F442190

General Info

Members Datasets Scaffolds Average Seq Length
430 234 860 386

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_1078157|Ga0436361_1078157_2554_3876
Length 422
Sequence VPGAIGAAGDMGHNSGDMRLPAARAATAALIALALAGCSLFAKRHAVANERFEVASGEDVVGVVQVVTAGREDTLTDIARRFNVGYEEIMRANPGVDPWLPGEGREIVVPTQFILPDAPRTGVVINIAAMRIFYFPPPAKRGDRQVVITHPIGIGKVGWRTPEGVTKIVRRQRDPTWRVPVSVRKEHHENGEDLDPVIGPGPDNPLGKYAFYLQWPSYLIHGTNKPAGVGLRSSHGCIRLYPEDIAQFFAIVPVGTEVRVVNQPFVFGWHEGQLYLQPYDVLEDDARDWKNAQKKLLTRSLAARLQQQLRAQRLQVDWGRVSGLTAHPRGLPVPITQSEASAETLLADAPRVQNVLPEGSTWDGNSDLPMDEASFRQIMSEIEPPAAGAGAPQAATSAGDDGGTVGAEPRTPPAPPEQRAGT

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
160 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
227 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
228 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 6.28
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 7.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_1078157 3300039447 Bacteria 4106
2 LJNas_1005936 3300000546 Bacteria 1327
3 JGI25406J46586_10008910 3300003203 Bacteria 4514
4 rootL2_10107787 3300003322 Bacteria 8462
5 Ga0065704_10070480 3300005289 Bacteria 23034
6 Ga0065707_10093300 3300005295 Bacteria 3647
7 Ga0070676_10007681 3300005328 Bacteria 5789
8 Ga0070676_10138891 3300005328 Bacteria 1545
9 Ga0070683_100010868 3300005329 Bacteria 7838
10 Ga0070683_100230942 3300005329 Bacteria 1759
11 Ga0070690_100020348 3300005330 Bacteria 4042
12 Ga0070677_10008196 3300005333 Bacteria 3512
13 Ga0070666_10089338 3300005335 Bacteria 2114
14 Ga0070666_10119110 3300005335 Unclassified 1829
15 Ga0070680_100001502 3300005336 Bacteria 16987
16 Ga0070680_100010738 3300005336 Bacteria 7069
17 Ga0070680_100146714 3300005336 Bacteria 1980
18 Ga0070682_100039217 3300005337 Bacteria 2910
19 Ga0068868_100019205 3300005338 Bacteria 5120
20 Ga0070689_100005957 3300005340 Bacteria 8385
21 Ga0070689_100166051 3300005340 Bacteria 1787
22 Ga0070661_100082406 3300005344 Bacteria 2375
23 Ga0070692_10135171 3300005345 Bacteria 1390
24 Ga0070668_100027230 3300005347 Bacteria 4339
25 Ga0070669_100012487 3300005353 Bacteria 6027
26 Ga0070675_100005011 3300005354 Bacteria 10114
27 Ga0070675_100085850 3300005354 Bacteria 2630
28 Ga0070675_100190775 3300005354 Unclassified 1775
29 Ga0070671_100015473 3300005355 Bacteria 6164
30 Ga0070671_100050961 3300005355 Bacteria 3443
31 Ga0070673_100084165 3300005364 Bacteria 2586
32 Ga0070673_100087244 3300005364 Bacteria 2543
33 Ga0070673_100252857 3300005364 Bacteria 1537
34 Ga0070667_100000395 3300005367 Bacteria 47219
35 Ga0070667_100004893 3300005367 Bacteria 11217
36 Ga0070667_100041145 3300005367 Bacteria 3877
37 Ga0070709_10001200 3300005434 Bacteria 14228
38 Ga0070709_10107512 3300005434 Bacteria 1870
39 Ga0070714_100075233 3300005435 Bacteria 2930
40 Ga0070714_100322964 3300005435 Bacteria 1444
41 Ga0070713_100004834 3300005436 Bacteria 9127
42 Ga0070713_100031636 3300005436 Bacteria 4217
43 Ga0070710_10041470 3300005437 Bacteria 2542
44 Ga0070701_10007388 3300005438 Bacteria 4691
45 Ga0070711_100008832 3300005439 Bacteria 6184
46 Ga0070711_100175693 3300005439 Bacteria 1636
47 Ga0070711_100225066 3300005439 Bacteria 1460
48 Ga0070705_100035224 3300005440 Bacteria 2804
49 Ga0070700_100180489 3300005441 Bacteria 1469
50 Ga0070694_100121328 3300005444 Unclassified 1876
51 Ga0070663_100010875 3300005455 Bacteria 5685
52 Ga0070662_100004973 3300005457 Bacteria 8445
53 Ga0070662_100045064 3300005457 Bacteria 3163
54 Ga0070681_10001579 3300005458 Bacteria 20232
55 Ga0070681_10003751 3300005458 Bacteria 14263
56 Ga0070681_10003874 3300005458 Bacteria 14079
57 Ga0070681_10015412 3300005458 Bacteria 7608
58 Ga0070681_10015764 3300005458 Bacteria 7532
59 Ga0068867_100010932 3300005459 Bacteria 6400
60 Ga0068867_100046442 3300005459 Bacteria 3190
61 Ga0070685_10019479 3300005466 Bacteria 3662
62 Ga0070698_100171010 3300005471 Unclassified 2114
63 Ga0070679_100002348 3300005530 Bacteria 17133
64 Ga0070679_100090713 3300005530 Unclassified 3044
65 Ga0070684_100044651 3300005535 Unclassified 3834
66 Ga0070672_100011626 3300005543 Bacteria 6143
67 Ga0070672_100034406 3300005543 Bacteria 3845
68 Ga0070672_100096757 3300005543 Bacteria 2389
69 Ga0070672_100109160 3300005543 Unclassified 2253
70 Ga0070695_100002823 3300005545 Bacteria 10091
71 Ga0070695_100179056 3300005545 Unclassified 1501
72 Ga0070693_100065741 3300005547 Bacteria 2120
73 Ga0070665_100000853 3300005548 Bacteria 39671
74 Ga0070665_100005165 3300005548 Bacteria 13510
75 Ga0070665_100017227 3300005548 Bacteria 7250
76 Ga0070665_100029291 3300005548 Bacteria 5541
77 Ga0070665_100031740 3300005548 Bacteria 5316
78 Ga0070665_100037039 3300005548 Bacteria 4906
79 Ga0070665_100053930 3300005548 Bacteria 4032
80 Ga0068855_100005222 3300005563 Bacteria 15842
81 Ga0068855_100013154 3300005563 Bacteria 9981
82 Ga0068855_100060188 3300005563 Bacteria 4442
83 Ga0068856_100001707 3300005614 Bacteria 22944
84 Ga0068856_100057886 3300005614 Bacteria 3827
85 Ga0068856_100063929 3300005614 Bacteria 3636
86 Ga0068859_100001110 3300005617 Bacteria 27468
87 Ga0068859_100024652 3300005617 Bacteria 6037
88 Ga0068859_100282014 3300005617 Bacteria 1754
89 Ga0068864_100030866 3300005618 Bacteria 4544
90 Ga0068866_10011180 3300005718 Bacteria 3875
91 Ga0068861_100000765 3300005719 Bacteria 19275
92 Ga0068861_100006836 3300005719 Bacteria 7787
93 Ga0068861_100066266 3300005719 Bacteria 2784
94 Ga0068861_100133874 3300005719 Bacteria 2015
95 Ga0068870_10058264 3300005840 Unclassified 2068
96 Ga0068870_10063505 3300005840 Bacteria 1992
97 Ga0068863_100006639 3300005841 Bacteria 11355
98 Ga0068863_100010225 3300005841 Bacteria 9120
99 Ga0068863_100033801 3300005841 Bacteria 4872
100 Ga0068863_100067836 3300005841 Bacteria 3374
101 Ga0068863_100197961 3300005841 Bacteria 1932
102 Ga0068858_100000426 3300005842 Bacteria 43886
103 Ga0068858_100004895 3300005842 Bacteria 13135
104 Ga0068858_100019823 3300005842 Bacteria 6287
105 Ga0068860_100000293 3300005843 Bacteria 70629
106 Ga0068860_100016475 3300005843 Bacteria 7207
107 Ga0068860_100042357 3300005843 Bacteria 4349
108 Ga0068860_100157502 3300005843 Bacteria 2189
109 Ga0068862_100009461 3300005844 Bacteria 8063
110 Ga0081455_10000098 3300005937 Bacteria 95177
111 Ga0081455_10002212 3300005937 Bacteria 23167
112 Ga0081539_10000006 3300005985 Bacteria 534555
113 Ga0070717_10004026 3300006028 Bacteria 10584
114 Ga0070715_10000187 3300006163 Bacteria 14503
115 Ga0070716_100001983 3300006173 Bacteria 9322
116 Ga0070716_100003777 3300006173 Bacteria 7178
117 Ga0070712_100004056 3300006175 Bacteria 8988
118 Ga0070712_100281950 3300006175 Bacteria 1339
119 Ga0097621_100017640 3300006237 Bacteria 5427
120 Ga0097621_100057277 3300006237 Bacteria 3186
121 Ga0068871_100039217 3300006358 Bacteria 3789
122 Ga0068871_100058385 3300006358 Bacteria 3141
123 Ga0075428_100019329 3300006844 Bacteria 7539
124 Ga0075431_100103987 3300006847 Bacteria 2931
125 Ga0068865_100005022 3300006881 Bacteria 8004
126 Ga0068865_100023278 3300006881 Unclassified 4054
127 Ga0068865_100128183 3300006881 Bacteria 1897
128 Ga0097620_100001110 3300006931 Bacteria 27468
129 Ga0097620_100024652 3300006931 Bacteria 6037
130 Ga0097620_100282011 3300006931 Bacteria 1754
131 Ga0099795_10006843 3300007788 Bacteria 3137
132 Ga0105240_10002949 3300009093 Bacteria 26832
133 Ga0105240_10004207 3300009093 Bacteria 22002
134 Ga0105240_10011870 3300009093 Bacteria 12089
135 Ga0105240_10015549 3300009093 Bacteria 10342
136 Ga0105240_10166601 3300009093 Bacteria 2613
137 Ga0105240_10323153 3300009093 Bacteria 1758
138 Ga0111539_10005545 3300009094 Bacteria 16321
139 Ga0111539_10083346 3300009094 Bacteria 3760
140 Ga0111539_10169539 3300009094 Bacteria 2551
141 Ga0105245_10011915 3300009098 Bacteria 7561
142 Ga0105247_10000150 3300009101 Bacteria 68542
143 Ga0105247_10007096 3300009101 Bacteria 6882
144 Ga0105247_10008267 3300009101 Bacteria 6351
145 Ga0105247_10014159 3300009101 Bacteria 4784
146 Ga0105241_10008673 3300009174 Bacteria 7473
147 Ga0105242_10000384 3300009176 Bacteria 35144
148 Ga0105248_10016638 3300009177 Bacteria 8095
149 Ga0105248_10027084 3300009177 Bacteria 6377
150 Ga0105248_10222713 3300009177 Bacteria 2124
151 Ga0105237_10010822 3300009545 Bacteria 9681
152 Ga0105237_10012126 3300009545 Bacteria 9095
153 Ga0105238_10005901 3300009551 Bacteria 12129
154 Ga0105238_10050093 3300009551 Bacteria 4205
155 Ga0105238_10076538 3300009551 Bacteria 3337
156 Ga0105238_10213149 3300009551 Bacteria 1908
157 Ga0105249_10056766 3300009553 Bacteria 3585
158 Ga0105249_10056860 3300009553 Bacteria 3582
159 Ga0099796_10002347 3300010159 Bacteria 4136
160 Ga0105239_10054256 3300010375 Bacteria 4396
161 Ga0105239_10098278 3300010375 Bacteria 3236
162 Ga0157370_10016848 3300013104 Bacteria 7386
163 Ga0157369_10124993 3300013105 Bacteria 2728
164 Ga0157374_10020634 3300013296 Bacteria 5851
165 Ga0157374_10107876 3300013296 Unclassified 2676
166 Ga0157374_10165139 3300013296 Bacteria 2157
167 Ga0157378_10126566 3300013297 Bacteria 2360
168 Ga0157372_10356362 3300013307 Unclassified 1704
169 Ga0157375_10014664 3300013308 Bacteria 7001
170 Ga0157375_10030254 3300013308 Bacteria 5103
171 Ga0163163_10079127 3300014325 Bacteria 3285
172 Ga0163163_10133707 3300014325 Bacteria 2521
173 Ga0163163_10168357 3300014325 Unclassified 2237
174 Ga0163163_10269097 3300014325 Bacteria 1755
175 Ga0163163_10362985 3300014325 Bacteria 1505
176 Ga0157380_10002321 3300014326 Bacteria 12783
177 Ga0157380_10022020 3300014326 Bacteria 4789
178 Ga0157380_10058405 3300014326 Bacteria 3075
179 Ga0157379_10004437 3300014968 Bacteria 12032
180 Ga0157379_10009306 3300014968 Bacteria 8557
181 Ga0157379_10057772 3300014968 Bacteria 3467
182 Ga0157379_10175979 3300014968 Bacteria 1932
183 Ga0157379_10188131 3300014968 Bacteria 1866
184 Ga0228598_1007621 3300024227 Bacteria 2199
185 Ga0207682_10000689 3300025893 Bacteria 15698
186 Ga0207682_10002094 3300025893 Bacteria 9037
187 Ga0207682_10003090 3300025893 Bacteria 7296
188 Ga0207692_10037699 3300025898 Bacteria 2366
189 Ga0207710_10000181 3300025900 Bacteria 63816
190 Ga0207710_10056792 3300025900 Bacteria 1767
191 Ga0207699_10001786 3300025906 Bacteria 10119
192 Ga0207645_10000365 3300025907 Bacteria 37527
193 Ga0207645_10183395 3300025907 Bacteria 1373
194 Ga0207643_10004704 3300025908 Bacteria 7324
195 Ga0207643_10023843 3300025908 Bacteria 3376
196 Ga0207707_10004544 3300025912 Bacteria 12201
197 Ga0207707_10006158 3300025912 Bacteria 10483
198 Ga0207707_10027902 3300025912 Unclassified 4936
199 Ga0207707_10050293 3300025912 Bacteria 3631
200 Ga0207695_10008201 3300025913 Bacteria 13121
201 Ga0207695_10009686 3300025913 Bacteria 11861
202 Ga0207695_10029074 3300025913 Bacteria 6116
203 Ga0207695_10044659 3300025913 Bacteria 4710
204 Ga0207693_10000211 3300025915 Bacteria 53479
205 Ga0207693_10028491 3300025915 Bacteria 4412
206 Ga0207660_10001402 3300025917 Bacteria 16193
207 Ga0207660_10028054 3300025917 Bacteria 3848
208 Ga0207649_10042868 3300025920 Bacteria 2763
209 Ga0207652_10004040 3300025921 Bacteria 11980
210 Ga0207652_10122436 3300025921 Bacteria 2315
211 Ga0207694_10004435 3300025924 Bacteria 10972
212 Ga0207659_10047962 3300025926 Bacteria 3024
213 Ga0207700_10004471 3300025928 Bacteria 8249
214 Ga0207664_10030151 3300025929 Unclassified 4140
215 Ga0207664_10195103 3300025929 Bacteria 1745
216 Ga0207644_10003164 3300025931 Bacteria 10588
217 Ga0207644_10114701 3300025931 Bacteria 2042
218 Ga0207706_10005238 3300025933 Bacteria 12096
219 Ga0207706_10135399 3300025933 Bacteria 2167
220 Ga0207670_10064219 3300025936 Bacteria 2515
221 Ga0207704_10040336 3300025938 Bacteria 2727
222 Ga0207704_10066500 3300025938 Bacteria 2263
223 Ga0207704_10140189 3300025938 Bacteria 1690
224 Ga0207665_10001663 3300025939 Bacteria 14966
225 Ga0207665_10018029 3300025939 Bacteria 4638
226 Ga0207691_10000161 3300025940 Bacteria 62768
227 Ga0207691_10007501 3300025940 Bacteria 10497
228 Ga0207691_10011179 3300025940 Bacteria 8616
229 Ga0207691_10096927 3300025940 Bacteria 2636
230 Ga0207689_10045283 3300025942 Bacteria 3639
231 Ga0207689_10063840 3300025942 Bacteria 3030
232 Ga0207689_10146707 3300025942 Bacteria 1944
233 Ga0207689_10191920 3300025942 Unclassified 1685
234 Ga0207667_10001029 3300025949 Bacteria 35522
235 Ga0207667_10012579 3300025949 Bacteria 9735
236 Ga0207667_10099516 3300025949 Bacteria 3000
237 Ga0207667_10108701 3300025949 Bacteria 2860
238 Ga0207651_10032489 3300025960 Bacteria 3353
239 Ga0207640_10072936 3300025981 Bacteria 2318
240 Ga0207658_10000097 3300025986 Bacteria 97223
241 Ga0207658_10013040 3300025986 Bacteria 5675
242 Ga0207658_10170716 3300025986 Unclassified 1791
243 Ga0207677_10009546 3300026023 Bacteria 5462
244 Ga0207703_10000627 3300026035 Bacteria 35546
245 Ga0207703_10002460 3300026035 Bacteria 16062
246 Ga0207703_10018178 3300026035 Bacteria 5490
247 Ga0207703_10041957 3300026035 Bacteria 3668
248 Ga0207703_10151066 3300026035 Bacteria 2025
249 Ga0207678_10037477 3300026067 Bacteria 4217
250 Ga0207678_10081635 3300026067 Bacteria 2767
251 Ga0207708_10007387 3300026075 Bacteria 8122
252 Ga0207708_10062802 3300026075 Bacteria 2837
253 Ga0207708_10085152 3300026075 Bacteria 2431
254 Ga0207702_10081469 3300026078 Unclassified 2811
255 Ga0207702_10103842 3300026078 Bacteria 2514
256 Ga0207641_10000350 3300026088 Bacteria 55088
257 Ga0207641_10024367 3300026088 Bacteria 4988
258 Ga0207641_10032977 3300026088 Bacteria 4302
259 Ga0207641_10069261 3300026088 Bacteria 3028
260 Ga0207648_10034710 3300026089 Bacteria 4445
261 Ga0207648_10037126 3300026089 Bacteria 4291
262 Ga0207676_10026563 3300026095 Bacteria 4307
263 Ga0207675_100005020 3300026118 Bacteria 12749
264 Ga0207675_100010163 3300026118 Bacteria 8821
265 Ga0207683_10009331 3300026121 Bacteria 8359
266 Ga0207683_10109046 3300026121 Bacteria 2478
267 Ga0209983_1005883 3300027665 Unclassified 2532
268 Ga0209971_1000839 3300027682 Bacteria 7930
269 Ga0209998_10003196 3300027717 Bacteria 3618
270 Ga0209974_10000315 3300027876 Bacteria 15777
271 Ga0268266_10000228 3300028379 Bacteria 97214
272 Ga0268266_10010004 3300028379 Bacteria 8324
273 Ga0268266_10011425 3300028379 Bacteria 7723
274 Ga0268266_10012333 3300028379 Bacteria 7392
275 Ga0268266_10100581 3300028379 Bacteria 2547
276 Ga0268265_10039544 3300028380 Bacteria 3477
277 Ga0268264_10000824 3300028381 Bacteria 33279
278 Ga0268264_10126148 3300028381 Bacteria 2262
279 Ga0268264_10126880 3300028381 Bacteria 2256
280 Ga0265338_10067186 3300028800 Bacteria 3098
281 Ga0307511_10000310 3300030521 Bacteria 51837
282 Ga0307511_10036390 3300030521 Bacteria 4276
283 Ga0265770_1000676 3300030878 Bacteria 4756
284 Ga0265760_10000514 3300031090 Bacteria 10818
285 Ga0265331_10011272 3300031250 Bacteria 4901
286 Ga0307513_10008951 3300031456 Bacteria 12713
287 Ga0307513_10036718 3300031456 Bacteria 5461
288 Ga0307513_10037134 3300031456 Bacteria 5424
289 Ga0307513_10050758 3300031456 Bacteria 4481
290 Ga0307509_10000017 3300031507 Bacteria 265012
291 Ga0307509_10027416 3300031507 Bacteria 6339
292 Ga0307516_10001814 3300031730 Bacteria 29363
293 Ga0307413_10013694 3300031824 Bacteria 4089
294 Ga0307413_10028019 3300031824 Bacteria 3130
295 Ga0307410_10022753 3300031852 Bacteria 3881
296 Ga0307406_10004823 3300031901 Bacteria 7348
297 Ga0307407_10029412 3300031903 Bacteria 2950
298 Ga0307407_10041003 3300031903 Bacteria 2586
299 Ga0307409_100028143 3300031995 Bacteria 3998
300 Ga0307409_100028668 3300031995 Unclassified 3971
301 Ga0307409_100031946 3300031995 Bacteria 3808
302 Ga0307409_100047951 3300031995 Bacteria 3247
303 Ga0307416_100088186 3300032002 Bacteria 2652
304 Ga0307416_100148535 3300032002 Bacteria 2145
305 Ga0307411_10162135 3300032005 Bacteria 1676
306 Ga0307510_10000002 3300033180 Bacteria 801565
307 Ga0307510_10068539 3300033180 Unclassified 3559
308 Ga0307510_10080015 3300033180 Bacteria 3181
309 Ga0373936_0004591 3300035113 Bacteria 5224
310 Ga0373937_0009810 3300036401 Bacteria 8349
311 Ga0373925_0164359 3300037068 Bacteria 1750
312 Ga0436365_1358774 3300039437 Bacteria 21458
313 Ga0436360_0493328 3300039438 Bacteria 2465
314 Ga0436360_0913673 3300039438 Bacteria 9887
315 Ga0436360_1074582 3300039438 Bacteria 3489
316 Ga0436361_0678604 3300039447 Bacteria 5735
317 Ga0436363_0494041 3300039450 Bacteria 6258
318 Ga0436363_0906556 3300039450 Bacteria 6266
319 Ga0436363_0990455 3300039450 Bacteria 2130
320 Ga0436362_0719043 3300039453 Bacteria 3245
321 Ga0451807_1706060 3300041486 Bacteria 4282
322 Ga0451845_0216517 3300041501 Bacteria 1299
323 Ga0450923_024590 3300042125 Bacteria 1195
324 Ga0439460_0016146 3300042461 Bacteria 1986
325 Ga0451577_0011203 3300042876 Bacteria 8503
326 Ga0451577_0014546 3300042876 Bacteria 7333
327 Ga0451577_0069413 3300042876 Bacteria 3142
328 Ga0451577_0106151 3300042876 Bacteria 2510
329 Ga0451577_0165258 3300042876 Bacteria 1993
330 Ga0466969_0000900 3300044656 Bacteria 16060
331 Ga0466969_0007322 3300044656 Bacteria 5868
332 Ga0466966_0005595 3300044684 Bacteria 8261
333 Ga0466961_0001019 3300044693 Bacteria 17316
334 Ga0466964_0000751 3300044706 Bacteria 10538
335 Ga0453684_0008881 3300044712 Bacteria 17806
336 Ga0453684_0016129 3300044712 Bacteria 11720
337 Ga0453684_0356282 3300044712 Bacteria 1648
338 Ga0466971_0000561 3300044719 Bacteria 14694
339 Ga0466968_0018421 3300044735 Unclassified 2800
340 Ga0466970_0000209 3300044765 Bacteria 28546
341 Ga0466959_0000949 3300045049 Bacteria 17225
342 Ga0466959_0011030 3300045049 Bacteria 6486
343 Ga0466959_0039185 3300045049 Bacteria 3502
344 Ga0451576_0008029 3300045051 Bacteria 12460
345 Ga0451576_0100904 3300045051 Bacteria 3001
346 Ga0466958_0060818 3300045836 Unclassified 2300
347 Ga0495590_0021604 3300046457 Bacteria 2280
348 Ga0495638_0006788 3300046460 Bacteria 8274
349 Ga0495580_0002559 3300046472 Bacteria 15856
350 Ga0495580_0195213 3300046472 Unclassified 1396
351 Ga0495583_0014268 3300046506 Unclassified 4392
352 Ga0495616_0001081 3300046513 Bacteria 19363
353 Ga0495618_0121089 3300046514 Bacteria 1676
354 Ga0495632_0044790 3300046519 Bacteria 2207
355 Ga0495632_0071040 3300046519 Bacteria 1673
356 Ga0495587_0089812 3300046536 Bacteria 1775
357 Ga0495625_0042155 3300046660 Bacteria 3319
358 Ga0495625_0117473 3300046660 Unclassified 1813
359 Ga0495671_0006931 3300046692 Bacteria 6501
360 Ga0495649_0026274 3300046694 Bacteria 3240
361 Ga0495686_0067543 3300047472 Bacteria 2207
362 Ga0496100_0005114 3300048903 Bacteria 7030
363 Ga0496101_0012107 3300048904 Bacteria 5749
364 Ga0496102_0003969 3300048905 Bacteria 12540
365 Ga0496102_0009726 3300048905 Bacteria 8269
366 Ga0496102_0068964 3300048905 Unclassified 3246
367 Ga0496103_0018576 3300048906 Bacteria 4171
368 Ga0496104_0005406 3300048907 Bacteria 11177
369 Ga0496104_0079430 3300048907 Bacteria 3127
370 Ga0496104_0190957 3300048907 Bacteria 1959
371 Ga0496105_0069011 3300048908 Bacteria 2920
372 Ga0496106_0003391 3300048909 Bacteria 11871
373 Ga0496106_0096950 3300048909 Bacteria 2283
374 Ga0496107_0014426 3300048910 Bacteria 5533
375 Ga0496107_0109158 3300048910 Bacteria 2032
376 Ga0496108_0017291 3300048911 Bacteria 5898
377 Ga0496108_0045759 3300048911 Bacteria 3655
378 Ga0496109_0045932 3300048912 Bacteria 3965
379 Ga0496110_0098807 3300048913 Bacteria 2616
380 Ga0496111_0070444 3300048914 Bacteria 2543
381 Ga0496112_0048361 3300048915 Bacteria 4170
382 Ga0496113_0012647 3300048916 Bacteria 5680
383 Ga0496114_0000938 3300048917 Bacteria 21805
384 Ga0496114_0009835 3300048917 Bacteria 7600
385 Ga0496114_0036194 3300048917 Bacteria 4080
386 Ga0496115_0005113 3300048918 Bacteria 9540
387 Ga0496115_0015003 3300048918 Bacteria 5872
388 Ga0496116_0003370 3300048919 Bacteria 15858
389 Ga0496117_0000140 3300048920 Bacteria 158390
390 Ga0496117_0104977 3300048920 Bacteria 1777
391 Ga0496118_0000102 3300048921 Bacteria 158228
392 Ga0496118_0107003 3300048921 Unclassified 1869
393 Ga0496120_0003518 3300048923 Bacteria 14185
394 Ga0496120_0035898 3300048923 Bacteria 2956
395 Ga0496121_0009363 3300048924 Bacteria 11282
396 Ga0496124_0019955 3300048927 Bacteria 6215
397 Ga0496125_0000690 3300048928 Bacteria 55954
398 Ga0496125_0031235 3300048928 Bacteria 4750
399 Ga0496125_0074348 3300048928 Bacteria 2635
400 Ga0496126_0002522 3300048929 Bacteria 24512
401 Ga0496126_0006771 3300048929 Bacteria 12713
402 Ga0501039_0240228 3300049575 Bacteria 1424
403 Ga0501040_0024919 3300049576 Bacteria 4020
404 Ga0501067_0021602 3300049583 Bacteria 3562
405 Ga0501068_0000289 3300049584 Bacteria 25017
406 Ga0501070_0003759 3300049586 Bacteria 13106
407 Ga0501073_0000841 3300049589 Bacteria 21854
408 Ga0501074_0001016 3300049590 Bacteria 18256
409 Ga0501077_0000942 3300049593 Bacteria 17539
410 Ga0501079_0001317 3300049741 Bacteria 17449
411 Ga0501080_0000468 3300049742 Bacteria 31379
412 Ga0501045_0091542 3300049824 Bacteria 2248
413 nmdc:mga06r32_109735_c1 3300050510 Unclassified 2714
414 nmdc:mga06r32_38253_c1 3300050510 Bacteria 4543
415 nmdc:mga08y16_151706_c1 3300050511 Bacteria 2408
416 nmdc:mga08y16_290044_c1 3300050511 Bacteria 1687
417 nmdc:mga08y16_35499_c1 3300050511 Bacteria 5236
418 nmdc:mga08y16_54445_c1 3300050511 Bacteria 4180
419 nmdc:mga0n895_231813_c1 3300050512 Unclassified 1874
420 nmdc:mga0rr50_250181_c1 3300050513 Unclassified 1472
421 Ga0500644_0012275 3300053088 Bacteria 2364
422 Ga0500641_0005233 3300053096 Bacteria 4598
423 Ga0500556_0000291 3300053104 Bacteria 39063
424 Ga0500617_026713 3300053124 Bacteria 2567
425 Ga0500588_0004156 3300053146 Bacteria 3116
426 Ga0500616_0000064 3300053153 Bacteria 243072
427 Ga0500622_0006987 3300053156 Bacteria 6462
428 Ga0501084_0010051 3300054114 Bacteria 7821
429 Ga0466962_0000184 3300061719 Bacteria 25901
430 Ga0530510_0312063 3300061734 Bacteria 1178
431 Ga0436361_1078157
432 LJNas_1005936
433 JGI25406J46586_10008910
434 rootL2_10107787
435 Ga0065704_10070480
436 Ga0065707_10093300
437 Ga0070676_10007681
438 Ga0070676_10138891
439 Ga0070683_100010868
440 Ga0070683_100230942
441 Ga0070690_100020348
442 Ga0070677_10008196
443 Ga0070666_10089338
444 Ga0070666_10119110
445 Ga0070680_100001502
446 Ga0070680_100010738
447 Ga0070680_100146714
448 Ga0070682_100039217
449 Ga0068868_100019205
450 Ga0070689_100005957
451 Ga0070689_100166051
452 Ga0070661_100082406
453 Ga0070692_10135171
454 Ga0070668_100027230
455 Ga0070669_100012487
456 Ga0070675_100005011
457 Ga0070675_100085850
458 Ga0070675_100190775
459 Ga0070671_100015473
460 Ga0070671_100050961
461 Ga0070673_100084165
462 Ga0070673_100087244
463 Ga0070673_100252857
464 Ga0070667_100000395
465 Ga0070667_100004893
466 Ga0070667_100041145
467 Ga0070709_10001200
468 Ga0070709_10107512
469 Ga0070714_100075233
470 Ga0070714_100322964
471 Ga0070713_100004834
472 Ga0070713_100031636
473 Ga0070710_10041470
474 Ga0070701_10007388
475 Ga0070711_100008832
476 Ga0070711_100175693
477 Ga0070711_100225066
478 Ga0070705_100035224
479 Ga0070700_100180489
480 Ga0070694_100121328
481 Ga0070663_100010875
482 Ga0070662_100004973
483 Ga0070662_100045064
484 Ga0070681_10001579
485 Ga0070681_10003751
486 Ga0070681_10003874
487 Ga0070681_10015412
488 Ga0070681_10015764
489 Ga0068867_100010932
490 Ga0068867_100046442
491 Ga0070685_10019479
492 Ga0070698_100171010
493 Ga0070679_100002348
494 Ga0070679_100090713
495 Ga0070684_100044651
496 Ga0070672_100011626
497 Ga0070672_100034406
498 Ga0070672_100096757
499 Ga0070672_100109160
500 Ga0070695_100002823
501 Ga0070695_100179056
502 Ga0070693_100065741
503 Ga0070665_100000853
504 Ga0070665_100005165
505 Ga0070665_100017227
506 Ga0070665_100029291
507 Ga0070665_100031740
508 Ga0070665_100037039
509 Ga0070665_100053930
510 Ga0068855_100005222
511 Ga0068855_100013154
512 Ga0068855_100060188
513 Ga0068856_100001707
514 Ga0068856_100057886
515 Ga0068856_100063929
516 Ga0068859_100001110
517 Ga0068859_100024652
518 Ga0068859_100282014
519 Ga0068864_100030866
520 Ga0068866_10011180
521 Ga0068861_100000765
522 Ga0068861_100006836
523 Ga0068861_100066266
524 Ga0068861_100133874
525 Ga0068870_10058264
526 Ga0068870_10063505
527 Ga0068863_100006639
528 Ga0068863_100010225
529 Ga0068863_100033801
530 Ga0068863_100067836
531 Ga0068863_100197961
532 Ga0068858_100000426
533 Ga0068858_100004895
534 Ga0068858_100019823
535 Ga0068860_100000293
536 Ga0068860_100016475
537 Ga0068860_100042357
538 Ga0068860_100157502
539 Ga0068862_100009461
540 Ga0081455_10000098
541 Ga0081455_10002212
542 Ga0081539_10000006
543 Ga0070717_10004026
544 Ga0070715_10000187
545 Ga0070716_100001983
546 Ga0070716_100003777
547 Ga0070712_100004056
548 Ga0070712_100281950
549 Ga0097621_100017640
550 Ga0097621_100057277
551 Ga0068871_100039217
552 Ga0068871_100058385
553 Ga0075428_100019329
554 Ga0075431_100103987
555 Ga0068865_100005022
556 Ga0068865_100023278
557 Ga0068865_100128183
558 Ga0097620_100001110
559 Ga0097620_100024652
560 Ga0097620_100282011
561 Ga0099795_10006843
562 Ga0105240_10002949
563 Ga0105240_10004207
564 Ga0105240_10011870
565 Ga0105240_10015549
566 Ga0105240_10166601
567 Ga0105240_10323153
568 Ga0111539_10005545
569 Ga0111539_10083346
570 Ga0111539_10169539
571 Ga0105245_10011915
572 Ga0105247_10000150
573 Ga0105247_10007096
574 Ga0105247_10008267
575 Ga0105247_10014159
576 Ga0105241_10008673
577 Ga0105242_10000384
578 Ga0105248_10016638
579 Ga0105248_10027084
580 Ga0105248_10222713
581 Ga0105237_10010822
582 Ga0105237_10012126
583 Ga0105238_10005901
584 Ga0105238_10050093
585 Ga0105238_10076538
586 Ga0105238_10213149
587 Ga0105249_10056766
588 Ga0105249_10056860
589 Ga0099796_10002347
590 Ga0105239_10054256
591 Ga0105239_10098278
592 Ga0157370_10016848
593 Ga0157369_10124993
594 Ga0157374_10020634
595 Ga0157374_10107876
596 Ga0157374_10165139
597 Ga0157378_10126566
598 Ga0157372_10356362
599 Ga0157375_10014664
600 Ga0157375_10030254
601 Ga0163163_10079127
602 Ga0163163_10133707
603 Ga0163163_10168357
604 Ga0163163_10269097
605 Ga0163163_10362985
606 Ga0157380_10002321
607 Ga0157380_10022020
608 Ga0157380_10058405
609 Ga0157379_10004437
610 Ga0157379_10009306
611 Ga0157379_10057772
612 Ga0157379_10175979
613 Ga0157379_10188131
614 Ga0228598_1007621
615 Ga0207682_10000689
616 Ga0207682_10002094
617 Ga0207682_10003090
618 Ga0207692_10037699
619 Ga0207710_10000181
620 Ga0207710_10056792
621 Ga0207699_10001786
622 Ga0207645_10000365
623 Ga0207645_10183395
624 Ga0207643_10004704
625 Ga0207643_10023843
626 Ga0207707_10004544
627 Ga0207707_10006158
628 Ga0207707_10027902
629 Ga0207707_10050293
630 Ga0207695_10008201
631 Ga0207695_10009686
632 Ga0207695_10029074
633 Ga0207695_10044659
634 Ga0207693_10000211
635 Ga0207693_10028491
636 Ga0207660_10001402
637 Ga0207660_10028054
638 Ga0207649_10042868
639 Ga0207652_10004040
640 Ga0207652_10122436
641 Ga0207694_10004435
642 Ga0207659_10047962
643 Ga0207700_10004471
644 Ga0207664_10030151
645 Ga0207664_10195103
646 Ga0207644_10003164
647 Ga0207644_10114701
648 Ga0207706_10005238
649 Ga0207706_10135399
650 Ga0207670_10064219
651 Ga0207704_10040336
652 Ga0207704_10066500
653 Ga0207704_10140189
654 Ga0207665_10001663
655 Ga0207665_10018029
656 Ga0207691_10000161
657 Ga0207691_10007501
658 Ga0207691_10011179
659 Ga0207691_10096927
660 Ga0207689_10045283
661 Ga0207689_10063840
662 Ga0207689_10146707
663 Ga0207689_10191920
664 Ga0207667_10001029
665 Ga0207667_10012579
666 Ga0207667_10099516
667 Ga0207667_10108701
668 Ga0207651_10032489
669 Ga0207640_10072936
670 Ga0207658_10000097
671 Ga0207658_10013040
672 Ga0207658_10170716
673 Ga0207677_10009546
674 Ga0207703_10000627
675 Ga0207703_10002460
676 Ga0207703_10018178
677 Ga0207703_10041957
678 Ga0207703_10151066
679 Ga0207678_10037477
680 Ga0207678_10081635
681 Ga0207708_10007387
682 Ga0207708_10062802
683 Ga0207708_10085152
684 Ga0207702_10081469
685 Ga0207702_10103842
686 Ga0207641_10000350
687 Ga0207641_10024367
688 Ga0207641_10032977
689 Ga0207641_10069261
690 Ga0207648_10034710
691 Ga0207648_10037126
692 Ga0207676_10026563
693 Ga0207675_100005020
694 Ga0207675_100010163
695 Ga0207683_10009331
696 Ga0207683_10109046
697 Ga0209983_1005883
698 Ga0209971_1000839
699 Ga0209998_10003196
700 Ga0209974_10000315
701 Ga0268266_10000228
702 Ga0268266_10010004
703 Ga0268266_10011425
704 Ga0268266_10012333
705 Ga0268266_10100581
706 Ga0268265_10039544
707 Ga0268264_10000824
708 Ga0268264_10126148
709 Ga0268264_10126880
710 Ga0265338_10067186
711 Ga0307511_10000310
712 Ga0307511_10036390
713 Ga0265770_1000676
714 Ga0265760_10000514
715 Ga0265331_10011272
716 Ga0307513_10008951
717 Ga0307513_10036718
718 Ga0307513_10037134
719 Ga0307513_10050758
720 Ga0307509_10000017
721 Ga0307509_10027416
722 Ga0307516_10001814
723 Ga0307413_10013694
724 Ga0307413_10028019
725 Ga0307410_10022753
726 Ga0307406_10004823
727 Ga0307407_10029412
728 Ga0307407_10041003
729 Ga0307409_100028143
730 Ga0307409_100028668
731 Ga0307409_100031946
732 Ga0307409_100047951
733 Ga0307416_100088186
734 Ga0307416_100148535
735 Ga0307411_10162135
736 Ga0307510_10000002
737 Ga0307510_10068539
738 Ga0307510_10080015
739 Ga0373936_0004591
740 Ga0373937_0009810
741 Ga0373925_0164359
742 Ga0436365_1358774
743 Ga0436360_0493328
744 Ga0436360_0913673
745 Ga0436360_1074582
746 Ga0436361_0678604
747 Ga0436363_0494041
748 Ga0436363_0906556
749 Ga0436363_0990455
750 Ga0436362_0719043
751 Ga0451807_1706060
752 Ga0451845_0216517
753 Ga0450923_024590
754 Ga0439460_0016146
755 Ga0451577_0011203
756 Ga0451577_0014546
757 Ga0451577_0069413
758 Ga0451577_0106151
759 Ga0451577_0165258
760 Ga0466969_0000900
761 Ga0466969_0007322
762 Ga0466966_0005595
763 Ga0466961_0001019
764 Ga0466964_0000751
765 Ga0453684_0008881
766 Ga0453684_0016129
767 Ga0453684_0356282
768 Ga0466971_0000561
769 Ga0466968_0018421
770 Ga0466970_0000209
771 Ga0466959_0000949
772 Ga0466959_0011030
773 Ga0466959_0039185
774 Ga0451576_0008029
775 Ga0451576_0100904
776 Ga0466958_0060818
777 Ga0495590_0021604
778 Ga0495638_0006788
779 Ga0495580_0002559
780 Ga0495580_0195213
781 Ga0495583_0014268
782 Ga0495616_0001081
783 Ga0495618_0121089
784 Ga0495632_0044790
785 Ga0495632_0071040
786 Ga0495587_0089812
787 Ga0495625_0042155
788 Ga0495625_0117473
789 Ga0495671_0006931
790 Ga0495649_0026274
791 Ga0495686_0067543
792 Ga0496100_0005114
793 Ga0496101_0012107
794 Ga0496102_0003969
795 Ga0496102_0009726
796 Ga0496102_0068964
797 Ga0496103_0018576
798 Ga0496104_0005406
799 Ga0496104_0079430
800 Ga0496104_0190957
801 Ga0496105_0069011
802 Ga0496106_0003391
803 Ga0496106_0096950
804 Ga0496107_0014426
805 Ga0496107_0109158
806 Ga0496108_0017291
807 Ga0496108_0045759
808 Ga0496109_0045932
809 Ga0496110_0098807
810 Ga0496111_0070444
811 Ga0496112_0048361
812 Ga0496113_0012647
813 Ga0496114_0000938
814 Ga0496114_0009835
815 Ga0496114_0036194
816 Ga0496115_0005113
817 Ga0496115_0015003
818 Ga0496116_0003370
819 Ga0496117_0000140
820 Ga0496117_0104977
821 Ga0496118_0000102
822 Ga0496118_0107003
823 Ga0496120_0003518
824 Ga0496120_0035898
825 Ga0496121_0009363
826 Ga0496124_0019955
827 Ga0496125_0000690
828 Ga0496125_0031235
829 Ga0496125_0074348
830 Ga0496126_0002522
831 Ga0496126_0006771
832 Ga0501039_0240228
833 Ga0501040_0024919
834 Ga0501067_0021602
835 Ga0501068_0000289
836 Ga0501070_0003759
837 Ga0501073_0000841
838 Ga0501074_0001016
839 Ga0501077_0000942
840 Ga0501079_0001317
841 Ga0501080_0000468
842 Ga0501045_0091542
843 nmdc:mga06r32_109735_c1
844 nmdc:mga06r32_38253_c1
845 nmdc:mga08y16_151706_c1
846 nmdc:mga08y16_290044_c1
847 nmdc:mga08y16_35499_c1
848 nmdc:mga08y16_54445_c1
849 nmdc:mga0n895_231813_c1
850 nmdc:mga0rr50_250181_c1
851 Ga0500644_0012275
852 Ga0500641_0005233
853 Ga0500556_0000291
854 Ga0500617_026713
855 Ga0500588_0004156
856 Ga0500616_0000064
857 Ga0500622_0006987
858 Ga0501084_0010051
859 Ga0466962_0000184
860 Ga0530510_0312063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01476

LysM

LysM domain

67

110

0.84

PF03734

YkuD

L,D-transpeptidase catalytic domain

120

260

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bum-assembly1.cif.gz_B crystal structure of lysm domain from equisetum arvense chitinase a 0.9202 49 91
5k2l-assembly1.cif.gz_A crystal structure of lysm domain from volvox carteri chitinase 0.8976 50 94
4pxv-assembly2.cif.gz_B crystal structure of lysm domain from pteris ryukyuensis chitinase a 0.8777 49 91
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.8645 33 319
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.8586 33 319
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.916 104 245 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9085 102 244 2.40.440.10
5bumA00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.9015 49 93 3.10.350.10
5k2lA00 Alpha Beta;Roll;Membrane-bound Lytic Murein Transglycosylase D; Chain A;LysM domain 0.8977 50 94 3.10.350.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8964 102 244 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A7V5XEM5-F1-model_v4 L,D-transpeptidase 0.9753 48 185 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7C3HEP0-F1-model_v4 LysM peptidoglycan-binding domain-containing protein 0.9727 35 208 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A6S6NCT8-F1-model_v4 deleted 0.9689 135 244
AF-A0A2N2SRL9-F1-model_v4 Peptigoglycan-binding protein LysM 0.9619 35 134
AF-A0A7V5XEM5-F1-model_v4 L,D-transpeptidase 0.9617 48 185 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972

Map