc:mga05p37_993292_c1_224_727 166
386 3300050508 nmdc:mga09592_207357_c1 nmdc:mga09592_207357_c1_448_951 166
387 3300050508 nmdc:mga09592_271794_c1 nmdc:mga09592_271794_c1_811_1341 166
388 3300050508 nmdc:mga09592_278630_c1 nmdc:mga09592_278630_c1_627_1130 166
389 3300050508 nmdc:mga09592_341731_c1 nmdc:mga09592_341731_c1_67_567 166
390 3300050509 nmdc:mga0qj67_21110_c1 nmdc:mga0qj67_21110_c1_3145_3648 166
391 3300050509 nmdc:mga0qj67_392515_c1 nmdc:mga0qj67_392515_c1_309_809 166
392 3300050510 nmdc:mga06r32_151478_c1 nmdc:mga06r32_151478_c1_846_1481 166
393 3300050510 nmdc:mga06r32_205037_c1 nmdc:mga06r32_205037_c1_160_663 166
394 3300050510 nmdc:mga06r32_349666_c1 nmdc:mga06r32_349666_c1_256_759 166
395 3300050510 nmdc:mga06r32_358392_c1 nmdc:mga06r32_358392_c1_94_729 166
396 3300050510 nmdc:mga06r32_41487_c1 nmdc:mga06r32_41487_c1_1555_2085 166
397 3300050511 nmdc:mga08y16_349635_c1 nmdc:mga08y16_349635_c1_778_1278 166
398 3300050511 nmdc:mga08y16_899185_c1 nmdc:mga08y16_899185_c1_145_645 166
399 3300050512 nmdc:mga0n895_184385_c1 nmdc:mga0n895_184385_c1_360_860 166
400 3300050512 nmdc:mga0n895_194653_c1 nmdc:mga0n895_194653_c1_189_692 166
401 3300050512 nmdc:mga0n895_217964_c1 nmdc:mga0n895_217964_c1_1139_1720 166
402 3300050512 nmdc:mga0n895_27679_c1 nmdc:mga0n895_27679_c1_809_1309 166
403 3300050512 nmdc:mga0n895_387641_c1 nmdc:mga0n895_387641_c1_377_880 166
404 3300050512 nmdc:mga0n895_396560_c1 nmdc:mga0n895_396560_c1_261_896 166
405 3300050513 nmdc:mga0rr50_124759_c1 nmdc:mga0rr50_124759_c1_804_1385 166
406 3300050513 nmdc:mga0rr50_210016_c1 nmdc:mga0rr50_210016_c1_43_543 166
407 3300050513 nmdc:mga0rr50_96094_c1 nmdc:mga0rr50_96094_c1_1583_2086 166
408 3300050514 nmdc:mga08x19_79897_c1 nmdc:mga08x19_79897_c1_208_711 166
409 3300050515 nmdc:mga0a205_11748_c1 nmdc:mga0a205_11748_c1_3219_3722 166
410 3300050515 nmdc:mga0a205_226654_c1 nmdc:mga0a205_226654_c1_267_767 166
411 3300050515 nmdc:mga0a205_711146_c1 nmdc:mga0a205_711146_c1_63_563 166
412 3300050515 nmdc:mga0a205_739088_c1 nmdc:mga0a205_739088_c1_207_707 166
413 3300050515 nmdc:mga0a205_801153_c1 nmdc:mga0a205_801153_c1_209_712 166
414 3300050515 nmdc:mga0a205_80741_c1 nmdc:mga0a205_80741_c1_575_1078 166
415 3300050515 nmdc:mga0a205_97398_c1 nmdc:mga0a205_97398_c1_840_1343 166
416 3300053079 Ga0500610_0291854 Ga0500610_0291854_13_513 166
417 3300053096 Ga0500641_0028238 Ga0500641_0028238_125_625 166
418 3300053103 Ga0500555_023739 Ga0500555_023739_1118_1618 166
419 3300053158 Ga0500627_0292350 Ga0500627_0292350_191_691 166
420 3300054114 Ga0501084_0002986 Ga0501084_0002986_9175_9678 166
421 3300054114 Ga0501084_0058531 Ga0501084_0058531_2334_2837 166
422 3300054114 Ga0501084_0084991 Ga0501084_0084991_2136_2639 166
423 3300054114 Ga0501084_1159145 Ga0501084_1159145_81_581 166
424 3300060353 Ga0501082_0000401 Ga0501082_0000401_37119_37622 166
425 3300060353 Ga0501082_0303448 Ga0501082_0303448_591_1094 166
426 3300061734 Ga0530510_0008614 Ga0530510_0008614_1110_1613 166
427 3300061734 Ga0530510_0049713 Ga0530510_0049713_2496_2999 166
428 3300061734 Ga0530510_0138727 Ga0530510_0138727_1095_1598 166
429 3300061734 Ga0530510_0224368 Ga0530510_0224368_805_1308 166
430 3300061734 Ga0530510_0317224 Ga0530510_0317224_592_1095 166
431 3300061734 Ga0530510_0434383 Ga0530510_0434383_446_946 166
432 3300061734 Ga0530510_0743062 Ga0530510_0743062_102_605 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

56

199

0.96

PF00578

AhpC-TSA

AhpC/TSA family

57

183

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i43-assembly1.cif.gz_A escherichia coli thiol peroxidase (tpx) wild type disulfide form 0.9816 1 164
1q98-assembly1.cif.gz_B structure of a thiol peroxidase from haemophilus influenzae rd 0.9778 3 166
4je1-assembly1.cif.gz_B crystal structure of thiol peroxidase from burkholderia cenocepacia j2315 0.9771 2 166
2xpe-assembly1.cif.gz_A oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis 0.9736 3 166
1q98-assembly1.cif.gz_B structure of a thiol peroxidase from haemophilus influenzae rd 0.972 3 166
ID Description Score Start End Superfamily
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9391 2 166 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9283 2 166 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9177 4 164 3.40.30.10
1xvqA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9074 2 164 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8995 1 163 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C0ZGE8-F1-model_v4 Thiol peroxidase 0.994 41 166 GO:0008379
AF-A0A098BXX0-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9922 1 166 GO:0008379
AF-A0A837C1X2-F1-model_v4 deleted 0.9906 1 165
AF-A0A7Y0APW1-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9883 1 166 GO:0008379
AF-Q3B4X6-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9874 1 166 GO:0008379

Feature Viewer

pLDDT pTM Quality
90.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map