F442704

General Info

Members Datasets Scaffolds Average Seq Length
432 242 420 134

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0033465|Ga0501034_0033465_1681_2094
Length 137
Sequence MTEETKEMTPPASEAAEKPAAPAVVAAPGSALPAEEVQRLTDEIIAALKTVYDPEIPADIYELGLIYKVDLKDSRDVDVEMTLTTPNCPSAAELPVMVENAVSSVAGVGQVKVDIVWDPPWDPSRMSDEARLVLNMW

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2643221580 Devosia sp. Root635 Isolate Unclassified
4 2643221591 Devosia sp. Root685 Isolate Unclassified
5 2643221629 Devosia sp. Root105 Isolate Unclassified
6 2643221662 Devosia sp. Root413D1 Isolate Unclassified
7 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
8 2643221674 Devosia sp. Root436 Isolate Unclassified
9 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
10 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
11 2932401849 Devosia sp. 2618 Isolate Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
233 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.82
Metatranscriptomes 4.4
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0.69
Rhizoplane 3.24
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1035532 3300003214 Bacteria 641
2 rootH2_10033647 3300003320 Bacteria 5302
3 Ga0055536_1000554 3300003781 Bacteria 25604
4 Ga0055531_10005421 3300003794 Bacteria 7467
5 Ga0070658_10009132 3300005327 Bacteria 7970
6 Ga0070658_10131827 3300005327 Bacteria 2083
7 Ga0070658_10194762 3300005327 Bacteria 1709
8 Ga0070658_10675998 3300005327 Bacteria 896
9 Ga0070658_10726179 3300005327 Bacteria 863
10 Ga0070658_11654034 3300005327 Bacteria 554
11 Ga0070683_100627491 3300005329 Bacteria 1029
12 Ga0070683_101216925 3300005329 Bacteria 724
13 Ga0070666_11240084 3300005335 Bacteria 556
14 Ga0070680_100479679 3300005336 Bacteria 1063
15 Ga0070680_100797737 3300005336 Bacteria 814
16 Ga0070660_100034638 3300005339 Bacteria 3816
17 Ga0070660_100083536 3300005339 Bacteria 2509
18 Ga0070660_100381512 3300005339 Bacteria 1163
19 Ga0070661_100022236 3300005344 Bacteria 4539
20 Ga0070661_100129884 3300005344 Bacteria 1891
21 Ga0070661_100754702 3300005344 Bacteria 796
22 Ga0070675_100662879 3300005354 Bacteria 949
23 Ga0070675_100896000 3300005354 Bacteria 813
24 Ga0070671_100351516 3300005355 Bacteria 1258
25 Ga0070674_100453017 3300005356 Bacteria 1059
26 Ga0070659_100081998 3300005366 Bacteria 2576
27 Ga0070659_100150692 3300005366 Bacteria 1897
28 Ga0070659_100755420 3300005366 Bacteria 844
29 Ga0070659_101609656 3300005366 Bacteria 580
30 Ga0070678_100108961 3300005456 Bacteria 2163
31 Ga0070678_100225789 3300005456 Bacteria 1559
32 Ga0070681_10747890 3300005458 Bacteria 894
33 Ga0068867_100631570 3300005459 Bacteria 937
34 Ga0070679_100141830 3300005530 Bacteria 2382
35 Ga0070679_100540018 3300005530 Bacteria 1110
36 Ga0070679_100566984 3300005530 Bacteria 1079
37 Ga0070684_102044730 3300005535 Bacteria 541
38 Ga0068853_100000349 3300005539 Bacteria 32236
39 Ga0068853_100010907 3300005539 Bacteria 7364
40 Ga0068853_100310939 3300005539 Bacteria 1459
41 Ga0068853_100368334 3300005539 Bacteria 1340
42 Ga0068853_100620441 3300005539 Bacteria 1028
43 Ga0068853_101297905 3300005539 Bacteria 703
44 Ga0068853_101883843 3300005539 Bacteria 580
45 Ga0070672_100893184 3300005543 Bacteria 785
46 Ga0070693_100398108 3300005547 Bacteria 954
47 Ga0070665_100017471 3300005548 Bacteria 7203
48 Ga0068855_100019409 3300005563 Bacteria 8168
49 Ga0068855_100103516 3300005563 Bacteria 3275
50 Ga0068855_100359720 3300005563 Bacteria 1602
51 Ga0068855_100672226 3300005563 Bacteria 1110
52 Ga0068855_100901836 3300005563 Bacteria 934
53 Ga0068857_100495828 3300005577 Bacteria 1146
54 Ga0068857_101027868 3300005577 Bacteria 794
55 Ga0068854_100175192 3300005578 Bacteria 1671
56 Ga0068854_100646111 3300005578 Bacteria 908
57 Ga0068856_100347165 3300005614 Bacteria 1502
58 Ga0068856_100660994 3300005614 Bacteria 1066
59 Ga0068856_100956722 3300005614 Bacteria 875
60 Ga0068852_100010308 3300005616 Bacteria 6977
61 Ga0068852_100056190 3300005616 Bacteria 3400
62 Ga0068852_100078086 3300005616 Bacteria 2928
63 Ga0068852_100579737 3300005616 Bacteria 1124
64 Ga0068851_10004013 3300005834 Bacteria 6607
65 Ga0068851_10523320 3300005834 Bacteria 714
66 Ga0068863_100825916 3300005841 Bacteria 925
67 Ga0068863_101813675 3300005841 Bacteria 620
68 Ga0068858_100518060 3300005842 Bacteria 1153
69 Ga0081455_10111448 3300005937 Bacteria 2174
70 Ga0070717_11500281 3300006028 Bacteria 612
71 Ga0075363_100021497 3300006048 Bacteria 3251
72 Ga0075363_100246764 3300006048 Bacteria 1027
73 Ga0075364_10124886 3300006051 Bacteria 1724
74 Ga0075362_10602274 3300006177 Bacteria 568
75 Ga0075367_10063986 3300006178 Bacteria 2200
76 Ga0075369_10312095 3300006186 Bacteria 735
77 Ga0075366_10276303 3300006195 Bacteria 1026
78 Ga0075370_10059177 3300006353 Bacteria 2180
79 Ga0075370_10087779 3300006353 Bacteria 1792
80 Ga0075428_100157260 3300006844 Bacteria 2468
81 Ga0075428_100442811 3300006844 Bacteria 1392
82 Ga0075430_100125688 3300006846 Bacteria 2137
83 Ga0075431_100097521 3300006847 Bacteria 3035
84 Ga0075433_10328810 3300006852 Bacteria 1352
85 Ga0075429_101555257 3300006880 Bacteria 575
86 Ga0068865_100743692 3300006881 Bacteria 842
87 Ga0068865_101246279 3300006881 Bacteria 660
88 Ga0075435_100214004 3300007076 Bacteria 1635
89 Ga0099795_10298971 3300007788 Bacteria 707
90 Ga0105240_11507339 3300009093 Bacteria 705
91 Ga0111539_10291456 3300009094 Bacteria 1899
92 Ga0105245_10518199 3300009098 Bacteria 1210
93 Ga0105245_10691489 3300009098 Bacteria 1052
94 Ga0114129_10456929 3300009147 Bacteria 1674
95 Ga0105243_10819306 3300009148 Bacteria 919
96 Ga0105241_10021133 3300009174 Bacteria 4811
97 Ga0105241_10069780 3300009174 Bacteria 2725
98 Ga0105241_10421379 3300009174 Bacteria 1175
99 Ga0105241_10473955 3300009174 Bacteria 1111
100 Ga0105241_10567060 3300009174 Bacteria 1021
101 Ga0105237_10000309 3300009545 Bacteria 67900
102 Ga0105237_10255147 3300009545 Bacteria 1756
103 Ga0105237_11723167 3300009545 Bacteria 634
104 Ga0105237_11824669 3300009545 Bacteria 616
105 Ga0105238_10081963 3300009551 Bacteria 3216
106 Ga0105238_10217173 3300009551 Bacteria 1888
107 Ga0105238_10332730 3300009551 Bacteria 1506
108 Ga0105238_10843008 3300009551 Bacteria 934
109 Ga0099796_10507711 3300010159 Bacteria 540
110 Ga0105239_10000575 3300010375 Bacteria 52515
111 Ga0105239_10026037 3300010375 Bacteria 6441
112 Ga0105239_10727243 3300010375 Bacteria 1136
113 Ga0105239_10906360 3300010375 Bacteria 1012
114 Ga0105239_12478619 3300010375 Bacteria 604
115 Ga0105239_12601346 3300010375 Bacteria 590
116 Ga0105239_12650715 3300010375 Bacteria 585
117 Ga0105246_10194296 3300011119 Bacteria 1573
118 Ga0105246_12019631 3300011119 Bacteria 557
119 Ga0157326_1004013 3300012513 Bacteria 1546
120 Ga0157373_10205783 3300013100 Bacteria 1388
121 Ga0157373_10233178 3300013100 Bacteria 1300
122 Ga0157371_10061002 3300013102 Bacteria 2674
123 Ga0157371_10343538 3300013102 Bacteria 1086
124 Ga0157370_10245263 3300013104 Bacteria 1657
125 Ga0157370_10636763 3300013104 Bacteria 975
126 Ga0157370_10637430 3300013104 Bacteria 974
127 Ga0157370_10818150 3300013104 Bacteria 847
128 Ga0157370_10949493 3300013104 Bacteria 779
129 Ga0157370_11038552 3300013104 Bacteria 741
130 Ga0157370_11563360 3300013104 Bacteria 593
131 Ga0157369_10029152 3300013105 Bacteria 6101
132 Ga0157369_10290816 3300013105 Bacteria 1701
133 Ga0157369_10987484 3300013105 Bacteria 862
134 Ga0157374_10018795 3300013296 Bacteria 6108
135 Ga0157374_10320429 3300013296 Bacteria 1536
136 Ga0157378_10798152 3300013297 Bacteria 970
137 Ga0163162_10912982 3300013306 Bacteria 991
138 Ga0157372_10735492 3300013307 Bacteria 1147
139 Ga0163163_10119646 3300014325 Bacteria 2667
140 Ga0163163_11955551 3300014325 Bacteria 646
141 Ga0163163_12076793 3300014325 Bacteria 628
142 Ga0182008_10113850 3300014497 Bacteria 1341
143 Ga0157376_10193623 3300014969 Bacteria 1866
144 Ga0197907_10040603 3300020069 Bacteria 1183
145 Ga0197907_10076440 3300020069 Bacteria 562
146 Ga0197907_10838917 3300020069 Bacteria 708
147 Ga0206356_10224072 3300020070 Bacteria 783
148 Ga0206356_11296514 3300020070 Bacteria 922
149 Ga0206349_1250854 3300020075 Bacteria 672
150 Ga0206355_1718572 3300020076 Bacteria 624
151 Ga0206351_10708264 3300020077 Bacteria 585
152 Ga0206354_11675897 3300020081 Bacteria 750
153 Ga0224712_10059741 3300022467 Bacteria 1515
154 Ga0224712_10128235 3300022467 Bacteria 1105
155 Ga0224712_10263735 3300022467 Bacteria 798
156 Ga0207427_101879 3300025231 Bacteria 6619
157 Ga0209233_1001040 3300025261 Bacteria 11652
158 Ga0209676_1000661 3300025292 Bacteria 49370
159 Ga0209050_1015487 3300025298 Bacteria 3197
160 Ga0209257_1000178 3300025304 Bacteria 160969
161 Ga0207656_10017539 3300025321 Bacteria 2806
162 Ga0207656_10074112 3300025321 Bacteria 1518
163 Ga0207642_10412584 3300025899 Bacteria 810
164 Ga0207680_10942736 3300025903 Bacteria 618
165 Ga0207647_10168006 3300025904 Bacteria 1278
166 Ga0207645_10273603 3300025907 Bacteria 1120
167 Ga0207705_10058559 3300025909 Bacteria 2779
168 Ga0207705_10295202 3300025909 Bacteria 1242
169 Ga0207705_10783858 3300025909 Bacteria 740
170 Ga0207705_10898585 3300025909 Bacteria 686
171 Ga0207654_10162003 3300025911 Bacteria 1446
172 Ga0207654_10209766 3300025911 Bacteria 1287
173 Ga0207695_10255677 3300025913 Bacteria 1650
174 Ga0207671_10000617 3300025914 Bacteria 46905
175 Ga0207671_10177492 3300025914 Bacteria 1656
176 Ga0207671_10250159 3300025914 Bacteria 1393
177 Ga0207657_10009762 3300025919 Bacteria 9622
178 Ga0207657_10012082 3300025919 Bacteria 8535
179 Ga0207657_10024676 3300025919 Bacteria 5560
180 Ga0207649_10000527 3300025920 Bacteria 26665
181 Ga0207649_11657602 3300025920 Bacteria 506
182 Ga0207652_10053579 3300025921 Bacteria 3465
183 Ga0207652_10624676 3300025921 Bacteria 965
184 Ga0207694_10112207 3300025924 Bacteria 2169
185 Ga0207694_10274456 3300025924 Bacteria 1383
186 Ga0207659_10331826 3300025926 Bacteria 1258
187 Ga0207659_10839755 3300025926 Bacteria 789
188 Ga0207644_10165258 3300025931 Bacteria 1724
189 Ga0207690_10161424 3300025932 Bacteria 1671
190 Ga0207690_10533181 3300025932 Bacteria 953
191 Ga0207690_10643784 3300025932 Bacteria 868
192 Ga0207690_10835706 3300025932 Bacteria 762
193 Ga0207706_10750713 3300025933 Bacteria 831
194 Ga0207704_11041423 3300025938 Bacteria 694
195 Ga0207679_10609293 3300025945 Bacteria 985
196 Ga0207679_11367393 3300025945 Bacteria 650
197 Ga0207667_10082927 3300025949 Bacteria 3320
198 Ga0207667_10093804 3300025949 Bacteria 3099
199 Ga0207667_10238663 3300025949 Bacteria 1861
200 Ga0207667_10279455 3300025949 Bacteria 1706
201 Ga0207667_10447728 3300025949 Bacteria 1312
202 Ga0207667_10635352 3300025949 Bacteria 1074
203 Ga0207667_10646516 3300025949 Bacteria 1063
204 Ga0207651_10571827 3300025960 Bacteria 985
205 Ga0207668_10164141 3300025972 Bacteria 1734
206 Ga0207640_10049846 3300025981 Bacteria 2713
207 Ga0207640_10350501 3300025981 Bacteria 1186
208 Ga0207703_10809022 3300026035 Bacteria 895
209 Ga0207703_10844899 3300026035 Bacteria 875
210 Ga0207639_10007233 3300026041 Bacteria 7563
211 Ga0207639_10011930 3300026041 Bacteria 6045
212 Ga0207639_10258747 3300026041 Bacteria 1521
213 Ga0207639_10465282 3300026041 Bacteria 1150
214 Ga0207639_10537103 3300026041 Bacteria 1072
215 Ga0207639_10937559 3300026041 Bacteria 810
216 Ga0207639_12291721 3300026041 Bacteria 501
217 Ga0207678_10826215 3300026067 Bacteria 818
218 Ga0207702_10043009 3300026078 Bacteria 3791
219 Ga0207702_10250781 3300026078 Bacteria 1662
220 Ga0207702_10450766 3300026078 Bacteria 1248
221 Ga0207702_10513496 3300026078 Bacteria 1169
222 Ga0207648_10319902 3300026089 Bacteria 1394
223 Ga0207674_10057472 3300026116 Bacteria 3943
224 Ga0207674_10188809 3300026116 Bacteria 2011
225 Ga0207674_11730967 3300026116 Bacteria 593
226 Ga0207683_10157290 3300026121 Bacteria 2053
227 Ga0207683_11222525 3300026121 Bacteria 696
228 Ga0207698_10026340 3300026142 Bacteria 4112
229 Ga0207698_10834375 3300026142 Bacteria 926
230 Ga0207698_10980511 3300026142 Bacteria 855
231 Ga0209813_10313709 3300027866 Bacteria 612
232 Ga0207428_10995093 3300027907 Bacteria 589
233 Ga0268266_10000265 3300028379 Bacteria 87871
234 Ga0265338_10039703 3300028800 Bacteria 4435
235 Ga0265330_10054166 3300031235 Bacteria 1754
236 Ga0265320_10279697 3300031240 Bacteria 739
237 Ga0265325_10006244 3300031241 Bacteria 7263
238 Ga0265329_10252544 3300031242 Bacteria 588
239 Ga0265340_10057760 3300031247 Bacteria 1864
240 Ga0265339_10000389 3300031249 Bacteria 34751
241 Ga0265331_10058989 3300031250 Bacteria 1815
242 Ga0265316_10384392 3300031344 Bacteria 1012
243 Ga0307408_100593640 3300031548 Bacteria 983
244 Ga0265313_10000449 3300031595 Bacteria 43511
245 Ga0265314_10048467 3300031711 Bacteria 2982
246 Ga0265314_10202461 3300031711 Bacteria 1172
247 Ga0265342_10088252 3300031712 Bacteria 1781
248 Ga0307516_10082670 3300031730 Bacteria 3053
249 Ga0307405_10512309 3300031731 Bacteria 964
250 Ga0307413_10039416 3300031824 Bacteria 2747
251 Ga0307413_10217370 3300031824 Bacteria 1393
252 Ga0307413_11830628 3300031824 Bacteria 544
253 Ga0307410_11616281 3300031852 Bacteria 573
254 Ga0307406_10419607 3300031901 Bacteria 1066
255 Ga0307407_10455105 3300031903 Bacteria 930
256 Ga0307412_10284232 3300031911 Bacteria 1300
257 Ga0307412_10371271 3300031911 Bacteria 1155
258 Ga0307412_10801237 3300031911 Bacteria 818
259 Ga0307412_11104843 3300031911 Bacteria 706
260 Ga0307409_100845676 3300031995 Bacteria 926
261 Ga0307416_100281241 3300032002 Bacteria 1641
262 Ga0307416_103163332 3300032002 Bacteria 551
263 Ga0307414_10020781 3300032004 Bacteria 4100
264 Ga0307414_10081189 3300032004 Bacteria 2373
265 Ga0307414_10249080 3300032004 Bacteria 1475
266 Ga0307414_10517281 3300032004 Bacteria 1059
267 Ga0307414_10608500 3300032004 Bacteria 981
268 Ga0307414_11367852 3300032004 Bacteria 657
269 Ga0307414_11900909 3300032004 Bacteria 555
270 Ga0307411_10159594 3300032005 Bacteria 1687
271 Ga0307411_10213182 3300032005 Bacteria 1493
272 Ga0307415_100614791 3300032126 Bacteria 969
273 Ga0316593_10251532 3300032168 Bacteria 661
274 Ga0373928_0166449 3300035084 Bacteria 619
275 Ga0373939_0163946 3300035114 Bacteria 818
276 Ga0373960_0366917 3300035121 Bacteria 549
277 Ga0373962_0149049 3300035242 Bacteria 765
278 Ga0395899_0117329 3300037312 Bacteria 1909
279 Ga0395899_0509205 3300037312 Bacteria 780
280 Ga0395900_0194693 3300037418 Bacteria 2054
281 Ga0395900_0303920 3300037418 Bacteria 1580
282 Ga0395900_0691255 3300037418 Bacteria 954
283 Ga0395900_0869459 3300037418 Bacteria 826
284 Ga0395898_0527032 3300037466 Bacteria 1123
285 Ga0395898_0544462 3300037466 Bacteria 1102
286 Ga0395898_1218449 3300037466 Bacteria 683
287 Ga0395901_0161843 3300038443 Bacteria 2350
288 Ga0395901_0310998 3300038443 Bacteria 1632
289 Ga0436360_1058874 3300039438 Bacteria 666
290 Ga0439453_0176018 3300041408 Bacteria 520
291 Ga0439465_0031449 3300041413 Bacteria 1691
292 Ga0439465_0051238 3300041413 Bacteria 1352
293 Ga0439465_0346270 3300041413 Bacteria 561
294 Ga0451791_1552472 3300041451 Bacteria 873
295 Ga0451793_1555952 3300041452 Bacteria 591
296 Ga0451797_1207130 3300041453 Bacteria 689
297 Ga0451795_0586041 3300041456 Bacteria 630
298 Ga0451833_1112826 3300041491 Bacteria 696
299 Ga0439434_0171615 3300042435 Bacteria 724
300 Ga0495686_0186405 3300047472 Bacteria 1199
301 Ga0496101_0064329 3300048904 Bacteria 2671
302 Ga0496102_0242656 3300048905 Bacteria 1699
303 Ga0496102_1873184 3300048905 Bacteria 517
304 Ga0496108_0521214 3300048911 Bacteria 1038
305 Ga0496109_0550826 3300048912 Bacteria 1088
306 Ga0496109_1045886 3300048912 Bacteria 754
307 Ga0496110_0202395 3300048913 Bacteria 1804
308 Ga0496110_0253775 3300048913 Bacteria 1601
309 Ga0496111_0235306 3300048914 Bacteria 1360
310 Ga0496114_0722794 3300048917 Bacteria 872
311 Ga0496116_0257982 3300048919 Bacteria 862
312 Ga0496121_0029423 3300048924 Bacteria 5079
313 Ga0496121_0255500 3300048924 Bacteria 1213
314 Ga0496121_0679346 3300048924 Bacteria 623
315 Ga0496124_0214754 3300048927 Bacteria 1452
316 Ga0496124_0362253 3300048927 Bacteria 1021
317 Ga0496125_0000602 3300048928 Bacteria 61264
318 Ga0496126_0107854 3300048929 Bacteria 2429
319 Ga0496126_0218725 3300048929 Bacteria 1601
320 Ga0496126_0493408 3300048929 Bacteria 980
321 Ga0501031_0234476 3300049568 Bacteria 1194
322 Ga0501032_0209597 3300049569 Bacteria 1271
323 Ga0501032_0546287 3300049569 Bacteria 739
324 Ga0501033_0012313 3300049570 Bacteria 6529
325 Ga0501033_0078836 3300049570 Bacteria 2417
326 Ga0501033_0593259 3300049570 Bacteria 760
327 Ga0501034_0003327 3300049571 Bacteria 18346
328 Ga0501034_0033465 3300049571 Bacteria 5214
329 Ga0501034_0074714 3300049571 Bacteria 3397
330 Ga0501034_0105656 3300049571 Bacteria 2808
331 Ga0501034_0205236 3300049571 Bacteria 1927
332 Ga0501034_0227208 3300049571 Bacteria 1817
333 Ga0501034_0254375 3300049571 Bacteria 1700
334 Ga0501034_0398539 3300049571 Bacteria 1299
335 Ga0501034_0399848 3300049571 Bacteria 1296
336 Ga0501034_0541639 3300049571 Bacteria 1074
337 Ga0501034_1148228 3300049571 Bacteria 657
338 Ga0501036_0014336 3300049572 Bacteria 6597
339 Ga0501036_0131302 3300049572 Bacteria 2115
340 Ga0501036_0508534 3300049572 Bacteria 1002
341 Ga0501037_0173246 3300049573 Bacteria 1533
342 Ga0501037_0301824 3300049573 Bacteria 1112
343 Ga0501037_0311547 3300049573 Bacteria 1091
344 Ga0501038_0092330 3300049574 Bacteria 2535
345 Ga0501038_0140103 3300049574 Bacteria 1979
346 Ga0501038_0180253 3300049574 Bacteria 1705
347 Ga0501038_0314911 3300049574 Bacteria 1225
348 Ga0501042_0154340 3300049578 Bacteria 1656
349 Ga0501043_0197365 3300049579 Bacteria 1563
350 Ga0501043_0287148 3300049579 Bacteria 1260
351 Ga0501043_0912789 3300049579 Bacteria 629
352 Ga0501046_0121940 3300049580 Bacteria 1983
353 Ga0501046_0512906 3300049580 Bacteria 858
354 Ga0501047_0015714 3300049581 Bacteria 7212
355 Ga0501047_0619962 3300049581 Bacteria 902
356 Ga0501067_0200274 3300049583 Bacteria 1112
357 Ga0501068_1044394 3300049584 Bacteria 540
358 Ga0501069_0373720 3300049585 Bacteria 842
359 Ga0501069_0707822 3300049585 Unclassified 608
360 Ga0501070_0012163 3300049586 Bacteria 7262
361 Ga0501070_0102572 3300049586 Bacteria 2366
362 Ga0501070_0178841 3300049586 Bacteria 1746
363 Ga0501070_0705973 3300049586 Bacteria 797
364 Ga0501071_0716384 3300049587 Bacteria 771
365 Ga0501073_0413479 3300049589 Bacteria 932
366 Ga0501074_0687688 3300049590 Bacteria 722
367 Ga0501076_1509967 3300049592 Bacteria 552
368 Ga0501077_0148847 3300049593 Bacteria 1485
369 Ga0501079_0104775 3300049741 Bacteria 2194
370 Ga0501079_0634951 3300049741 Bacteria 841
371 Ga0501080_0164947 3300049742 Bacteria 2045
372 Ga0501083_0682880 3300049744 Bacteria 668
373 Ga0501035_0005658 3300049822 Bacteria 11796
374 Ga0501035_0026323 3300049822 Bacteria 5322
375 Ga0501035_0088772 3300049822 Bacteria 2723
376 Ga0501035_0232471 3300049822 Bacteria 1571
377 Ga0501035_0422231 3300049822 Bacteria 1107
378 Ga0501044_0111536 3300049823 Bacteria 2742
379 Ga0501044_0181606 3300049823 Bacteria 2070
380 Ga0501044_0492532 3300049823 Bacteria 1128
381 Ga0501045_0268455 3300049824 Bacteria 1270
382 nmdc:mga03683_13444_c1 3300050489 Bacteria 3013
383 nmdc:mga03n38_89912_c1 3300050490 Bacteria 1459
384 nmdc:mga00v17_355719_c1 3300050491 Bacteria 952
385 nmdc:mga0k408_662336_c1 3300050493 Bacteria 613
386 nmdc:mga0k408_756219_c1 3300050493 Bacteria 568
387 nmdc:mga06z11_26765_c1 3300050494 Bacteria 2749
388 nmdc:mga07m45_336907_c1 3300050496 Bacteria 877
389 nmdc:mga07m45_91276_c1 3300050496 Bacteria 1745
390 nmdc:mga05p37_103391_c1 3300050507 Bacteria 3506
391 nmdc:mga05p37_151397_c1 3300050507 Bacteria 2837
392 nmdc:mga09592_552138_c1 3300050508 Bacteria 989
393 nmdc:mga0qj67_36097_c1 3300050509 Bacteria 3866
394 nmdc:mga06r32_9816_c1 3300050510 Bacteria 8636
395 nmdc:mga08y16_286257_c1 3300050511 Bacteria 1699
396 nmdc:mga08y16_899383_c1 3300050511 Bacteria 871
397 nmdc:mga0n895_323770_c1 3300050512 Bacteria 1562
398 nmdc:mga0rr50_767221_c1 3300050513 Bacteria 823
399 Ga0500644_0001666 3300053088 Bacteria 5796
400 Ga0500651_0012786 3300053093 Bacteria 5095
401 Ga0500562_044278 3300053108 Bacteria 1185
402 Ga0500595_200188 3300053119 Bacteria 551
403 Ga0500608_122648 3300053122 Bacteria 1176
404 Ga0500568_0093111 3300053139 Bacteria 1135
405 Ga0500604_0004888 3300053151 Bacteria 3554
406 Ga0500616_0012756 3300053153 Bacteria 4906
407 Ga0500624_020034 3300053157 Bacteria 1069
408 Ga0500634_0000071 3300053161 Bacteria 40285
409 Ga0501084_0190640 3300054114 Bacteria 1729
410 Ga0501084_0303056 3300054114 Bacteria 1350
411 Ga0501084_0530553 3300054114 Bacteria 995
412 Ga0587077_024025 3300059493 Bacteria 1106
413 Ga0587077_032951 3300059493 Bacteria 999
414 Ga0587086_085906 3300059507 Bacteria 561
415 Ga0587106_053186 3300059605 Bacteria 724
416 Ga0587101_004973 3300059623 Bacteria 1451
417 Ga0587062_006810 3300059639 Bacteria 1311
418 Ga0501082_0033464 3300060353 Bacteria 4435
419 Ga0530510_0074293 3300061734 Bacteria 2468
420 Ga0530510_0378976 3300061734 Bacteria 1065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0242656 Ga0496102_0242656_327_749 115
2 3300048912 Ga0496109_1045886 Ga0496109_1045886_135_557 115
3 3300005336 Ga0070680_100479679 Ga0070680_1004796793 117
4 3300011119 Ga0105246_10194296 Ga0105246_101942962 117
5 iso_pu_bacteria 2513237098 2513680293 117
6 iso_pu_bacteria 2524023210 2524471319 117
7 iso_pu_bacteria 2885383462 2885385956 117
8 iso_pu_bacteria 2903768456 2903774074 117
9 iso_pu_bacteria 8056681323 8056688294 117
10 3300005841 Ga0068863_101813675 Ga0068863_1018136752 118
11 3300005937 Ga0081455_10111448 Ga0081455_101114483 118
12 3300006028 Ga0070717_11500281 Ga0070717_115002811 118
13 3300006844 Ga0075428_100157260 Ga0075428_1001572603 118
14 3300006844 Ga0075428_100442811 Ga0075428_1004428112 118
15 3300006846 Ga0075430_100125688 Ga0075430_1001256883 118
16 3300006847 Ga0075431_100097521 Ga0075431_1000975212 118
17 3300006880 Ga0075429_101555257 Ga0075429_1015552571 118
18 3300007076 Ga0075435_100214004 Ga0075435_1002140043 118
19 3300009094 Ga0111539_10291456 Ga0111539_102914563 118
20 3300009147 Ga0114129_10456929 Ga0114129_104569293 118
21 3300027907 Ga0207428_10995093 Ga0207428_109950932 118
22 3300035121 Ga0373960_0366917 Ga0373960_0366917_144_506 118
23 3300037312 Ga0395899_0509205 Ga0395899_0509205_401_760 118
24 3300041456 Ga0451795_0586041 Ga0451795_0586041_59_415 118
25 3300048913 Ga0496110_0253775 Ga0496110_0253775_187_549 118
26 3300049571 Ga0501034_0074714 Ga0501034_0074714_172_582 118
27 3300049583 Ga0501067_0200274 Ga0501067_0200274_667_1029 118
28 3300050507 nmdc:mga05p37_103391_c1 nmdc:mga05p37_103391_c1_1200_1562 118
29 3300050507 nmdc:mga05p37_151397_c1 nmdc:mga05p37_151397_c1_1157_1519 118
30 3300050508 nmdc:mga09592_552138_c1 nmdc:mga09592_552138_c1_438_800 118
31 3300050509 nmdc:mga0qj67_36097_c1 nmdc:mga0qj67_36097_c1_2674_3036 118
32 3300050510 nmdc:mga06r32_9816_c1 nmdc:mga06r32_9816_c1_7394_7756 118
33 3300050511 nmdc:mga08y16_286257_c1 nmdc:mga08y16_286257_c1_827_1189 118
34 3300050512 nmdc:mga0n895_323770_c1 nmdc:mga0n895_323770_c1_698_1060 118
35 3300050513 nmdc:mga0rr50_767221_c1 nmdc:mga0rr50_767221_c1_344_706 118
36 iso_pu_bacteria 2643221591 2643963318 118
37 3300013102 Ga0157371_10061002 Ga0157371_100610022 119
38 3300048924 Ga0496121_0029423 Ga0496121_0029423_4335_4763 119
39 3300049593 Ga0501077_0148847 Ga0501077_0148847_670_1113 119
40 3300054114 Ga0501084_0530553 Ga0501084_0530553_358_801 119
41 iso_pu_bacteria 2643221663 2644351872 119
42 3300005327 Ga0070658_11654034 Ga0070658_116540341 120
43 3300005336 Ga0070680_100797737 Ga0070680_1007977372 120
44 3300005366 Ga0070659_100081998 Ga0070659_1000819983 120
45 3300005458 Ga0070681_10747890 Ga0070681_107478902 120
46 3300005459 Ga0068867_100631570 Ga0068867_1006315702 120
47 3300005530 Ga0070679_100540018 Ga0070679_1005400182 120
48 3300005539 Ga0068853_100620441 Ga0068853_1006204411 120
49 3300005563 Ga0068855_100672226 Ga0068855_1006722262 120
50 3300005577 Ga0068857_101027868 Ga0068857_1010278682 120
51 3300005834 Ga0068851_10523320 Ga0068851_105233202 120
52 3300005841 Ga0068863_100825916 Ga0068863_1008259161 120
53 3300006852 Ga0075433_10328810 Ga0075433_103288101 120
54 3300007788 Ga0099795_10298971 Ga0099795_102989712 120
55 3300009551 Ga0105238_10332730 Ga0105238_103327302 120
56 3300010159 Ga0099796_10507711 Ga0099796_105077111 120
57 3300013100 Ga0157373_10205783 Ga0157373_102057832 120
58 3300013104 Ga0157370_10637430 Ga0157370_106374301 120
59 3300013105 Ga0157369_10987484 Ga0157369_109874842 120
60 3300014325 Ga0163163_10119646 Ga0163163_101196462 120
61 3300025907 Ga0207645_10273603 Ga0207645_102736032 120
62 3300025919 Ga0207657_10024676 Ga0207657_100246765 120
63 3300025921 Ga0207652_10053579 Ga0207652_100535793 120
64 3300025921 Ga0207652_10624676 Ga0207652_106246761 120
65 3300025949 Ga0207667_10447728 Ga0207667_104477282 120
66 3300026067 Ga0207678_10826215 Ga0207678_108262152 120
67 3300026116 Ga0207674_11730967 Ga0207674_117309671 120
68 3300038443 Ga0395901_0310998 Ga0395901_0310998_1102_1473 120
69 3300048904 Ga0496101_0064329 Ga0496101_0064329_227_598 120
70 3300048905 Ga0496102_1873184 Ga0496102_1873184_128_499 120
71 3300049568 Ga0501031_0234476 Ga0501031_0234476_238_639 120
72 3300049571 Ga0501034_0003327 Ga0501034_0003327_10804_11166 120
73 3300049571 Ga0501034_1148228 Ga0501034_1148228_101_502 120
74 3300049572 Ga0501036_0508534 Ga0501036_0508534_38_439 120
75 3300049573 Ga0501037_0311547 Ga0501037_0311547_659_1060 120
76 3300049578 Ga0501042_0154340 Ga0501042_0154340_1073_1474 120
77 3300049585 Ga0501069_0707822 Ga0501069_0707822_161_562 120
78 3300049741 Ga0501079_0104775 Ga0501079_0104775_1695_2096 120
79 3300049741 Ga0501079_0634951 Ga0501079_0634951_112_522 120
80 3300049822 Ga0501035_0232471 Ga0501035_0232471_518_919 120
81 3300049824 Ga0501045_0268455 Ga0501045_0268455_731_1132 120
82 3300053161 Ga0500634_0000071 Ga0500634_0000071_12470_12865 120
83 3300054114 Ga0501084_0190640 Ga0501084_0190640_1272_1673 120
84 3300060353 Ga0501082_0033464 Ga0501082_0033464_3924_4325 120
85 3300061734 Ga0530510_0074293 Ga0530510_0074293_257_658 120
86 3300061734 Ga0530510_0378976 Ga0530510_0378976_342_752 120
87 3300012513 Ga0157326_1004013 Ga0157326_10040132 121
88 3300042435 Ga0439434_0171615 Ga0439434_0171615_116_499 121
89 3300048917 Ga0496114_0722794 Ga0496114_0722794_225_626 121
90 3300049574 Ga0501038_0314911 Ga0501038_0314911_360_761 121
91 3300049579 Ga0501043_0287148 Ga0501043_0287148_802_1212 121
92 3300053119 Ga0500595_200188 Ga0500595_200188_63_482 121
93 3300059493 Ga0587077_032951 Ga0587077_032951_180_608 121
94 3300006177 Ga0075362_10602274 Ga0075362_106022741 122
95 3300039438 Ga0436360_1058874 Ga0436360_1058874_134_508 122
96 3300041451 Ga0451791_1552472 Ga0451791_1552472_462_839 122
97 3300048913 Ga0496110_0202395 Ga0496110_0202395_1379_1759 122
98 3300048914 Ga0496111_0235306 Ga0496111_0235306_548_928 122
99 3300048919 Ga0496116_0257982 Ga0496116_0257982_16_396 122
100 3300048927 Ga0496124_0362253 Ga0496124_0362253_580_960 122
101 3300048928 Ga0496125_0000602 Ga0496125_0000602_34729_35109 122
102 3300049590 Ga0501074_0687688 Ga0501074_0687688_29_400 123
103 3300049744 Ga0501083_0682880 Ga0501083_0682880_281_652 123
104 3300003781 Ga0055536_1000554 Ga0055536_100055415 124
105 3300003794 Ga0055531_10005421 Ga0055531_100054213 124
106 3300005354 Ga0070675_100896000 Ga0070675_1008960002 124
107 3300005355 Ga0070671_100351516 Ga0070671_1003515162 124
108 3300005456 Ga0070678_100225789 Ga0070678_1002257892 124
109 3300009098 Ga0105245_10691489 Ga0105245_106914892 124
110 3300013306 Ga0163162_10912982 Ga0163162_109129822 124
111 3300025292 Ga0209676_1000661 Ga0209676_100066122 124
112 3300025298 Ga0209050_1015487 Ga0209050_10154873 124
113 3300025304 Ga0209257_1000178 Ga0209257_100017895 124
114 3300025931 Ga0207644_10165258 Ga0207644_101652583 124
115 3300025960 Ga0207651_10571827 Ga0207651_105718271 124
116 3300026121 Ga0207683_11222525 Ga0207683_112225251 124
117 3300031548 Ga0307408_100593640 Ga0307408_1005936402 124
118 3300048911 Ga0496108_0521214 Ga0496108_0521214_560_946 124
119 3300049592 Ga0501076_1509967 Ga0501076_1509967_64_456 124
120 3300050511 nmdc:mga08y16_899383_c1 nmdc:mga08y16_899383_c1_459_848 124
121 3300031911 Ga0307412_10371271 Ga0307412_103712712 125
122 3300032004 Ga0307414_10249080 Ga0307414_102490803 125
123 3300032004 Ga0307414_11367852 Ga0307414_113678521 125
124 3300032004 Ga0307414_11900909 Ga0307414_119009091 125
125 3300048927 Ga0496124_0214754 Ga0496124_0214754_504_896 125
126 3300053088 Ga0500644_0001666 Ga0500644_0001666_311_709 125
127 3300053093 Ga0500651_0012786 Ga0500651_0012786_3545_3943 125
128 iso_pu_bacteria 2643221674 2644410625 125
129 3300049569 Ga0501032_0546287 Ga0501032_0546287_309_707 126
130 3300025926 Ga0207659_10331826 Ga0207659_103318262 127
131 3300032126 Ga0307415_100614791 Ga0307415_1006147912 127
132 iso_pu_bacteria 2643221580 2643912313 127
133 iso_pu_bacteria 2932401849 2932403255 127
134 iso_pu_bacteria 2643221629 2644167645 128
135 iso_pu_bacteria 2643221662 2644349105 128
136 3300049571 Ga0501034_0033465 Ga0501034_0033465_1681_2094 129
137 3300049571 Ga0501034_0227208 Ga0501034_0227208_691_1089 129
138 3300049742 Ga0501080_0164947 Ga0501080_0164947_444_860 129
139 3300049572 Ga0501036_0131302 Ga0501036_0131302_776_1168 130
140 3300049573 Ga0501037_0173246 Ga0501037_0173246_755_1147 130
141 3300031824 Ga0307413_10039416 Ga0307413_100394162 131
142 3300031903 Ga0307407_10455105 Ga0307407_104551051 131
143 3300031911 Ga0307412_10284232 Ga0307412_102842322 131
144 3300031911 Ga0307412_10801237 Ga0307412_108012372 131
145 3300031911 Ga0307412_11104843 Ga0307412_111048432 131
146 3300031995 Ga0307409_100845676 Ga0307409_1008456761 131
147 3300032004 Ga0307414_10020781 Ga0307414_100207813 131
148 3300032004 Ga0307414_10517281 Ga0307414_105172812 131
149 3300032005 Ga0307411_10159594 Ga0307411_101595942 131
150 3300032168 Ga0316593_10251532 Ga0316593_102515321 131
151 3300041453 Ga0451797_1207130 Ga0451797_1207130_44_439 131
152 3300053151 Ga0500604_0004888 Ga0500604_0004888_531_926 131
153 3300053157 Ga0500624_020034 Ga0500624_020034_532_927 131
154 3300003320 rootH2_10033647 rootH2_100336474 132
155 3300006048 Ga0075363_100021497 Ga0075363_1000214973 132
156 3300006353 Ga0075370_10059177 Ga0075370_100591773 132
157 3300037418 Ga0395900_0691255 Ga0395900_0691255_61_468 132
158 3300041413 Ga0439465_0051238 Ga0439465_0051238_50_466 132
159 3300041413 Ga0439465_0346270 Ga0439465_0346270_125_541 132
160 3300048929 Ga0496126_0107854 Ga0496126_0107854_1612_2028 132
161 3300049571 Ga0501034_0105656 Ga0501034_0105656_1322_1738 132
162 3300049589 Ga0501073_0413479 Ga0501073_0413479_301_711 132
163 3300049822 Ga0501035_0422231 Ga0501035_0422231_558_974 132
164 3300050489 nmdc:mga03683_13444_c1 nmdc:mga03683_13444_c1_1177_1581 132
165 3300050490 nmdc:mga03n38_89912_c1 nmdc:mga03n38_89912_c1_50_454 132
166 3300050496 nmdc:mga07m45_91276_c1 nmdc:mga07m45_91276_c1_964_1368 132
167 3300053139 Ga0500568_0093111 Ga0500568_0093111_172_588 132
168 3300059493 Ga0587077_024025 Ga0587077_024025_215_631 132
169 3300059623 Ga0587101_004973 Ga0587101_004973_134_550 132
170 3300059639 Ga0587062_006810 Ga0587062_006810_806_1222 132
171 3300031824 Ga0307413_10217370 Ga0307413_102173702 133
172 3300031852 Ga0307410_11616281 Ga0307410_116162812 133
173 3300032002 Ga0307416_100281241 Ga0307416_1002812412 133
174 3300032004 Ga0307414_10608500 Ga0307414_106085002 133
175 3300032005 Ga0307411_10213182 Ga0307411_102131822 133
176 3300041413 Ga0439465_0031449 Ga0439465_0031449_397_813 133
177 3300041491 Ga0451833_1112826 Ga0451833_1112826_158_571 133
178 3300049587 Ga0501071_0716384 Ga0501071_0716384_111_527 133
179 3300025972 Ga0207668_10164141 Ga0207668_101641413 134
180 3300031731 Ga0307405_10512309 Ga0307405_105123092 134
181 3300031824 Ga0307413_11830628 Ga0307413_118306282 134
182 3300032004 Ga0307414_10081189 Ga0307414_100811892 134
183 3300041452 Ga0451793_1555952 Ga0451793_1555952_23_439 134
184 3300048929 Ga0496126_0218725 Ga0496126_0218725_1027_1440 134
185 3300049585 Ga0501069_0373720 Ga0501069_0373720_129_542 134
186 3300059507 Ga0587086_085906 Ga0587086_085906_19_441 134
187 3300005563 Ga0068855_100901836 Ga0068855_1009018362 135
188 3300005614 Ga0068856_100660994 Ga0068856_1006609942 135
189 3300010375 Ga0105239_12650715 Ga0105239_126507151 135
190 3300013104 Ga0157370_10949493 Ga0157370_109494932 135
191 3300013296 Ga0157374_10018795 Ga0157374_100187955 135
192 3300013297 Ga0157378_10798152 Ga0157378_107981522 135
193 3300025949 Ga0207667_10646516 Ga0207667_106465162 135
194 3300031240 Ga0265320_10279697 Ga0265320_102796972 135
195 3300031242 Ga0265329_10252544 Ga0265329_102525441 135
196 3300031247 Ga0265340_10057760 Ga0265340_100577603 135
197 3300031711 Ga0265314_10048467 Ga0265314_100484673 135
198 3300031730 Ga0307516_10082670 Ga0307516_100826702 135
199 3300005327 Ga0070658_10009132 Ga0070658_100091322 136
200 3300005327 Ga0070658_10131827 Ga0070658_101318273 136
201 3300005327 Ga0070658_10726179 Ga0070658_107261792 136
202 3300005329 Ga0070683_100627491 Ga0070683_1006274912 136
203 3300005329 Ga0070683_101216925 Ga0070683_1012169252 136
204 3300005335 Ga0070666_11240084 Ga0070666_112400841 136
205 3300005339 Ga0070660_100034638 Ga0070660_1000346383 136
206 3300005339 Ga0070660_100083536 Ga0070660_1000835362 136
207 3300005339 Ga0070660_100381512 Ga0070660_1003815122 136
208 3300005344 Ga0070661_100022236 Ga0070661_1000222365 136
209 3300005344 Ga0070661_100129884 Ga0070661_1001298842 136
210 3300005344 Ga0070661_100754702 Ga0070661_1007547022 136
211 3300005354 Ga0070675_100662879 Ga0070675_1006628792 136
212 3300005356 Ga0070674_100453017 Ga0070674_1004530172 136
213 3300005366 Ga0070659_100150692 Ga0070659_1001506922 136
214 3300005366 Ga0070659_100755420 Ga0070659_1007554201 136
215 3300005366 Ga0070659_101609656 Ga0070659_1016096561 136
216 3300005456 Ga0070678_100108961 Ga0070678_1001089612 136
217 3300005530 Ga0070679_100141830 Ga0070679_1001418303 136
218 3300005530 Ga0070679_100566984 Ga0070679_1005669841 136
219 3300005535 Ga0070684_102044730 Ga0070684_1020447301 136
220 3300005539 Ga0068853_100000349 Ga0068853_10000034932 136
221 3300005539 Ga0068853_100010907 Ga0068853_1000109074 136
222 3300005539 Ga0068853_100310939 Ga0068853_1003109391 136
223 3300005539 Ga0068853_100368334 Ga0068853_1003683342 136
224 3300005539 Ga0068853_101297905 Ga0068853_1012979051 136
225 3300005539 Ga0068853_101883843 Ga0068853_1018838431 136
226 3300005543 Ga0070672_100893184 Ga0070672_1008931842 136
227 3300005547 Ga0070693_100398108 Ga0070693_1003981082 136
228 3300005563 Ga0068855_100019409 Ga0068855_1000194096 136
229 3300005563 Ga0068855_100103516 Ga0068855_1001035164 136
230 3300005577 Ga0068857_100495828 Ga0068857_1004958282 136
231 3300005578 Ga0068854_100175192 Ga0068854_1001751923 136
232 3300005578 Ga0068854_100646111 Ga0068854_1006461112 136
233 3300005614 Ga0068856_100347165 Ga0068856_1003471653 136
234 3300005614 Ga0068856_100956722 Ga0068856_1009567222 136
235 3300005616 Ga0068852_100010308 Ga0068852_1000103082 136
236 3300005616 Ga0068852_100056190 Ga0068852_1000561903 136
237 3300005616 Ga0068852_100078086 Ga0068852_1000780862 136
238 3300005616 Ga0068852_100579737 Ga0068852_1005797372 136
239 3300005834 Ga0068851_10004013 Ga0068851_100040137 136
240 3300006048 Ga0075363_100246764 Ga0075363_1002467642 136
241 3300006051 Ga0075364_10124886 Ga0075364_101248865 136
242 3300006178 Ga0075367_10063986 Ga0075367_100639862 136
243 3300006186 Ga0075369_10312095 Ga0075369_103120952 136
244 3300006195 Ga0075366_10276303 Ga0075366_102763032 136
245 3300006353 Ga0075370_10087779 Ga0075370_100877792 136
246 3300006881 Ga0068865_100743692 Ga0068865_1007436922 136
247 3300006881 Ga0068865_101246279 Ga0068865_1012462791 136
248 3300009093 Ga0105240_11507339 Ga0105240_115073392 136
249 3300009148 Ga0105243_10819306 Ga0105243_108193062 136
250 3300009174 Ga0105241_10021133 Ga0105241_100211336 136
251 3300009174 Ga0105241_10069780 Ga0105241_100697801 136
252 3300009174 Ga0105241_10421379 Ga0105241_104213792 136
253 3300009174 Ga0105241_10567060 Ga0105241_105670602 136
254 3300009545 Ga0105237_10255147 Ga0105237_102551472 136
255 3300009545 Ga0105237_11723167 Ga0105237_117231672 136
256 3300009545 Ga0105237_11824669 Ga0105237_118246692 136
257 3300009551 Ga0105238_10081963 Ga0105238_100819632 136
258 3300009551 Ga0105238_10217173 Ga0105238_102171732 136
259 3300009551 Ga0105238_10843008 Ga0105238_108430082 136
260 3300010375 Ga0105239_10026037 Ga0105239_100260373 136
261 3300010375 Ga0105239_10727243 Ga0105239_107272431 136
262 3300010375 Ga0105239_12601346 Ga0105239_126013461 136
263 3300011119 Ga0105246_12019631 Ga0105246_120196311 136
264 3300013100 Ga0157373_10233178 Ga0157373_102331782 136
265 3300013102 Ga0157371_10343538 Ga0157371_103435382 136
266 3300013104 Ga0157370_10245263 Ga0157370_102452632 136
267 3300013104 Ga0157370_10636763 Ga0157370_106367632 136
268 3300013104 Ga0157370_10818150 Ga0157370_108181501 136
269 3300013104 Ga0157370_11038552 Ga0157370_110385522 136
270 3300013104 Ga0157370_11563360 Ga0157370_115633602 136
271 3300013105 Ga0157369_10029152 Ga0157369_100291525 136
272 3300013105 Ga0157369_10290816 Ga0157369_102908161 136
273 3300013296 Ga0157374_10320429 Ga0157374_103204293 136
274 3300013307 Ga0157372_10735492 Ga0157372_107354921 136
275 3300014325 Ga0163163_11955551 Ga0163163_119555512 136
276 3300014497 Ga0182008_10113850 Ga0182008_101138502 136
277 3300020069 Ga0197907_10040603 Ga0197907_100406032 136
278 3300020069 Ga0197907_10076440 Ga0197907_100764401 136
279 3300020069 Ga0197907_10838917 Ga0197907_108389171 136
280 3300020070 Ga0206356_10224072 Ga0206356_102240722 136
281 3300020070 Ga0206356_11296514 Ga0206356_112965141 136
282 3300020075 Ga0206349_1250854 Ga0206349_12508542 136
283 3300020076 Ga0206355_1718572 Ga0206355_17185722 136
284 3300020077 Ga0206351_10708264 Ga0206351_107082641 136
285 3300020081 Ga0206354_11675897 Ga0206354_116758971 136
286 3300022467 Ga0224712_10128235 Ga0224712_101282351 136
287 3300022467 Ga0224712_10263735 Ga0224712_102637351 136
288 3300025321 Ga0207656_10017539 Ga0207656_100175392 136
289 3300025321 Ga0207656_10074112 Ga0207656_100741123 136
290 3300025899 Ga0207642_10412584 Ga0207642_104125842 136
291 3300025903 Ga0207680_10942736 Ga0207680_109427361 136
292 3300025909 Ga0207705_10058559 Ga0207705_100585593 136
293 3300025909 Ga0207705_10295202 Ga0207705_102952022 136
294 3300025909 Ga0207705_10783858 Ga0207705_107838582 136
295 3300025911 Ga0207654_10162003 Ga0207654_101620031 136
296 3300025911 Ga0207654_10209766 Ga0207654_102097662 136
297 3300025913 Ga0207695_10255677 Ga0207695_102556772 136
298 3300025914 Ga0207671_10177492 Ga0207671_101774923 136
299 3300025914 Ga0207671_10250159 Ga0207671_102501592 136
300 3300025919 Ga0207657_10009762 Ga0207657_100097628 136
301 3300025919 Ga0207657_10012082 Ga0207657_100120826 136
302 3300025920 Ga0207649_10000527 Ga0207649_1000052721 136
303 3300025920 Ga0207649_11657602 Ga0207649_116576021 136
304 3300025924 Ga0207694_10112207 Ga0207694_101122072 136
305 3300025924 Ga0207694_10274456 Ga0207694_102744562 136
306 3300025926 Ga0207659_10839755 Ga0207659_108397552 136
307 3300025932 Ga0207690_10161424 Ga0207690_101614242 136
308 3300025932 Ga0207690_10643784 Ga0207690_106437842 136
309 3300025932 Ga0207690_10835706 Ga0207690_108357062 136
310 3300025933 Ga0207706_10750713 Ga0207706_107507132 136
311 3300025938 Ga0207704_11041423 Ga0207704_110414232 136
312 3300025945 Ga0207679_10609293 Ga0207679_106092932 136
313 3300025945 Ga0207679_11367393 Ga0207679_113673932 136
314 3300025949 Ga0207667_10082927 Ga0207667_100829273 136
315 3300025949 Ga0207667_10093804 Ga0207667_100938042 136
316 3300025949 Ga0207667_10238663 Ga0207667_102386632 136
317 3300025949 Ga0207667_10279455 Ga0207667_102794552 136
318 3300025949 Ga0207667_10635352 Ga0207667_106353522 136
319 3300025981 Ga0207640_10049846 Ga0207640_100498463 136
320 3300025981 Ga0207640_10350501 Ga0207640_103505012 136
321 3300026035 Ga0207703_10844899 Ga0207703_108448992 136
322 3300026041 Ga0207639_10007233 Ga0207639_100072335 136
323 3300026041 Ga0207639_10011930 Ga0207639_100119303 136
324 3300026041 Ga0207639_10258747 Ga0207639_102587472 136
325 3300026041 Ga0207639_10465282 Ga0207639_104652823 136
326 3300026041 Ga0207639_10537103 Ga0207639_105371032 136
327 3300026041 Ga0207639_12291721 Ga0207639_122917211 136
328 3300026078 Ga0207702_10043009 Ga0207702_100430092 136
329 3300026078 Ga0207702_10250781 Ga0207702_102507813 136
330 3300026078 Ga0207702_10450766 Ga0207702_104507662 136
331 3300026078 Ga0207702_10513496 Ga0207702_105134963 136
332 3300026089 Ga0207648_10319902 Ga0207648_103199022 136
333 3300026116 Ga0207674_10057472 Ga0207674_100574722 136
334 3300026116 Ga0207674_10188809 Ga0207674_101888092 136
335 3300026121 Ga0207683_10157290 Ga0207683_101572902 136
336 3300026142 Ga0207698_10026340 Ga0207698_100263403 136
337 3300026142 Ga0207698_10834375 Ga0207698_108343752 136
338 3300026142 Ga0207698_10980511 Ga0207698_109805112 136
339 3300027866 Ga0209813_10313709 Ga0209813_103137092 136
340 3300028800 Ga0265338_10039703 Ga0265338_100397033 136
341 3300031235 Ga0265330_10054166 Ga0265330_100541662 136
342 3300031241 Ga0265325_10006244 Ga0265325_100062443 136
343 3300031249 Ga0265339_10000389 Ga0265339_100003895 136
344 3300031250 Ga0265331_10058989 Ga0265331_100589892 136
345 3300031344 Ga0265316_10384392 Ga0265316_103843922 136
346 3300031595 Ga0265313_10000449 Ga0265313_1000044929 136
347 3300031711 Ga0265314_10202461 Ga0265314_102024612 136
348 3300031712 Ga0265342_10088252 Ga0265342_100882522 136
349 3300031901 Ga0307406_10419607 Ga0307406_104196072 136
350 3300035084 Ga0373928_0166449 Ga0373928_0166449_132_548 136
351 3300035114 Ga0373939_0163946 Ga0373939_0163946_187_603 136
352 3300035242 Ga0373962_0149049 Ga0373962_0149049_261_677 136
353 3300037418 Ga0395900_0303920 Ga0395900_0303920_868_1284 136
354 3300037418 Ga0395900_0869459 Ga0395900_0869459_231_647 136
355 3300037466 Ga0395898_0527032 Ga0395898_0527032_560_976 136
356 3300037466 Ga0395898_1218449 Ga0395898_1218449_98_514 136
357 3300038443 Ga0395901_0161843 Ga0395901_0161843_502_918 136
358 3300048912 Ga0496109_0550826 Ga0496109_0550826_309_725 136
359 3300048924 Ga0496121_0679346 Ga0496121_0679346_49_471 136
360 3300049570 Ga0501033_0078836 Ga0501033_0078836_187_603 136
361 3300049571 Ga0501034_0205236 Ga0501034_0205236_295_711 136
362 3300049571 Ga0501034_0254375 Ga0501034_0254375_766_1191 136
363 3300049571 Ga0501034_0399848 Ga0501034_0399848_352_768 136
364 3300049572 Ga0501036_0014336 Ga0501036_0014336_1066_1482 136
365 3300049574 Ga0501038_0140103 Ga0501038_0140103_1300_1716 136
366 3300049580 Ga0501046_0512906 Ga0501046_0512906_367_783 136
367 3300049581 Ga0501047_0619962 Ga0501047_0619962_455_871 136
368 3300049584 Ga0501068_1044394 Ga0501068_1044394_91_507 136
369 3300049586 Ga0501070_0178841 Ga0501070_0178841_829_1245 136
370 3300049822 Ga0501035_0088772 Ga0501035_0088772_215_631 136
371 3300049823 Ga0501044_0181606 Ga0501044_0181606_588_1004 136
372 3300050491 nmdc:mga00v17_355719_c1 nmdc:mga00v17_355719_c1_126_551 136
373 3300050493 nmdc:mga0k408_662336_c1 nmdc:mga0k408_662336_c1_16_444 136
374 3300050493 nmdc:mga0k408_756219_c1 nmdc:mga0k408_756219_c1_12_437 136
375 3300050494 nmdc:mga06z11_26765_c1 nmdc:mga06z11_26765_c1_15_440 136
376 3300050496 nmdc:mga07m45_336907_c1 nmdc:mga07m45_336907_c1_383_808 136
377 3300053108 Ga0500562_044278 Ga0500562_044278_740_1162 136
378 3300059605 Ga0587106_053186 Ga0587106_053186_199_615 136
379 3300005327 Ga0070658_10675998 Ga0070658_106759981 137
380 3300005563 Ga0068855_100359720 Ga0068855_1003597202 137
381 3300009098 Ga0105245_10518199 Ga0105245_105181993 137
382 3300009174 Ga0105241_10473955 Ga0105241_104739552 137
383 3300010375 Ga0105239_10906360 Ga0105239_109063601 137
384 3300014325 Ga0163163_12076793 Ga0163163_120767931 137
385 3300022467 Ga0224712_10059741 Ga0224712_100597413 137
386 3300025904 Ga0207647_10168006 Ga0207647_101680062 137
387 3300025909 Ga0207705_10898585 Ga0207705_108985851 137
388 3300037312 Ga0395899_0117329 Ga0395899_0117329_1254_1673 137
389 3300037418 Ga0395900_0194693 Ga0395900_0194693_555_974 137
390 3300037466 Ga0395898_0544462 Ga0395898_0544462_416_835 137
391 3300047472 Ga0495686_0186405 Ga0495686_0186405_650_1069 137
392 3300049570 Ga0501033_0012313 Ga0501033_0012313_3237_3662 137
393 3300049571 Ga0501034_0398539 Ga0501034_0398539_626_1051 137
394 3300049571 Ga0501034_0541639 Ga0501034_0541639_409_834 137
395 3300049574 Ga0501038_0180253 Ga0501038_0180253_1200_1625 137
396 3300049579 Ga0501043_0197365 Ga0501043_0197365_214_639 137
397 3300049581 Ga0501047_0015714 Ga0501047_0015714_3108_3533 137
398 3300049586 Ga0501070_0012163 Ga0501070_0012163_6764_7189 137
399 3300049822 Ga0501035_0026323 Ga0501035_0026323_4536_4961 137
400 3300049823 Ga0501044_0111536 Ga0501044_0111536_2278_2703 137
401 3300049823 Ga0501044_0492532 Ga0501044_0492532_305_724 137
402 3300053122 Ga0500608_122648 Ga0500608_122648_321_740 137
403 3300053153 Ga0500616_0012756 Ga0500616_0012756_3476_3895 137
404 3300054114 Ga0501084_0303056 Ga0501084_0303056_420_845 137
405 3300005548 Ga0070665_100017471 Ga0070665_1000174715 138
406 3300009545 Ga0105237_10000309 Ga0105237_1000030914 138
407 3300010375 Ga0105239_10000575 Ga0105239_100005756 138
408 3300010375 Ga0105239_12478619 Ga0105239_124786191 138
409 3300014969 Ga0157376_10193623 Ga0157376_101936232 138
410 3300025914 Ga0207671_10000617 Ga0207671_100006173 138
411 3300025932 Ga0207690_10533181 Ga0207690_105331812 138
412 3300026041 Ga0207639_10937559 Ga0207639_109375592 138
413 3300028379 Ga0268266_10000265 Ga0268266_1000026543 138
414 3300032002 Ga0307416_103163332 Ga0307416_1031633321 138
415 3300041408 Ga0439453_0176018 Ga0439453_0176018_51_485 138
416 3300048924 Ga0496121_0255500 Ga0496121_0255500_131_562 138
417 3300048929 Ga0496126_0493408 Ga0496126_0493408_339_770 138
418 3300005842 Ga0068858_100518060 Ga0068858_1005180602 139
419 3300026035 Ga0207703_10809022 Ga0207703_108090222 139
420 3300049569 Ga0501032_0209597 Ga0501032_0209597_341_766 139
421 3300049570 Ga0501033_0593259 Ga0501033_0593259_185_610 139
422 3300049573 Ga0501037_0301824 Ga0501037_0301824_454_879 139
423 3300049574 Ga0501038_0092330 Ga0501038_0092330_1130_1555 139
424 3300049579 Ga0501043_0912789 Ga0501043_0912789_13_438 139
425 3300049580 Ga0501046_0121940 Ga0501046_0121940_301_726 139
426 3300049586 Ga0501070_0102572 Ga0501070_0102572_475_900 139
427 3300049822 Ga0501035_0005658 Ga0501035_0005658_8335_8760 139
428 3300005327 Ga0070658_10194762 Ga0070658_101947622 140
429 3300049586 Ga0501070_0705973 Ga0501070_0705973_29_463 141
430 3300003214 JGI25165J46597_1035532 JGI25165J46597_10355321 142
431 3300025231 Ga0207427_101879 Ga0207427_1018792 142
432 3300025261 Ga0209233_1001040 Ga0209233_10010409 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

41

114

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9062 45 142
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.9033 45 141
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.9009 45 134
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8776 45 141
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.8732 45 134
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9636 56 140 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9217 56 140 3.30.300.130
3cq2B00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9016 45 141 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8951 42 121 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8931 37 120 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A3A1WTA3-F1-model_v4 SUF system Fe-S cluster assembly protein 0.9884 37 142
AF-A0A0M9GNF3-F1-model_v4 FeS assembly SUF system protein 0.9855 34 142
AF-A0A3D2FD25-F1-model_v4 SUF system Fe-S cluster assembly protein 0.9839 46 136
AF-A0A3S1WQW6-F1-model_v4 deleted 0.9833 50 142
AF-A0A0C2AA83-F1-model_v4 deleted 0.9816 34 142

Feature Viewer

pLDDT pTM Quality
70.81 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map