F442243

General Info

Members Datasets Scaffolds Average Seq Length
430 257 860 113

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0746636|Ga0501042_0746636_70_468
Length 132
Sequence LQAPANSEPDVWTSAGGAMDSCLFCALVAGKVKADIVYRDERIVAFKDVKPQAPVHLLLIPRKHLAGVLDIEPDDHLLIGEIFHVAARLARDHGIADSGFRVVVNSGADAGQSVFHLHYHLIGGRLMTWPPG

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
249 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
250 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
251 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
252 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
253 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
254 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
255 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
256 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
257 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.23
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.23
Rhizoplane 2.09
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 24.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0746636 3300049578 Unclassified 712
2 rootH1_10178011 3300003323 Bacteria 5660
3 Ga0055532_1000524 3300003758 Bacteria 16779
4 JGI25405J52794_10002031 3300003911 Unclassified 3434
5 Ga0065704_10256606 3300005289 Unclassified 937
6 Ga0065712_10001764 3300005290 Bacteria 12242
7 Ga0065715_10010544 3300005293 Bacteria 3191
8 Ga0065707_10083129 3300005295 Bacteria 10286
9 Ga0065707_10175742 3300005295 Bacteria 1452
10 Ga0070658_10747902 3300005327 Unclassified 849
11 Ga0070658_11282175 3300005327 Unclassified 636
12 Ga0070676_11109061 3300005328 Bacteria 598
13 Ga0070683_101587063 3300005329 Bacteria 629
14 Ga0070690_100079328 3300005330 Bacteria 2146
15 Ga0070670_100007719 3300005331 Bacteria 9146
16 Ga0070670_100152677 3300005331 Bacteria 1999
17 Ga0070677_10016181 3300005333 Bacteria 2653
18 Ga0068869_101048192 3300005334 Unclassified 712
19 Ga0070666_10026148 3300005335 Bacteria 3810
20 Ga0070666_11023941 3300005335 Bacteria 613
21 Ga0070666_11172897 3300005335 Unclassified 572
22 Ga0070680_100013209 3300005336 Bacteria 6428
23 Ga0070680_100128660 3300005336 Bacteria 2117
24 Ga0070680_100469504 3300005336 Bacteria 1075
25 Ga0070682_100055494 3300005337 Unclassified 2488
26 Ga0070660_100050994 3300005339 Bacteria 3185
27 Ga0070689_102097959 3300005340 Unclassified 518
28 Ga0070691_10015494 3300005341 Bacteria 3503
29 Ga0070687_100043264 3300005343 Bacteria 2288
30 Ga0070661_100039475 3300005344 Bacteria 3439
31 Ga0070661_100828027 3300005344 Bacteria 761
32 Ga0070661_101692586 3300005344 Bacteria 536
33 Ga0070668_100046953 3300005347 Bacteria 3319
34 Ga0070668_100978912 3300005347 Bacteria 759
35 Ga0070669_100032713 3300005353 Bacteria 3757
36 Ga0070675_100124202 3300005354 Bacteria 2195
37 Ga0070675_101054477 3300005354 Unclassified 747
38 Ga0070675_101546909 3300005354 Bacteria 612
39 Ga0070671_100083022 3300005355 Bacteria 2679
40 Ga0070671_100112941 3300005355 Bacteria 2283
41 Ga0070671_100904299 3300005355 Bacteria 771
42 Ga0070674_100005438 3300005356 Bacteria 7356
43 Ga0070673_100140663 3300005364 Bacteria 2035
44 Ga0070673_101790253 3300005364 Bacteria 582
45 Ga0070688_100295034 3300005365 Bacteria 1170
46 Ga0070688_100852783 3300005365 Unclassified 716
47 Ga0070659_100020894 3300005366 Bacteria 4979
48 Ga0070667_100014494 3300005367 Bacteria 6514
49 Ga0070714_100144915 3300005435 Unclassified 2135
50 Ga0070710_10972704 3300005437 Bacteria 617
51 Ga0070700_100149912 3300005441 Bacteria 1594
52 Ga0070700_100199358 3300005441 Bacteria 1405
53 Ga0070694_100071464 3300005444 Bacteria 2392
54 Ga0070694_100091670 3300005444 Bacteria 2134
55 Ga0070694_100948969 3300005444 Bacteria 712
56 Ga0070708_100842780 3300005445 Unclassified 861
57 Ga0070678_100067213 3300005456 Bacteria 2667
58 Ga0070678_100245244 3300005456 Bacteria 1500
59 Ga0070662_100364479 3300005457 Unclassified 1186
60 Ga0070681_10001378 3300005458 Bacteria 21303
61 Ga0070681_10001997 3300005458 Bacteria 18468
62 Ga0070681_10192300 3300005458 Bacteria 1960
63 Ga0068867_100018943 3300005459 Bacteria 4900
64 Ga0068867_101468890 3300005459 Bacteria 634
65 Ga0070706_100046320 3300005467 Bacteria 4015
66 Ga0070707_100094804 3300005468 Bacteria 2890
67 Ga0070707_100343919 3300005468 Bacteria 1449
68 Ga0070698_100184512 3300005471 Bacteria 2024
69 Ga0070698_100370710 3300005471 Bacteria 1364
70 Ga0070699_100418054 3300005518 Unclassified 1213
71 Ga0070679_100003081 3300005530 Bacteria 15237
72 Ga0070679_100032419 3300005530 Bacteria 5168
73 Ga0070679_100072531 3300005530 Bacteria 3435
74 Ga0070697_100727749 3300005536 Unclassified 876
75 Ga0070697_101099978 3300005536 Unclassified 707
76 Ga0070672_100032627 3300005543 Bacteria 3932
77 Ga0070672_100033275 3300005543 Bacteria 3902
78 Ga0070672_100150823 3300005543 Bacteria 1923
79 Ga0070672_100427895 3300005543 Unclassified 1138
80 Ga0070686_100006604 3300005544 Bacteria 6456
81 Ga0070686_100519877 3300005544 Bacteria 926
82 Ga0070695_100087452 3300005545 Bacteria 2073
83 Ga0070695_100141728 3300005545 Bacteria 1667
84 Ga0070695_100818654 3300005545 Bacteria 747
85 Ga0070696_100063932 3300005546 Bacteria 2578
86 Ga0070696_100072916 3300005546 Bacteria 2418
87 Ga0070696_102023176 3300005546 Unclassified 500
88 Ga0070693_100071578 3300005547 Unclassified 2044
89 Ga0070693_100498599 3300005547 Unclassified 863
90 Ga0070665_100147998 3300005548 Bacteria 2351
91 Ga0070665_100354611 3300005548 Bacteria 1472
92 Ga0070704_100051388 3300005549 Bacteria 2902
93 Ga0068855_101476769 3300005563 Unclassified 699
94 Ga0070664_100001735 3300005564 Bacteria 17446
95 Ga0070664_100064064 3300005564 Bacteria 3135
96 Ga0070664_100334761 3300005564 Bacteria 1374
97 Ga0070664_101352561 3300005564 Bacteria 673
98 Ga0068857_100563939 3300005577 Unclassified 1074
99 Ga0068857_100737793 3300005577 Bacteria 937
100 Ga0068854_100069424 3300005578 Bacteria 2573
101 Ga0068856_100097673 3300005614 Bacteria 2926
102 Ga0068856_100327365 3300005614 Bacteria 1550
103 Ga0070702_100022091 3300005615 Bacteria 3359
104 Ga0068852_100060283 3300005616 Bacteria 3294
105 Ga0068852_101048113 3300005616 Unclassified 835
106 Ga0068859_102747874 3300005617 Bacteria 541
107 Ga0068864_100688616 3300005618 Unclassified 998
108 Ga0068864_101179920 3300005618 Bacteria 764
109 Ga0068866_10224700 3300005718 Unclassified 1135
110 Ga0068861_100101613 3300005719 Bacteria 2287
111 Ga0068863_100245463 3300005841 Bacteria 1729
112 Ga0068858_101661673 3300005842 Unclassified 630
113 Ga0068858_102060217 3300005842 Unclassified 564
114 Ga0068860_100432685 3300005843 Unclassified 1306
115 Ga0081455_10000905 3300005937 Bacteria 38177
116 Ga0081455_10095552 3300005937 Bacteria 2398
117 Ga0081455_10715332 3300005937 Unclassified 636
118 Ga0081538_10115062 3300005981 Bacteria 1308
119 Ga0075365_10724820 3300006038 Unclassified 702
120 Ga0075368_10414461 3300006042 Unclassified 593
121 Ga0075363_100000502 3300006048 Bacteria 12479
122 Ga0075364_10008010 3300006051 Bacteria 6298
123 Ga0075364_10257922 3300006051 Unclassified 1185
124 Ga0075364_11020035 3300006051 Bacteria 562
125 Ga0075362_10000014 3300006177 Bacteria 98315
126 Ga0075367_10026207 3300006178 Bacteria 3304
127 Ga0097621_100066519 3300006237 Unclassified 2968
128 Ga0097621_101244685 3300006237 Unclassified 702
129 Ga0097621_102375109 3300006237 Unclassified 507
130 Ga0068871_100075440 3300006358 Unclassified 2783
131 Ga0068871_100468673 3300006358 Unclassified 1131
132 Ga0068871_102034870 3300006358 Bacteria 547
133 Ga0075428_101248675 3300006844 Bacteria 782
134 Ga0075428_101986475 3300006844 Bacteria 603
135 Ga0075430_100002885 3300006846 Bacteria 14397
136 Ga0075430_100349116 3300006846 Unclassified 1222
137 Ga0075430_101163839 3300006846 Bacteria 635
138 Ga0075431_100068110 3300006847 Bacteria 3673
139 Ga0075431_101483500 3300006847 Unclassified 637
140 Ga0075433_10115485 3300006852 Bacteria 2382
141 Ga0075433_10270540 3300006852 Bacteria 1506
142 Ga0075433_11590535 3300006852 Unclassified 564
143 Ga0075434_100005143 3300006871 Bacteria 11877
144 Ga0075434_100012010 3300006871 Bacteria 8194
145 Ga0075434_100655688 3300006871 Bacteria 1068
146 Ga0075429_100170567 3300006880 Unclassified 1906
147 Ga0075429_100406614 3300006880 Bacteria 1192
148 Ga0068865_100069794 3300006881 Bacteria 2488
149 Ga0075436_100138770 3300006914 Bacteria 1708
150 Ga0075436_100890373 3300006914 Unclassified 665
151 Ga0097620_102747864 3300006931 Bacteria 541
152 Ga0075435_100053408 3300007076 Unclassified 3259
153 Ga0075435_100258410 3300007076 Bacteria 1484
154 Ga0105240_10325135 3300009093 Unclassified 1752
155 Ga0111539_10156613 3300009094 Unclassified 2666
156 Ga0111539_10297815 3300009094 Bacteria 1877
157 Ga0111539_10426973 3300009094 Bacteria 1543
158 Ga0105245_10261846 3300009098 Bacteria 1683
159 Ga0105247_10684177 3300009101 Bacteria 770
160 Ga0114129_10517363 3300009147 Unclassified 1556
161 Ga0105241_10153483 3300009174 Bacteria 1886
162 Ga0105241_10262139 3300009174 Bacteria 1469
163 Ga0105242_10004249 3300009176 Bacteria 11167
164 Ga0105242_10182877 3300009176 Unclassified 1850
165 Ga0105242_13062810 3300009176 Bacteria 518
166 Ga0105238_10057943 3300009551 Unclassified 3883
167 Ga0105249_10367424 3300009553 Bacteria 1461
168 Ga0105239_10013963 3300010375 Bacteria 8918
169 Ga0105239_10020894 3300010375 Bacteria 7223
170 Ga0105246_10034163 3300011119 Bacteria 3385
171 Ga0157369_10035979 3300013105 Bacteria 5427
172 Ga0157369_11331555 3300013105 Bacteria 732
173 Ga0157369_11458449 3300013105 Bacteria 696
174 Ga0157374_10029790 3300013296 Bacteria 4949
175 Ga0157378_10717472 3300013297 Unclassified 1020
176 Ga0163162_10032149 3300013306 Bacteria 5210
177 Ga0163162_11320373 3300013306 Bacteria 820
178 Ga0157372_10038550 3300013307 Bacteria 5274
179 Ga0157372_10083332 3300013307 Bacteria 3622
180 Ga0157372_10107430 3300013307 Unclassified 3193
181 Ga0157372_10390274 3300013307 Bacteria 1622
182 Ga0157372_12768897 3300013307 Bacteria 562
183 Ga0163163_10547332 3300014325 Unclassified 1220
184 Ga0157380_11525092 3300014326 Unclassified 722
185 Ga0157380_11541891 3300014326 Unclassified 718
186 Ga0157376_10046519 3300014969 Bacteria 3578
187 Ga0182007_10251159 3300015262 Unclassified 634
188 Ga0163161_10251718 3300017792 Bacteria 1377
189 Ga0209147_100042 3300025229 Bacteria 301263
190 Ga0207673_1006570 3300025290 Bacteria 1442
191 Ga0209675_1054410 3300025291 Bacteria 813
192 Ga0207697_10012324 3300025315 Bacteria 3587
193 Ga0207682_10014819 3300025893 Bacteria 3036
194 Ga0207682_10029448 3300025893 Bacteria 2195
195 Ga0207688_10024199 3300025901 Bacteria 3329
196 Ga0207680_10401110 3300025903 Bacteria 969
197 Ga0207645_10001811 3300025907 Bacteria 17246
198 Ga0207645_11100571 3300025907 Unclassified 536
199 Ga0207705_10945563 3300025909 Unclassified 667
200 Ga0207684_10615093 3300025910 Bacteria 927
201 Ga0207707_10039072 3300025912 Bacteria 4148
202 Ga0207707_10103699 3300025912 Bacteria 2486
203 Ga0207707_10315109 3300025912 Bacteria 1351
204 Ga0207695_10000112 3300025913 Bacteria 248037
205 Ga0207660_10070357 3300025917 Bacteria 2543
206 Ga0207660_10318290 3300025917 Bacteria 1242
207 Ga0207660_10983244 3300025917 Unclassified 688
208 Ga0207662_10675221 3300025918 Unclassified 723
209 Ga0207657_10001886 3300025919 Bacteria 22653
210 Ga0207652_10008633 3300025921 Bacteria 8199
211 Ga0207652_10009169 3300025921 Bacteria 7964
212 Ga0207652_10127102 3300025921 Bacteria 2271
213 Ga0207646_10808150 3300025922 Bacteria 835
214 Ga0207646_11020847 3300025922 Unclassified 730
215 Ga0207646_11600407 3300025922 Unclassified 562
216 Ga0207681_10067801 3300025923 Bacteria 2475
217 Ga0207694_10036447 3300025924 Unclassified 3776
218 Ga0207650_10001698 3300025925 Bacteria 15651
219 Ga0207650_10394191 3300025925 Bacteria 1145
220 Ga0207659_10150185 3300025926 Bacteria 1819
221 Ga0207664_10190975 3300025929 Bacteria 1763
222 Ga0207644_10027293 3300025931 Bacteria 3944
223 Ga0207644_10101899 3300025931 Bacteria 2158
224 Ga0207644_10409218 3300025931 Bacteria 1110
225 Ga0207644_10780466 3300025931 Bacteria 799
226 Ga0207690_10063597 3300025932 Bacteria 2516
227 Ga0207706_10004222 3300025933 Bacteria 13532
228 Ga0207670_10265554 3300025936 Bacteria 1332
229 Ga0207669_10144268 3300025937 Bacteria 1658
230 Ga0207669_10212513 3300025937 Bacteria 1413
231 Ga0207704_10223814 3300025938 Bacteria 1394
232 Ga0207691_10017146 3300025940 Bacteria 6870
233 Ga0207691_10020542 3300025940 Bacteria 6244
234 Ga0207691_10251754 3300025940 Bacteria 1525
235 Ga0207691_10463510 3300025940 Bacteria 1078
236 Ga0207689_10090350 3300025942 Bacteria 2516
237 Ga0207679_10049954 3300025945 Unclassified 3053
238 Ga0207679_10189099 3300025945 Bacteria 1710
239 Ga0207679_10549969 3300025945 Bacteria 1036
240 Ga0207667_10055179 3300025949 Bacteria 4177
241 Ga0207667_10063457 3300025949 Bacteria 3860
242 Ga0207667_11114414 3300025949 Viruses 772
243 Ga0207667_11186447 3300025949 Bacteria 744
244 Ga0207667_11719935 3300025949 Unclassified 593
245 Ga0207651_10115341 3300025960 Bacteria 2025
246 Ga0207651_10540924 3300025960 Bacteria 1012
247 Ga0207712_10279544 3300025961 Bacteria 1362
248 Ga0207703_12198048 3300026035 Unclassified 528
249 Ga0207678_10105716 3300026067 Bacteria 2401
250 Ga0207678_10602600 3300026067 Bacteria 963
251 Ga0207702_10272316 3300026078 Bacteria 1597
252 Ga0207702_10328771 3300026078 Bacteria 1457
253 Ga0207641_10603497 3300026088 Bacteria 1075
254 Ga0207648_10087311 3300026089 Bacteria 2722
255 Ga0207676_10749860 3300026095 Unclassified 949
256 Ga0207675_100244126 3300026118 Bacteria 1736
257 Ga0207683_10007279 3300026121 Bacteria 9484
258 Ga0207683_10054628 3300026121 Bacteria 3502
259 Ga0207683_11679524 3300026121 Bacteria 584
260 Ga0209969_1023366 3300027360 Unclassified 927
261 Ga0209967_1005918 3300027364 Bacteria 1652
262 Ga0209996_1013166 3300027395 Bacteria 1116
263 Ga0210002_1016972 3300027617 Bacteria 1156
264 Ga0209983_1006444 3300027665 Bacteria 2411
265 Ga0209971_1056965 3300027682 Bacteria 945
266 Ga0209971_1059042 3300027682 Bacteria 928
267 Ga0209966_1031697 3300027695 Bacteria 1073
268 Ga0209998_10004370 3300027717 Bacteria 3007
269 Ga0209974_10001063 3300027876 Bacteria 9740
270 Ga0209974_10016302 3300027876 Bacteria 2467
271 Ga0268266_10170771 3300028379 Bacteria 1974
272 Ga0268266_10439567 3300028379 Archaea 1239
273 Ga0268265_11850581 3300028380 Unclassified 610
274 Ga0268264_11094804 3300028381 Unclassified 805
275 Ga0307410_10515712 3300031852 Bacteria 986
276 Ga0307412_10071494 3300031911 Bacteria 2369
277 Ga0307409_101950367 3300031995 Bacteria 617
278 Ga0307414_10390352 3300032004 Bacteria 1206
279 Ga0307411_12112648 3300032005 Bacteria 527
280 Ga0316593_10027213 3300032168 Bacteria 1833
281 Ga0373934_0179447 3300035086 Bacteria 870
282 Ga0373953_0332415 3300035117 Unclassified 665
283 Ga0373931_0148147 3300035691 Bacteria 1366
284 Ga0373931_0284852 3300035691 Bacteria 1016
285 Ga0373937_0021529 3300036401 Bacteria 5787
286 Ga0373937_0025054 3300036401 Bacteria 5386
287 Ga0316582_0282601 3300036647 Bacteria 1139
288 Ga0373925_1666961 3300037068 Bacteria 521
289 Ga0395900_0102264 3300037418 Bacteria 2944
290 Ga0395901_0347470 3300038443 Bacteria 1531
291 Ga0450923_132419 3300042125 Bacteria 594
292 Ga0439435_0112508 3300042436 Bacteria 846
293 Ga0439435_0266747 3300042436 Unclassified 580
294 Ga0439444_0070226 3300042437 Bacteria 748
295 Ga0439464_0082971 3300042439 Unclassified 959
296 Ga0451577_1086476 3300042876 Unclassified 716
297 Ga0453684_0010339 3300044712 Bacteria 15977
298 Ga0451576_1043393 3300045051 Unclassified 856
299 Ga0451576_1162587 3300045051 Bacteria 806
300 Ga0495592_0187049 3300046454 Bacteria 1406
301 Ga0495651_0511848 3300046462 Unclassified 767
302 Ga0495580_0372191 3300046472 Bacteria 966
303 Ga0495652_0117638 3300046529 Bacteria 2126
304 Ga0495645_0097961 3300046543 Bacteria 2088
305 Ga0496101_0745565 3300048904 Unclassified 773
306 Ga0496102_0270821 3300048905 Bacteria 1601
307 Ga0496106_0918040 3300048909 Unclassified 691
308 Ga0496108_0286963 3300048911 Bacteria 1433
309 Ga0496108_0937470 3300048911 Bacteria 742
310 Ga0496110_0006422 3300048913 Bacteria 9309
311 Ga0496110_0446535 3300048913 Bacteria 1179
312 Ga0496112_0053619 3300048915 Bacteria 3961
313 Ga0496113_0316242 3300048916 Bacteria 1251
314 Ga0501031_0047143 3300049568 Bacteria 2809
315 Ga0501032_0040792 3300049569 Bacteria 3154
316 Ga0501033_0133684 3300049570 Bacteria 1795
317 Ga0501034_0000755 3300049571 Bacteria 48638
318 Ga0501034_0005352 3300049571 Bacteria 14050
319 Ga0501034_0082226 3300049571 Unclassified 3223
320 Ga0501036_0515639 3300049572 Bacteria 994
321 Ga0501036_0586291 3300049572 Bacteria 925
322 Ga0501037_0018251 3300049573 Bacteria 5169
323 Ga0501038_0044059 3300049574 Bacteria 3878
324 Ga0501038_0513354 3300049574 Bacteria 915
325 Ga0501039_0012500 3300049575 Bacteria 6483
326 Ga0501039_0158275 3300049575 Bacteria 1780
327 Ga0501040_0027252 3300049576 Unclassified 3846
328 Ga0501040_0139509 3300049576 Bacteria 1707
329 Ga0501040_0201416 3300049576 Bacteria 1413
330 Ga0501041_0057405 3300049577 Bacteria 2380
331 Ga0501041_0254764 3300049577 Bacteria 1103
332 Ga0501042_0253609 3300049578 Bacteria 1269
333 Ga0501043_0793433 3300049579 Bacteria 685
334 Ga0501046_0038803 3300049580 Unclassified 3820
335 Ga0501047_0254788 3300049581 Bacteria 1603
336 Ga0501047_0313510 3300049581 Bacteria 1409
337 Ga0501048_0014930 3300049582 Bacteria 5744
338 Ga0501048_0226358 3300049582 Unclassified 1327
339 Ga0501068_0016701 3300049584 Unclassified 4234
340 Ga0501068_1129413 3300049584 Unclassified 518
341 Ga0501069_0019328 3300049585 Bacteria 3683
342 Ga0501070_0248483 3300049586 Bacteria 1455
343 Ga0501070_0411269 3300049586 Bacteria 1093
344 Ga0501070_0816697 3300049586 Bacteria 731
345 Ga0501071_0057620 3300049587 Bacteria 2808
346 Ga0501071_0090678 3300049587 Bacteria 2244
347 Ga0501071_1011341 3300049587 Unclassified 642
348 Ga0501071_1118605 3300049587 Unclassified 608
349 Ga0501072_0031468 3300049588 Bacteria 4154
350 Ga0501072_0176622 3300049588 Bacteria 1703
351 Ga0501072_0349329 3300049588 Bacteria 1174
352 Ga0501073_0027845 3300049589 Unclassified 4038
353 Ga0501074_0020391 3300049590 Bacteria 4818
354 Ga0501074_0513376 3300049590 Unclassified 849
355 Ga0501074_0566107 3300049590 Bacteria 804
356 Ga0501075_0013939 3300049591 Bacteria 5751
357 Ga0501075_0024897 3300049591 Bacteria 4394
358 Ga0501076_0003488 3300049592 Bacteria 11049
359 Ga0501076_0108001 3300049592 Bacteria 2247
360 Ga0501076_0144427 3300049592 Bacteria 1934
361 Ga0501077_0005729 3300049593 Bacteria 7566
362 Ga0501077_0005775 3300049593 Bacteria 7537
363 Ga0501077_0194828 3300049593 Bacteria 1287
364 Ga0501259_000055 3300049688 Bacteria 15534
365 Ga0501079_0062600 3300049741 Unclassified 2870
366 Ga0501079_0537994 3300049741 Bacteria 918
367 Ga0501080_0073074 3300049742 Bacteria 3190
368 Ga0501080_0115885 3300049742 Unclassified 2484
369 Ga0501080_0146264 3300049742 Bacteria 2184
370 Ga0501080_1160363 3300049742 Unclassified 665
371 Ga0501081_0000203 3300049743 Bacteria 28999
372 Ga0501081_0080981 3300049743 Bacteria 2273
373 Ga0501081_0513346 3300049743 Bacteria 894
374 Ga0501081_1488235 3300049743 Unclassified 514
375 Ga0501081_1515295 3300049743 Bacteria 509
376 Ga0501083_0042168 3300049744 Bacteria 3094
377 Ga0501083_0166362 3300049744 Bacteria 1442
378 Ga0501083_0454896 3300049744 Unclassified 833
379 Ga0501035_0182310 3300049822 Bacteria 1808
380 Ga0501044_0001558 3300049823 Bacteria 26864
381 Ga0501044_0115407 3300049823 Bacteria 2691
382 Ga0501044_0126476 3300049823 Unclassified 2553
383 Ga0501044_0375579 3300049823 Bacteria 1337
384 Ga0501045_0037068 3300049824 Bacteria 3543
385 Ga0501045_0049164 3300049824 Bacteria 3075
386 Ga0501045_0651619 3300049824 Unclassified 778
387 nmdc:mga03683_9_c1 3300050489 Bacteria 137145
388 nmdc:mga03n38_8369_c1 3300050490 Bacteria 3711
389 nmdc:mga00v17_61_c1 3300050491 Bacteria 67209
390 nmdc:mga00v17_892772_c1 3300050491 Bacteria 563
391 nmdc:mga0yw44_630017_c1 3300050492 Unclassified 729
392 nmdc:mga07m45_394_c1 3300050496 Bacteria 18028
393 nmdc:mga05p37_585752_c1 3300050507 Unclassified 1262
394 nmdc:mga09592_159040_c1 3300050508 Bacteria 1951
395 nmdc:mga0qj67_1119394_c1 3300050509 Unclassified 615
396 nmdc:mga06r32_1217370_c1 3300050510 Unclassified 699
397 nmdc:mga06r32_66703_c1 3300050510 Bacteria 3473
398 nmdc:mga08y16_1097046_c1 3300050511 Unclassified 771
399 nmdc:mga08y16_239358_c1 3300050511 Unclassified 1876
400 nmdc:mga08y16_539092_c1 3300050511 Bacteria 1182
401 nmdc:mga0n895_102439_c1 3300050512 Unclassified 2873
402 nmdc:mga0n895_11758_c1 3300050512 Bacteria 7824
403 nmdc:mga0n895_6875_c1 3300050512 Bacteria 9716
404 nmdc:mga0rr50_330739_c1 3300050513 Bacteria 1279
405 nmdc:mga0rr50_711323_c1 3300050513 Bacteria 857
406 nmdc:mga0rr50_7334_c1 3300050513 Bacteria 6790
407 nmdc:mga08x19_736067_c1 3300050514 Unclassified 700
408 nmdc:mga08x19_80136_c1 3300050514 Bacteria 2142
409 nmdc:mga0a205_163856_c1 3300050515 Bacteria 2119
410 Ga0495619_0573423 3300053085 Bacteria 773
411 Ga0500638_000023 3300053162 Bacteria 67291
412 Ga0501084_0166614 3300054114 Bacteria 1859
413 Ga0501084_0277034 3300054114 Bacteria 1416
414 Ga0590075_006472 3300059424 Bacteria 2778
415 Ga0501082_0037376 3300060353 Unclassified 4185
416 Ga0501082_0043505 3300060353 Bacteria 3872
417 Ga0501082_0084363 3300060353 Bacteria 2740
418 Ga0501082_0191727 3300060353 Bacteria 1778
419 Ga0530510_0021904 3300061734 Bacteria 4549
420 Ga0530510_0035378 3300061734 Unclassified 3599
421 Ga0530510_0054538 3300061734 Unclassified 2888
422 2511178844 2510917027 Bacteria 5287437
423 2512640380 2512564013 Bacteria 6286191
424 2745165828 2744054657 Bacteria 5016802
425 2817618865 2816332336 Bacteria 5207640
426 2857469762 2857465823 Bacteria 6772595
427 2857591901 2857591370 Bacteria 6569758
428 2915601242 2915597211 Bacteria 6475886
429 2915607526 2915606848 Bacteria 6032732
430 2929186396 2929183550 Bacteria 6377511
431 Ga0501042_0746636
432 rootH1_10178011
433 Ga0055532_1000524
434 JGI25405J52794_10002031
435 Ga0065704_10256606
436 Ga0065712_10001764
437 Ga0065715_10010544
438 Ga0065707_10083129
439 Ga0065707_10175742
440 Ga0070658_10747902
441 Ga0070658_11282175
442 Ga0070676_11109061
443 Ga0070683_101587063
444 Ga0070690_100079328
445 Ga0070670_100007719
446 Ga0070670_100152677
447 Ga0070677_10016181
448 Ga0068869_101048192
449 Ga0070666_10026148
450 Ga0070666_11023941
451 Ga0070666_11172897
452 Ga0070680_100013209
453 Ga0070680_100128660
454 Ga0070680_100469504
455 Ga0070682_100055494
456 Ga0070660_100050994
457 Ga0070689_102097959
458 Ga0070691_10015494
459 Ga0070687_100043264
460 Ga0070661_100039475
461 Ga0070661_100828027
462 Ga0070661_101692586
463 Ga0070668_100046953
464 Ga0070668_100978912
465 Ga0070669_100032713
466 Ga0070675_100124202
467 Ga0070675_101054477
468 Ga0070675_101546909
469 Ga0070671_100083022
470 Ga0070671_100112941
471 Ga0070671_100904299
472 Ga0070674_100005438
473 Ga0070673_100140663
474 Ga0070673_101790253
475 Ga0070688_100295034
476 Ga0070688_100852783
477 Ga0070659_100020894
478 Ga0070667_100014494
479 Ga0070714_100144915
480 Ga0070710_10972704
481 Ga0070700_100149912
482 Ga0070700_100199358
483 Ga0070694_100071464
484 Ga0070694_100091670
485 Ga0070694_100948969
486 Ga0070708_100842780
487 Ga0070678_100067213
488 Ga0070678_100245244
489 Ga0070662_100364479
490 Ga0070681_10001378
491 Ga0070681_10001997
492 Ga0070681_10192300
493 Ga0068867_100018943
494 Ga0068867_101468890
495 Ga0070706_100046320
496 Ga0070707_100094804
497 Ga0070707_100343919
498 Ga0070698_100184512
499 Ga0070698_100370710
500 Ga0070699_100418054
501 Ga0070679_100003081
502 Ga0070679_100032419
503 Ga0070679_100072531
504 Ga0070697_100727749
505 Ga0070697_101099978
506 Ga0070672_100032627
507 Ga0070672_100033275
508 Ga0070672_100150823
509 Ga0070672_100427895
510 Ga0070686_100006604
511 Ga0070686_100519877
512 Ga0070695_100087452
513 Ga0070695_100141728
514 Ga0070695_100818654
515 Ga0070696_100063932
516 Ga0070696_100072916
517 Ga0070696_102023176
518 Ga0070693_100071578
519 Ga0070693_100498599
520 Ga0070665_100147998
521 Ga0070665_100354611
522 Ga0070704_100051388
523 Ga0068855_101476769
524 Ga0070664_100001735
525 Ga0070664_100064064
526 Ga0070664_100334761
527 Ga0070664_101352561
528 Ga0068857_100563939
529 Ga0068857_100737793
530 Ga0068854_100069424
531 Ga0068856_100097673
532 Ga0068856_100327365
533 Ga0070702_100022091
534 Ga0068852_100060283
535 Ga0068852_101048113
536 Ga0068859_102747874
537 Ga0068864_100688616
538 Ga0068864_101179920
539 Ga0068866_10224700
540 Ga0068861_100101613
541 Ga0068863_100245463
542 Ga0068858_101661673
543 Ga0068858_102060217
544 Ga0068860_100432685
545 Ga0081455_10000905
546 Ga0081455_10095552
547 Ga0081455_10715332
548 Ga0081538_10115062
549 Ga0075365_10724820
550 Ga0075368_10414461
551 Ga0075363_100000502
552 Ga0075364_10008010
553 Ga0075364_10257922
554 Ga0075364_11020035
555 Ga0075362_10000014
556 Ga0075367_10026207
557 Ga0097621_100066519
558 Ga0097621_101244685
559 Ga0097621_102375109
560 Ga0068871_100075440
561 Ga0068871_100468673
562 Ga0068871_102034870
563 Ga0075428_101248675
564 Ga0075428_101986475
565 Ga0075430_100002885
566 Ga0075430_100349116
567 Ga0075430_101163839
568 Ga0075431_100068110
569 Ga0075431_101483500
570 Ga0075433_10115485
571 Ga0075433_10270540
572 Ga0075433_11590535
573 Ga0075434_100005143
574 Ga0075434_100012010
575 Ga0075434_100655688
576 Ga0075429_100170567
577 Ga0075429_100406614
578 Ga0068865_100069794
579 Ga0075436_100138770
580 Ga0075436_100890373
581 Ga0097620_102747864
582 Ga0075435_100053408
583 Ga0075435_100258410
584 Ga0105240_10325135
585 Ga0111539_10156613
586 Ga0111539_10297815
587 Ga0111539_10426973
588 Ga0105245_10261846
589 Ga0105247_10684177
590 Ga0114129_10517363
591 Ga0105241_10153483
592 Ga0105241_10262139
593 Ga0105242_10004249
594 Ga0105242_10182877
595 Ga0105242_13062810
596 Ga0105238_10057943
597 Ga0105249_10367424
598 Ga0105239_10013963
599 Ga0105239_10020894
600 Ga0105246_10034163
601 Ga0157369_10035979
602 Ga0157369_11331555
603 Ga0157369_11458449
604 Ga0157374_10029790
605 Ga0157378_10717472
606 Ga0163162_10032149
607 Ga0163162_11320373
608 Ga0157372_10038550
609 Ga0157372_10083332
610 Ga0157372_10107430
611 Ga0157372_10390274
612 Ga0157372_12768897
613 Ga0163163_10547332
614 Ga0157380_11525092
615 Ga0157380_11541891
616 Ga0157376_10046519
617 Ga0182007_10251159
618 Ga0163161_10251718
619 Ga0209147_100042
620 Ga0207673_1006570
621 Ga0209675_1054410
622 Ga0207697_10012324
623 Ga0207682_10014819
624 Ga0207682_10029448
625 Ga0207688_10024199
626 Ga0207680_10401110
627 Ga0207645_10001811
628 Ga0207645_11100571
629 Ga0207705_10945563
630 Ga0207684_10615093
631 Ga0207707_10039072
632 Ga0207707_10103699
633 Ga0207707_10315109
634 Ga0207695_10000112
635 Ga0207660_10070357
636 Ga0207660_10318290
637 Ga0207660_10983244
638 Ga0207662_10675221
639 Ga0207657_10001886
640 Ga0207652_10008633
641 Ga0207652_10009169
642 Ga0207652_10127102
643 Ga0207646_10808150
644 Ga0207646_11020847
645 Ga0207646_11600407
646 Ga0207681_10067801
647 Ga0207694_10036447
648 Ga0207650_10001698
649 Ga0207650_10394191
650 Ga0207659_10150185
651 Ga0207664_10190975
652 Ga0207644_10027293
653 Ga0207644_10101899
654 Ga0207644_10409218
655 Ga0207644_10780466
656 Ga0207690_10063597
657 Ga0207706_10004222
658 Ga0207670_10265554
659 Ga0207669_10144268
660 Ga0207669_10212513
661 Ga0207704_10223814
662 Ga0207691_10017146
663 Ga0207691_10020542
664 Ga0207691_10251754
665 Ga0207691_10463510
666 Ga0207689_10090350
667 Ga0207679_10049954
668 Ga0207679_10189099
669 Ga0207679_10549969
670 Ga0207667_10055179
671 Ga0207667_10063457
672 Ga0207667_11114414
673 Ga0207667_11186447
674 Ga0207667_11719935
675 Ga0207651_10115341
676 Ga0207651_10540924
677 Ga0207712_10279544
678 Ga0207703_12198048
679 Ga0207678_10105716
680 Ga0207678_10602600
681 Ga0207702_10272316
682 Ga0207702_10328771
683 Ga0207641_10603497
684 Ga0207648_10087311
685 Ga0207676_10749860
686 Ga0207675_100244126
687 Ga0207683_10007279
688 Ga0207683_10054628
689 Ga0207683_11679524
690 Ga0209969_1023366
691 Ga0209967_1005918
692 Ga0209996_1013166
693 Ga0210002_1016972
694 Ga0209983_1006444
695 Ga0209971_1056965
696 Ga0209971_1059042
697 Ga0209966_1031697
698 Ga0209998_10004370
699 Ga0209974_10001063
700 Ga0209974_10016302
701 Ga0268266_10170771
702 Ga0268266_10439567
703 Ga0268265_11850581
704 Ga0268264_11094804
705 Ga0307410_10515712
706 Ga0307412_10071494
707 Ga0307409_101950367
708 Ga0307414_10390352
709 Ga0307411_12112648
710 Ga0316593_10027213
711 Ga0373934_0179447
712 Ga0373953_0332415
713 Ga0373931_0148147
714 Ga0373931_0284852
715 Ga0373937_0021529
716 Ga0373937_0025054
717 Ga0316582_0282601
718 Ga0373925_1666961
719 Ga0395900_0102264
720 Ga0395901_0347470
721 Ga0450923_132419
722 Ga0439435_0112508
723 Ga0439435_0266747
724 Ga0439444_0070226
725 Ga0439464_0082971
726 Ga0451577_1086476
727 Ga0453684_0010339
728 Ga0451576_1043393
729 Ga0451576_1162587
730 Ga0495592_0187049
731 Ga0495651_0511848
732 Ga0495580_0372191
733 Ga0495652_0117638
734 Ga0495645_0097961
735 Ga0496101_0745565
736 Ga0496102_0270821
737 Ga0496106_0918040
738 Ga0496108_0286963
739 Ga0496108_0937470
740 Ga0496110_0006422
741 Ga0496110_0446535
742 Ga0496112_0053619
743 Ga0496113_0316242
744 Ga0501031_0047143
745 Ga0501032_0040792
746 Ga0501033_0133684
747 Ga0501034_0000755
748 Ga0501034_0005352
749 Ga0501034_0082226
750 Ga0501036_0515639
751 Ga0501036_0586291
752 Ga0501037_0018251
753 Ga0501038_0044059
754 Ga0501038_0513354
755 Ga0501039_0012500
756 Ga0501039_0158275
757 Ga0501040_0027252
758 Ga0501040_0139509
759 Ga0501040_0201416
760 Ga0501041_0057405
761 Ga0501041_0254764
762 Ga0501042_0253609
763 Ga0501043_0793433
764 Ga0501046_0038803
765 Ga0501047_0254788
766 Ga0501047_0313510
767 Ga0501048_0014930
768 Ga0501048_0226358
769 Ga0501068_0016701
770 Ga0501068_1129413
771 Ga0501069_0019328
772 Ga0501070_0248483
773 Ga0501070_0411269
774 Ga0501070_0816697
775 Ga0501071_0057620
776 Ga0501071_0090678
777 Ga0501071_1011341
778 Ga0501071_1118605
779 Ga0501072_0031468
780 Ga0501072_0176622
781 Ga0501072_0349329
782 Ga0501073_0027845
783 Ga0501074_0020391
784 Ga0501074_0513376
785 Ga0501074_0566107
786 Ga0501075_0013939
787 Ga0501075_0024897
788 Ga0501076_0003488
789 Ga0501076_0108001
790 Ga0501076_0144427
791 Ga0501077_0005729
792 Ga0501077_0005775
793 Ga0501077_0194828
794 Ga0501259_000055
795 Ga0501079_0062600
796 Ga0501079_0537994
797 Ga0501080_0073074
798 Ga0501080_0115885
799 Ga0501080_0146264
800 Ga0501080_1160363
801 Ga0501081_0000203
802 Ga0501081_0080981
803 Ga0501081_0513346
804 Ga0501081_1488235
805 Ga0501081_1515295
806 Ga0501083_0042168
807 Ga0501083_0166362
808 Ga0501083_0454896
809 Ga0501035_0182310
810 Ga0501044_0001558
811 Ga0501044_0115407
812 Ga0501044_0126476
813 Ga0501044_0375579
814 Ga0501045_0037068
815 Ga0501045_0049164
816 Ga0501045_0651619
817 nmdc:mga03683_9_c1
818 nmdc:mga03n38_8369_c1
819 nmdc:mga00v17_61_c1
820 nmdc:mga00v17_892772_c1
821 nmdc:mga0yw44_630017_c1
822 nmdc:mga07m45_394_c1
823 nmdc:mga05p37_585752_c1
824 nmdc:mga09592_159040_c1
825 nmdc:mga0qj67_1119394_c1
826 nmdc:mga06r32_1217370_c1
827 nmdc:mga06r32_66703_c1
828 nmdc:mga08y16_1097046_c1
829 nmdc:mga08y16_239358_c1
830 nmdc:mga08y16_539092_c1
831 nmdc:mga0n895_102439_c1
832 nmdc:mga0n895_11758_c1
833 nmdc:mga0n895_6875_c1
834 nmdc:mga0rr50_330739_c1
835 nmdc:mga0rr50_711323_c1
836 nmdc:mga0rr50_7334_c1
837 nmdc:mga08x19_736067_c1
838 nmdc:mga08x19_80136_c1
839 nmdc:mga0a205_163856_c1
840 Ga0495619_0573423
841 Ga0500638_000023
842 Ga0501084_0166614
843 Ga0501084_0277034
844 Ga0590075_006472
845 Ga0501082_0037376
846 Ga0501082_0043505
847 Ga0501082_0084363
848 Ga0501082_0191727
849 Ga0530510_0021904
850 Ga0530510_0035378
851 Ga0530510_0054538
852 2511178844
853 2512640380
854 2745165828
855 2817618865
856 2857469762
857 2857591901
858 2915601242
859 2915607526
860 2929186396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

21

128

0.97

PF01230

HIT

HIT domain

29

127

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.9634 3 108
6ypx-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group 0.9566 1 108
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.9547 19 108
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.953 3 108
5waa-assembly1.cif.gz_B human histidine triad nucleotide binding protein 1 (hhint1) c84r mutant 0.9501 3 108
ID Description Score Start End Superfamily
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9554 3 108 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.954 17 108 3.30.428.10
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9528 1 108 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.951 3 108 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9435 3 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0G1MLS5-F1-model_v4 Histidine triad (HIT) protein 0.9828 3 108 GO:0003824
AF-A0A7W0JED7-F1-model_v4 Histidine triad nucleotide-binding protein 0.9825 3 108 GO:0003824
AF-D6YUY2-F1-model_v4 HIT domain-containing protein 0.9803 1 108 GO:0003824
AF-A0A154TTZ9-F1-model_v4 deleted 0.9789 3 103
AF-A0A0C1GRI2-F1-model_v4 HIT family hydrolase 0.9783 3 104 GO:0016787

Map