F441896

General Info

Members Datasets Scaffolds Average Seq Length
429 280 858 148

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10171561|Ga0105247_101715613
Length 171
Sequence VRCRAELKLDLRDLQKDSKAMRAVVQRVTRARVTIDGAVVGEIEKGLVVLLGIARDDSREDADYLAPKIAALRIFDDAEGRMNVSVKEIGGGLLIVSQFTLYGDVSRGLRPSWSDAAAPEVAEPLYEYFVESSRTLVGRVETGSFRKMMQVELVNDGPVTILIDSHKKAQK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
131 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
132 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
133 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
134 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
185 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
186 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
187 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
188 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
189 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
190 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
191 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
194 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
250 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
260 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
261 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
262 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
263 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
264 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
265 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
266 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
267 2738543012 Acidovorax sp. CF301 Isolate Unclassified
268 2784132063 Pseudomonas sp. 424 Isolate Unclassified
269 2816332133 Acidovorax radicis 2721A Isolate Unclassified
270 2842677519 Variovorax sp. R-72495 Isolate Unclassified
271 2842733646 Variovorax sp. R-72446 Isolate Unclassified
272 2842747753 Variovorax sp. R-72060 Isolate Unclassified
273 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
274 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
275 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
276 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
277 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
278 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
279 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
280 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.32
Nodule 0.93
Rhizoplane 2.56
Rhizosphere 80.19
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10171561 3300009101 Bacteria 1443
2 JGI25152J39213_1003401 3300002773 Bacteria 5448
3 JGI25153J46596_10003309 3300003215 Bacteria 9056
4 rootH2_10025068 3300003320 Bacteria 4822
5 rootH1_10029228 3300003323 Bacteria 4812
6 Ga0055531_10009766 3300003794 Bacteria 4866
7 Ga0065704_10117187 3300005289 Bacteria 1839
8 Ga0065707_10671749 3300005295 Unclassified 653
9 Ga0070658_10458115 3300005327 Bacteria 1099
10 Ga0070676_10041643 3300005328 Bacteria 2664
11 Ga0070690_100014992 3300005330 Bacteria 4612
12 Ga0070670_100183736 3300005331 Bacteria 1815
13 Ga0068869_100667784 3300005334 Bacteria 884
14 Ga0070680_100280327 3300005336 Bacteria 1412
15 Ga0068868_100083445 3300005338 Bacteria 2565
16 Ga0068868_100236156 3300005338 Bacteria 1535
17 Ga0068868_100260205 3300005338 Bacteria 1463
18 Ga0070687_100112862 3300005343 Bacteria 1541
19 Ga0070687_100306935 3300005343 Bacteria 1009
20 Ga0070687_100791907 3300005343 Bacteria 671
21 Ga0070671_100018389 3300005355 Bacteria 5676
22 Ga0070671_100532830 3300005355 Bacteria 1012
23 Ga0070674_100080296 3300005356 Bacteria 2328
24 Ga0070674_100611250 3300005356 Bacteria 922
25 Ga0070673_100093670 3300005364 Bacteria 2460
26 Ga0070673_100180063 3300005364 Bacteria 1809
27 Ga0070673_100468334 3300005364 Bacteria 1136
28 Ga0070659_100850952 3300005366 Bacteria 795
29 Ga0070667_100446200 3300005367 Bacteria 1182
30 Ga0070709_10180524 3300005434 Bacteria 1482
31 Ga0070710_10305955 3300005437 Bacteria 1039
32 Ga0070710_10542048 3300005437 Unclassified 802
33 Ga0070705_100745079 3300005440 Bacteria 774
34 Ga0070663_101140286 3300005455 Bacteria 683
35 Ga0070663_101235205 3300005455 Bacteria 658
36 Ga0070678_100089571 3300005456 Bacteria 2355
37 Ga0070678_101129477 3300005456 Bacteria 724
38 Ga0070662_100278106 3300005457 Bacteria 1354
39 Ga0070681_10032907 3300005458 Bacteria 5205
40 Ga0070706_100000068 3300005467 Bacteria 119756
41 Ga0070698_100167651 3300005471 Bacteria 2138
42 Ga0068853_100108333 3300005539 Bacteria 2465
43 Ga0068853_100198064 3300005539 Bacteria 1827
44 Ga0070672_100006490 3300005543 Bacteria 7862
45 Ga0070672_100433928 3300005543 Bacteria 1130
46 Ga0070695_100044637 3300005545 Bacteria 2823
47 Ga0070695_100161689 3300005545 Bacteria 1572
48 Ga0070696_100052296 3300005546 Bacteria 2842
49 Ga0070696_101556834 3300005546 Unclassified 567
50 Ga0070693_100009624 3300005547 Bacteria 4810
51 Ga0070693_100112095 3300005547 Bacteria 1680
52 Ga0070693_100528376 3300005547 Unclassified 841
53 Ga0068855_100200565 3300005563 Bacteria 2246
54 Ga0068857_100257149 3300005577 Bacteria 1602
55 Ga0068857_101130977 3300005577 Bacteria 757
56 Ga0068854_100011048 3300005578 Bacteria 5862
57 Ga0068856_100197676 3300005614 Bacteria 2025
58 Ga0068856_101128777 3300005614 Bacteria 801
59 Ga0070702_100226615 3300005615 Bacteria 1253
60 Ga0070702_100418363 3300005615 Bacteria 964
61 Ga0068852_100088863 3300005616 Bacteria 2760
62 Ga0068852_100249524 3300005616 Bacteria 1700
63 Ga0068852_100597237 3300005616 Bacteria 1108
64 Ga0068852_101862752 3300005616 Bacteria 624
65 Ga0068852_101863127 3300005616 Unclassified 624
66 Ga0068859_100023475 3300005617 Bacteria 6189
67 Ga0068859_100050016 3300005617 Bacteria 4198
68 Ga0068864_100178587 3300005618 Bacteria 1940
69 Ga0068864_100415766 3300005618 Bacteria 1280
70 Ga0068864_100630822 3300005618 Bacteria 1042
71 Ga0068861_100190984 3300005719 Bacteria 1712
72 Ga0068851_10294644 3300005834 Bacteria 931
73 Ga0068863_100064387 3300005841 Bacteria 3467
74 Ga0068863_100097107 3300005841 Bacteria 2798
75 Ga0068863_100120420 3300005841 Bacteria 2502
76 Ga0068863_100258879 3300005841 Unclassified 1682
77 Ga0068863_100745555 3300005841 Bacteria 975
78 Ga0068858_100093222 3300005842 Bacteria 2803
79 Ga0068858_100189876 3300005842 Bacteria 1941
80 Ga0068860_100006731 3300005843 Bacteria 11531
81 Ga0068862_100458477 3300005844 Bacteria 1203
82 Ga0068862_100897988 3300005844 Bacteria 871
83 Ga0075364_10002397 3300006051 Bacteria 10511
84 Ga0070716_100166560 3300006173 Bacteria 1434
85 Ga0070716_100344113 3300006173 Unclassified 1053
86 Ga0075366_10000488 3300006195 Bacteria 18352
87 Ga0075366_10001615 3300006195 Bacteria 11295
88 Ga0075366_10002670 3300006195 Bacteria 9196
89 Ga0075366_10030878 3300006195 Bacteria 3151
90 Ga0097621_101144335 3300006237 Bacteria 732
91 Ga0075370_10003491 3300006353 Bacteria 7490
92 Ga0075370_10014520 3300006353 Bacteria 4203
93 Ga0075370_10943962 3300006353 Bacteria 528
94 Ga0068871_100013329 3300006358 Bacteria 6100
95 Ga0068871_100184027 3300006358 Bacteria 1797
96 Ga0068871_100735833 3300006358 Bacteria 906
97 Ga0075430_100015228 3300006846 Bacteria 6548
98 Ga0075430_100022572 3300006846 Bacteria 5356
99 Ga0075431_100031972 3300006847 Bacteria 5422
100 Ga0075433_10111592 3300006852 Bacteria 2426
101 Ga0075429_100181494 3300006880 Bacteria 1844
102 Ga0068865_100136168 3300006881 Bacteria 1846
103 Ga0068865_100845842 3300006881 Bacteria 792
104 Ga0075436_101060283 3300006914 Bacteria 609
105 Ga0097620_100023476 3300006931 Bacteria 6189
106 Ga0097620_100050022 3300006931 Bacteria 4198
107 Ga0099824_1030403 3300006942 Bacteria 2172
108 Ga0099823_1000139 3300006944 Bacteria 37935
109 Ga0105240_10100282 3300009093 Bacteria 3524
110 Ga0105240_11581990 3300009093 Bacteria 686
111 Ga0105245_11531110 3300009098 Bacteria 718
112 Ga0105247_10646369 3300009101 Bacteria 790
113 Ga0114129_10109803 3300009147 Bacteria 3807
114 Ga0114129_10139274 3300009147 Bacteria 3327
115 Ga0114129_11971889 3300009147 Bacteria 707
116 Ga0105241_10009042 3300009174 Bacteria 7328
117 Ga0105241_10249461 3300009174 Bacteria 1504
118 Ga0105241_10342174 3300009174 Bacteria 1296
119 Ga0105242_10026286 3300009176 Bacteria 4613
120 Ga0105248_10024656 3300009177 Bacteria 6688
121 Ga0105248_10036212 3300009177 Bacteria 5519
122 Ga0105248_10072071 3300009177 Bacteria 3882
123 Ga0105248_10215010 3300009177 Bacteria 2165
124 Ga0105248_10653250 3300009177 Bacteria 1187
125 Ga0105237_10033093 3300009545 Bacteria 5236
126 Ga0105237_10820931 3300009545 Bacteria 937
127 Ga0157373_10397828 3300013100 Bacteria 987
128 Ga0157369_10177377 3300013105 Bacteria 2243
129 Ga0157369_10229827 3300013105 Bacteria 1940
130 Ga0157369_11481783 3300013105 Bacteria 690
131 Ga0157378_10279529 3300013297 Bacteria 1608
132 Ga0157378_10568008 3300013297 Bacteria 1142
133 Ga0163162_10005068 3300013306 Bacteria 12694
134 Ga0163162_10116786 3300013306 Bacteria 2769
135 Ga0163162_12343340 3300013306 Bacteria 613
136 Ga0157372_10189303 3300013307 Bacteria 2383
137 Ga0157372_10676055 3300013307 Bacteria 1202
138 Ga0157375_10011855 3300013308 Bacteria 7711
139 Ga0157375_10016242 3300013308 Bacteria 6679
140 Ga0157375_12483601 3300013308 Bacteria 619
141 Ga0157380_10042717 3300014326 Bacteria 3545
142 Ga0157380_10489211 3300014326 Bacteria 1192
143 Ga0157380_11918271 3300014326 Bacteria 653
144 Ga0157377_10253728 3300014745 Bacteria 1141
145 Ga0157379_10034437 3300014968 Bacteria 4516
146 Ga0157379_10132040 3300014968 Bacteria 2248
147 Ga0157379_10272326 3300014968 Bacteria 1540
148 Ga0157376_10003875 3300014969 Bacteria 10342
149 Ga0157376_10220915 3300014969 Bacteria 1755
150 Ga0163161_10001195 3300017792 Bacteria 19533
151 Ga0163161_10001256 3300017792 Bacteria 18983
152 Ga0213872_10000498 3300021361 Bacteria 31427
153 Ga0213872_10000542 3300021361 Bacteria 29380
154 Ga0209673_1002844 3300025273 Bacteria 11093
155 Ga0209050_1009756 3300025298 Bacteria 4854
156 Ga0209256_1021091 3300025299 Bacteria 2013
157 Ga0209257_1006464 3300025304 Bacteria 7531
158 Ga0207656_10183235 3300025321 Bacteria 1006
159 Ga0207705_10313663 3300025909 Bacteria 1204
160 Ga0207684_10000326 3300025910 Bacteria 67183
161 Ga0207654_10007554 3300025911 Bacteria 5482
162 Ga0207654_10180789 3300025911 Bacteria 1376
163 Ga0207707_10009568 3300025912 Bacteria 8408
164 Ga0207707_10025180 3300025912 Bacteria 5204
165 Ga0207671_10687339 3300025914 Bacteria 814
166 Ga0207660_10229371 3300025917 Bacteria 1460
167 Ga0207662_10055806 3300025918 Bacteria 2358
168 Ga0207662_10082336 3300025918 Unclassified 1966
169 Ga0207652_10156556 3300025921 Bacteria 2041
170 Ga0207650_10018888 3300025925 Bacteria 4843
171 Ga0207650_10239694 3300025925 Bacteria 1465
172 Ga0207687_10997974 3300025927 Bacteria 718
173 Ga0207644_10002633 3300025931 Bacteria 11563
174 Ga0207644_10334765 3300025931 Bacteria 1226
175 Ga0207644_10490728 3300025931 Bacteria 1012
176 Ga0207690_10286963 3300025932 Bacteria 1283
177 Ga0207706_10273588 3300025933 Bacteria 1474
178 Ga0207706_10684412 3300025933 Bacteria 877
179 Ga0207670_10360511 3300025936 Bacteria 1153
180 Ga0207669_10351158 3300025937 Bacteria 1139
181 Ga0207669_10958371 3300025937 Bacteria 717
182 Ga0207704_10197337 3300025938 Bacteria 1470
183 Ga0207704_10448687 3300025938 Bacteria 1029
184 Ga0207704_10485450 3300025938 Bacteria 993
185 Ga0207691_10003449 3300025940 Bacteria 15379
186 Ga0207691_10052898 3300025940 Bacteria 3708
187 Ga0207711_10059975 3300025941 Bacteria 3277
188 Ga0207711_10120988 3300025941 Bacteria 2337
189 Ga0207711_10124290 3300025941 Bacteria 2306
190 Ga0207711_10444061 3300025941 Bacteria 1207
191 Ga0207689_10035012 3300025942 Bacteria 4171
192 Ga0207679_10157423 3300025945 Bacteria 1856
193 Ga0207679_11864292 3300025945 Bacteria 549
194 Ga0207667_10062781 3300025949 Bacteria 3883
195 Ga0207651_10040324 3300025960 Bacteria 3088
196 Ga0207668_10332666 3300025972 Unclassified 1264
197 Ga0207640_10009123 3300025981 Bacteria 5539
198 Ga0207658_10012147 3300025986 Bacteria 5874
199 Ga0207677_10036878 3300026023 Bacteria 3191
200 Ga0207677_10069636 3300026023 Bacteria 2475
201 Ga0207677_10149706 3300026023 Bacteria 1799
202 Ga0207703_10004229 3300026035 Bacteria 11831
203 Ga0207703_10376713 3300026035 Bacteria 1312
204 Ga0207703_11877064 3300026035 Bacteria 575
205 Ga0207639_10267439 3300026041 Bacteria 1498
206 Ga0207678_10364881 3300026067 Bacteria 1247
207 Ga0207678_10663016 3300026067 Bacteria 917
208 Ga0207708_10503860 3300026075 Bacteria 1015
209 Ga0207702_11697435 3300026078 Bacteria 624
210 Ga0207641_10011103 3300026088 Bacteria 7389
211 Ga0207641_10224203 3300026088 Unclassified 1745
212 Ga0207641_10248837 3300026088 Bacteria 1659
213 Ga0207641_10296088 3300026088 Bacteria 1527
214 Ga0207641_10674554 3300026088 Bacteria 1016
215 Ga0207641_12058250 3300026088 Bacteria 572
216 Ga0207648_10429691 3300026089 Bacteria 1200
217 Ga0207648_10822470 3300026089 Bacteria 865
218 Ga0207676_10030310 3300026095 Bacteria 4059
219 Ga0207676_10162465 3300026095 Bacteria 1936
220 Ga0207676_10420392 3300026095 Bacteria 1253
221 Ga0207674_10327517 3300026116 Bacteria 1481
222 Ga0207674_10504625 3300026116 Bacteria 1169
223 Ga0207683_10084097 3300026121 Bacteria 2828
224 Ga0207698_10034555 3300026142 Bacteria 3686
225 Ga0207698_10079128 3300026142 Bacteria 2643
226 Ga0207698_11232756 3300026142 Bacteria 762
227 Ga0207698_11574583 3300026142 Bacteria 672
228 Ga0209389_1002532 3300027296 Bacteria 14118
229 Ga0268265_10549516 3300028380 Bacteria 1096
230 Ga0268265_10947820 3300028380 Bacteria 848
231 Ga0268264_10068492 3300028381 Bacteria 2999
232 Ga0307515_10074235 3300028794 Bacteria 4553
233 Ga0307515_10676073 3300028794 Bacteria 646
234 Ga0316177_1060996 3300030731 Bacteria 3496
235 Ga0316176_1154893 3300030732 Bacteria 1938
236 Ga0314311_1017345 3300030733 Bacteria 6556
237 Ga0316179_1117184 3300030734 Bacteria 1208
238 Ga0316180_1180837 3300030736 Bacteria 2022
239 Ga0316183_1012117 3300030742 Bacteria 3436
240 Ga0316181_1028611 3300030744 Bacteria 3293
241 Ga0316182_1147191 3300030745 Bacteria 5616
242 Ga0265329_10173255 3300031242 Bacteria 704
243 Ga0265327_10007744 3300031251 Bacteria 8203
244 Ga0307513_10042374 3300031456 Bacteria 5013
245 Ga0307509_10020572 3300031507 Bacteria 7484
246 Ga0307408_100344087 3300031548 Bacteria 1263
247 Ga0307408_100438534 3300031548 Bacteria 1130
248 Ga0307408_100705031 3300031548 Bacteria 907
249 Ga0307408_101321425 3300031548 Bacteria 676
250 Ga0316576_10043310 3300031727 Bacteria 3247
251 Ga0316576_10054516 3300031727 Bacteria 2916
252 Ga0316578_10153463 3300031728 Bacteria 1388
253 Ga0307516_10660242 3300031730 Bacteria 701
254 Ga0307405_10178412 3300031731 Bacteria 1522
255 Ga0307405_10427012 3300031731 Bacteria 1044
256 Ga0307405_10689974 3300031731 Bacteria 844
257 Ga0307413_10005614 3300031824 Bacteria 5623
258 Ga0307413_10224290 3300031824 Bacteria 1375
259 Ga0307410_10002610 3300031852 Bacteria 8766
260 Ga0307410_10382926 3300031852 Bacteria 1132
261 Ga0307410_10783206 3300031852 Bacteria 810
262 Ga0307406_10842982 3300031901 Bacteria 776
263 Ga0307406_11015994 3300031901 Bacteria 712
264 Ga0307406_11387782 3300031901 Bacteria 615
265 Ga0307406_11453406 3300031901 Bacteria 602
266 Ga0307407_10010741 3300031903 Bacteria 4329
267 Ga0307412_10024829 3300031911 Bacteria 3704
268 Ga0307412_10084858 3300031911 Bacteria 2199
269 Ga0307412_10121878 3300031911 Bacteria 1879
270 Ga0307412_10199700 3300031911 Bacteria 1518
271 Ga0307412_10803685 3300031911 Bacteria 817
272 Ga0307412_10961595 3300031911 Bacteria 752
273 Ga0307409_100032550 3300031995 Bacteria 3782
274 Ga0307409_100268429 3300031995 Bacteria 1570
275 Ga0307416_100091129 3300032002 Bacteria 2617
276 Ga0307414_10187379 3300032004 Bacteria 1671
277 Ga0307414_10240030 3300032004 Bacteria 1500
278 Ga0307414_10328766 3300032004 Bacteria 1304
279 Ga0307414_10639624 3300032004 Bacteria 958
280 Ga0307414_11031766 3300032004 Unclassified 758
281 Ga0307411_10003141 3300032005 Bacteria 7576
282 Ga0373938_0155835 3300034957 Bacteria 610
283 Ga0373940_0077051 3300035088 Unclassified 980
284 Ga0316574_0227164 3300035398 Bacteria 1195
285 Ga0316574_0642650 3300035398 Bacteria 653
286 Ga0373927_0766199 3300035695 Bacteria 637
287 Ga0316584_0096326 3300036712 Bacteria 2215
288 Ga0373925_0009515 3300037068 Bacteria 7074
289 Ga0395899_0430540 3300037312 Bacteria 868
290 Ga0395900_0277265 3300037418 Bacteria 1670
291 Ga0395905_0021222 3300037471 Bacteria 6146
292 Ga0395905_0054367 3300037471 Bacteria 3747
293 Ga0395905_0457115 3300037471 Bacteria 1175
294 Ga0395905_0495844 3300037471 Bacteria 1121
295 Ga0395905_1117132 3300037471 Bacteria 691
296 Ga0436364_1445408 3300037853 Unclassified 592
297 Ga0395901_1212599 3300038443 Bacteria 720
298 Ga0436361_0074177 3300039447 Bacteria 20991
299 Ga0436361_0215655 3300039447 Bacteria 4273
300 Ga0436361_0692684 3300039447 Bacteria 133303
301 Ga0436361_0842061 3300039447 Bacteria 3173
302 Ga0439436_0002597 3300041404 Bacteria 5434
303 Ga0439466_0004355 3300041411 Bacteria 5458
304 Ga0439465_0004610 3300041413 Bacteria 4448
305 Ga0439465_0106668 3300041413 Bacteria 971
306 Ga0451791_1427295 3300041451 Bacteria 695
307 Ga0451793_0884303 3300041452 Bacteria 3170
308 Ga0451795_0003073 3300041456 Bacteria 1475
309 Ga0451800_0861231 3300041459 Bacteria 1469
310 Ga0451802_1687241 3300041460 Bacteria 1444
311 Ga0451833_1279728 3300041491 Bacteria 919
312 Ga0451839_1455947 3300041496 Bacteria 547
313 Ga0451841_0657186 3300041498 Bacteria 744
314 Ga0451853_1502345 3300041512 Bacteria 2654
315 Ga0439431_0003938 3300041997 Bacteria 3274
316 Ga0439431_0016515 3300041997 Bacteria 1728
317 Ga0439431_0249457 3300041997 Bacteria 526
318 Ga0439442_001693 3300042002 Bacteria 4326
319 Ga0439449_0046964 3300042007 Bacteria 1599
320 Ga0439450_003783 3300042008 Bacteria 2535
321 Ga0439462_0036347 3300042015 Bacteria 1311
322 Ga0450921_001618 3300042123 Bacteria 1393
323 Ga0450923_000582 3300042125 Bacteria 4154
324 Ga0450888_010222 3300042126 Bacteria 1084
325 Ga0450894_012623 3300042131 Bacteria 1106
326 Ga0450894_042545 3300042131 Bacteria 655
327 Ga0450896_043792 3300042133 Bacteria 702
328 Ga0450899_009791 3300042135 Bacteria 1059
329 Ga0450899_017045 3300042135 Bacteria 835
330 Ga0450906_000506 3300042145 Bacteria 8214
331 Ga0439446_0018417 3300042156 Bacteria 1956
332 Ga0439446_0057413 3300042156 Bacteria 1171
333 Ga0439446_0204705 3300042156 Bacteria 667
334 Ga0450908_000591 3300042184 Bacteria 6952
335 Ga0450909_007248 3300042185 Bacteria 1603
336 Ga0439434_0003667 3300042435 Bacteria 4489
337 Ga0450918_002701 3300042531 Bacteria 3332
338 Ga0450893_0017716 3300042532 Bacteria 1212
339 Ga0451577_0893092 3300042876 Bacteria 800
340 Ga0466972_0023701 3300044658 Bacteria 3051
341 Ga0466963_0738788 3300044694 Unclassified 694
342 Ga0453684_1953042 3300044712 Bacteria 592
343 Ga0466968_0084521 3300044735 Bacteria 1399
344 Ga0466970_0251274 3300044765 Unclassified 991
345 Ga0495638_0229779 3300046460 Bacteria 1033
346 Ga0495582_0134208 3300046473 Bacteria 1400
347 Ga0495582_0292264 3300046473 Bacteria 936
348 Ga0495632_0005828 3300046519 Bacteria 8069
349 Ga0495663_0102167 3300046525 Bacteria 945
350 Ga0495642_0089616 3300046528 Bacteria 1301
351 Ga0495642_0132560 3300046528 Bacteria 1073
352 Ga0495598_0191712 3300046537 Bacteria 734
353 Ga0495621_0140551 3300046539 Bacteria 945
354 Ga0495633_0101122 3300046558 Bacteria 1338
355 Ga0495656_0049139 3300046615 Bacteria 1795
356 Ga0495588_0121432 3300046674 Bacteria 1377
357 Ga0495647_0081320 3300046681 Bacteria 1314
358 Ga0495658_0050308 3300046683 Bacteria 2357
359 Ga0495624_0786668 3300046690 Bacteria 563
360 Ga0495660_0313364 3300046810 Bacteria 707
361 Ga0495615_0005961 3300048090 Bacteria 2227
362 Ga0496100_1564614 3300048903 Bacteria 521
363 Ga0496102_0673500 3300048905 Bacteria 958
364 Ga0496104_1792310 3300048907 Bacteria 516
365 Ga0496105_0447014 3300048908 Bacteria 1021
366 Ga0496112_0048047 3300048915 Bacteria 4185
367 Ga0496113_0110559 3300048916 Bacteria 2138
368 Ga0496122_0039031 3300048925 Bacteria 3793
369 Ga0496123_0157830 3300048926 Bacteria 1213
370 Ga0496124_0026598 3300048927 Bacteria 5214
371 Ga0496125_0003822 3300048928 Bacteria 17891
372 Ga0496126_0048700 3300048929 Bacteria 3871
373 Ga0501031_0249732 3300049568 Bacteria 1153
374 Ga0501074_0244676 3300049590 Bacteria 1276
375 Ga0501238_013266 3300049671 Bacteria 1121
376 Ga0501249_005623 3300049679 Bacteria 2562
377 Ga0501225_0249508 3300049705 Unclassified 583
378 Ga0501080_0655943 3300049742 Bacteria 928
379 Ga0501270_147422 3300049767 Unclassified 534
380 Ga0501035_0054443 3300049822 Bacteria 3575
381 Ga0501044_0125265 3300049823 Bacteria 2567
382 nmdc:mga03683_355537_c1 3300050489 Bacteria 694
383 nmdc:mga00v17_193926_c1 3300050491 Bacteria 1312
384 nmdc:mga00v17_479448_c1 3300050491 Bacteria 807
385 nmdc:mga0k408_1174_c1 3300050493 Bacteria 14328
386 nmdc:mga0k408_33839_c1 3300050493 Bacteria 2924
387 nmdc:mga0k408_729_c1 3300050493 Bacteria 18040
388 nmdc:mga06z11_42458_c1 3300050494 Bacteria 2281
389 nmdc:mga07m45_4514_c1 3300050496 Bacteria 6816
390 nmdc:mga07m45_79327_c1 3300050496 Bacteria 1874
391 nmdc:mga05p37_1122966_c1 3300050507 Unclassified 821
392 nmdc:mga09592_404914_c1 3300050508 Bacteria 1179
393 nmdc:mga0qj67_1122603_c1 3300050509 Unclassified 614
394 nmdc:mga0qj67_429354_c1 3300050509 Bacteria 1065
395 nmdc:mga06r32_717248_c1 3300050510 Unclassified 965
396 nmdc:mga0rr50_1892_c1 3300050513 Bacteria 10728
397 Ga0500635_0019526 3300053080 Bacteria 2062
398 Ga0500646_0053460 3300053090 Bacteria 1171
399 Ga0500651_0009413 3300053093 Bacteria 5802
400 Ga0500650_0064615 3300053098 Bacteria 1710
401 Ga0500562_007029 3300053108 Bacteria 2840
402 Ga0500623_140030 3300053127 Bacteria 1018
403 Ga0500642_0067417 3300053130 Bacteria 1621
404 Ga0500652_000771 3300053131 Bacteria 10814
405 Ga0500652_238908 3300053131 Bacteria 724
406 Ga0500655_005628 3300053133 Bacteria 2255
407 Ga0500568_0112357 3300053139 Bacteria 1017
408 Ga0500577_0021804 3300053142 Bacteria 2116
409 Ga0500586_015493 3300053145 Bacteria 2292
410 Ga0500588_0401817 3300053146 Bacteria 522
411 Ga0500622_0000890 3300053156 Bacteria 25460
412 Ga0500596_030340 3300053735 Bacteria 837
413 2574431348 2574179768 Bacteria 4907129
414 2587734976 2585428058 Bacteria 6853932
415 2644164028 2643221628 Bacteria 5745828
416 2739241762 2738543012 Bacteria 7115078
417 2784261109 2784132063 Bacteria 6262788
418 2816470933 2816332133 Bacteria 7249298
419 2842678635 2842677519 Bacteria 5615038
420 2842733903 2842733646 Bacteria 5716726
421 2842752382 2842747753 Bacteria 5578255
422 2842846424 2842843487 Bacteria 6004777
423 2880231052 2880230671 Bacteria 6140320
424 2894023833 2894023352 Bacteria 5167372
425 2919488768 2919487758 Bacteria 5929766
426 2919708480 2919704043 Bacteria 5560311
427 2945909590 2945909444 Bacteria 7065066
428 2945988428 2945984333 Bacteria 7358892
429 2990199643 2990196909 Bacteria 4054280
430 Ga0105247_10171561
431 JGI25152J39213_1003401
432 JGI25153J46596_10003309
433 rootH2_10025068
434 rootH1_10029228
435 Ga0055531_10009766
436 Ga0065704_10117187
437 Ga0065707_10671749
438 Ga0070658_10458115
439 Ga0070676_10041643
440 Ga0070690_100014992
441 Ga0070670_100183736
442 Ga0068869_100667784
443 Ga0070680_100280327
444 Ga0068868_100083445
445 Ga0068868_100236156
446 Ga0068868_100260205
447 Ga0070687_100112862
448 Ga0070687_100306935
449 Ga0070687_100791907
450 Ga0070671_100018389
451 Ga0070671_100532830
452 Ga0070674_100080296
453 Ga0070674_100611250
454 Ga0070673_100093670
455 Ga0070673_100180063
456 Ga0070673_100468334
457 Ga0070659_100850952
458 Ga0070667_100446200
459 Ga0070709_10180524
460 Ga0070710_10305955
461 Ga0070710_10542048
462 Ga0070705_100745079
463 Ga0070663_101140286
464 Ga0070663_101235205
465 Ga0070678_100089571
466 Ga0070678_101129477
467 Ga0070662_100278106
468 Ga0070681_10032907
469 Ga0070706_100000068
470 Ga0070698_100167651
471 Ga0068853_100108333
472 Ga0068853_100198064
473 Ga0070672_100006490
474 Ga0070672_100433928
475 Ga0070695_100044637
476 Ga0070695_100161689
477 Ga0070696_100052296
478 Ga0070696_101556834
479 Ga0070693_100009624
480 Ga0070693_100112095
481 Ga0070693_100528376
482 Ga0068855_100200565
483 Ga0068857_100257149
484 Ga0068857_101130977
485 Ga0068854_100011048
486 Ga0068856_100197676
487 Ga0068856_101128777
488 Ga0070702_100226615
489 Ga0070702_100418363
490 Ga0068852_100088863
491 Ga0068852_100249524
492 Ga0068852_100597237
493 Ga0068852_101862752
494 Ga0068852_101863127
495 Ga0068859_100023475
496 Ga0068859_100050016
497 Ga0068864_100178587
498 Ga0068864_100415766
499 Ga0068864_100630822
500 Ga0068861_100190984
501 Ga0068851_10294644
502 Ga0068863_100064387
503 Ga0068863_100097107
504 Ga0068863_100120420
505 Ga0068863_100258879
506 Ga0068863_100745555
507 Ga0068858_100093222
508 Ga0068858_100189876
509 Ga0068860_100006731
510 Ga0068862_100458477
511 Ga0068862_100897988
512 Ga0075364_10002397
513 Ga0070716_100166560
514 Ga0070716_100344113
515 Ga0075366_10000488
516 Ga0075366_10001615
517 Ga0075366_10002670
518 Ga0075366_10030878
519 Ga0097621_101144335
520 Ga0075370_10003491
521 Ga0075370_10014520
522 Ga0075370_10943962
523 Ga0068871_100013329
524 Ga0068871_100184027
525 Ga0068871_100735833
526 Ga0075430_100015228
527 Ga0075430_100022572
528 Ga0075431_100031972
529 Ga0075433_10111592
530 Ga0075429_100181494
531 Ga0068865_100136168
532 Ga0068865_100845842
533 Ga0075436_101060283
534 Ga0097620_100023476
535 Ga0097620_100050022
536 Ga0099824_1030403
537 Ga0099823_1000139
538 Ga0105240_10100282
539 Ga0105240_11581990
540 Ga0105245_11531110
541 Ga0105247_10646369
542 Ga0114129_10109803
543 Ga0114129_10139274
544 Ga0114129_11971889
545 Ga0105241_10009042
546 Ga0105241_10249461
547 Ga0105241_10342174
548 Ga0105242_10026286
549 Ga0105248_10024656
550 Ga0105248_10036212
551 Ga0105248_10072071
552 Ga0105248_10215010
553 Ga0105248_10653250
554 Ga0105237_10033093
555 Ga0105237_10820931
556 Ga0157373_10397828
557 Ga0157369_10177377
558 Ga0157369_10229827
559 Ga0157369_11481783
560 Ga0157378_10279529
561 Ga0157378_10568008
562 Ga0163162_10005068
563 Ga0163162_10116786
564 Ga0163162_12343340
565 Ga0157372_10189303
566 Ga0157372_10676055
567 Ga0157375_10011855
568 Ga0157375_10016242
569 Ga0157375_12483601
570 Ga0157380_10042717
571 Ga0157380_10489211
572 Ga0157380_11918271
573 Ga0157377_10253728
574 Ga0157379_10034437
575 Ga0157379_10132040
576 Ga0157379_10272326
577 Ga0157376_10003875
578 Ga0157376_10220915
579 Ga0163161_10001195
580 Ga0163161_10001256
581 Ga0213872_10000498
582 Ga0213872_10000542
583 Ga0209673_1002844
584 Ga0209050_1009756
585 Ga0209256_1021091
586 Ga0209257_1006464
587 Ga0207656_10183235
588 Ga0207705_10313663
589 Ga0207684_10000326
590 Ga0207654_10007554
591 Ga0207654_10180789
592 Ga0207707_10009568
593 Ga0207707_10025180
594 Ga0207671_10687339
595 Ga0207660_10229371
596 Ga0207662_10055806
597 Ga0207662_10082336
598 Ga0207652_10156556
599 Ga0207650_10018888
600 Ga0207650_10239694
601 Ga0207687_10997974
602 Ga0207644_10002633
603 Ga0207644_10334765
604 Ga0207644_10490728
605 Ga0207690_10286963
606 Ga0207706_10273588
607 Ga0207706_10684412
608 Ga0207670_10360511
609 Ga0207669_10351158
610 Ga0207669_10958371
611 Ga0207704_10197337
612 Ga0207704_10448687
613 Ga0207704_10485450
614 Ga0207691_10003449
615 Ga0207691_10052898
616 Ga0207711_10059975
617 Ga0207711_10120988
618 Ga0207711_10124290
619 Ga0207711_10444061
620 Ga0207689_10035012
621 Ga0207679_10157423
622 Ga0207679_11864292
623 Ga0207667_10062781
624 Ga0207651_10040324
625 Ga0207668_10332666
626 Ga0207640_10009123
627 Ga0207658_10012147
628 Ga0207677_10036878
629 Ga0207677_10069636
630 Ga0207677_10149706
631 Ga0207703_10004229
632 Ga0207703_10376713
633 Ga0207703_11877064
634 Ga0207639_10267439
635 Ga0207678_10364881
636 Ga0207678_10663016
637 Ga0207708_10503860
638 Ga0207702_11697435
639 Ga0207641_10011103
640 Ga0207641_10224203
641 Ga0207641_10248837
642 Ga0207641_10296088
643 Ga0207641_10674554
644 Ga0207641_12058250
645 Ga0207648_10429691
646 Ga0207648_10822470
647 Ga0207676_10030310
648 Ga0207676_10162465
649 Ga0207676_10420392
650 Ga0207674_10327517
651 Ga0207674_10504625
652 Ga0207683_10084097
653 Ga0207698_10034555
654 Ga0207698_10079128
655 Ga0207698_11232756
656 Ga0207698_11574583
657 Ga0209389_1002532
658 Ga0268265_10549516
659 Ga0268265_10947820
660 Ga0268264_10068492
661 Ga0307515_10074235
662 Ga0307515_10676073
663 Ga0316177_1060996
664 Ga0316176_1154893
665 Ga0314311_1017345
666 Ga0316179_1117184
667 Ga0316180_1180837
668 Ga0316183_1012117
669 Ga0316181_1028611
670 Ga0316182_1147191
671 Ga0265329_10173255
672 Ga0265327_10007744
673 Ga0307513_10042374
674 Ga0307509_10020572
675 Ga0307408_100344087
676 Ga0307408_100438534
677 Ga0307408_100705031
678 Ga0307408_101321425
679 Ga0316576_10043310
680 Ga0316576_10054516
681 Ga0316578_10153463
682 Ga0307516_10660242
683 Ga0307405_10178412
684 Ga0307405_10427012
685 Ga0307405_10689974
686 Ga0307413_10005614
687 Ga0307413_10224290
688 Ga0307410_10002610
689 Ga0307410_10382926
690 Ga0307410_10783206
691 Ga0307406_10842982
692 Ga0307406_11015994
693 Ga0307406_11387782
694 Ga0307406_11453406
695 Ga0307407_10010741
696 Ga0307412_10024829
697 Ga0307412_10084858
698 Ga0307412_10121878
699 Ga0307412_10199700
700 Ga0307412_10803685
701 Ga0307412_10961595
702 Ga0307409_100032550
703 Ga0307409_100268429
704 Ga0307416_100091129
705 Ga0307414_10187379
706 Ga0307414_10240030
707 Ga0307414_10328766
708 Ga0307414_10639624
709 Ga0307414_11031766
710 Ga0307411_10003141
711 Ga0373938_0155835
712 Ga0373940_0077051
713 Ga0316574_0227164
714 Ga0316574_0642650
715 Ga0373927_0766199
716 Ga0316584_0096326
717 Ga0373925_0009515
718 Ga0395899_0430540
719 Ga0395900_0277265
720 Ga0395905_0021222
721 Ga0395905_0054367
722 Ga0395905_0457115
723 Ga0395905_0495844
724 Ga0395905_1117132
725 Ga0436364_1445408
726 Ga0395901_1212599
727 Ga0436361_0074177
728 Ga0436361_0215655
729 Ga0436361_0692684
730 Ga0436361_0842061
731 Ga0439436_0002597
732 Ga0439466_0004355
733 Ga0439465_0004610
734 Ga0439465_0106668
735 Ga0451791_1427295
736 Ga0451793_0884303
737 Ga0451795_0003073
738 Ga0451800_0861231
739 Ga0451802_1687241
740 Ga0451833_1279728
741 Ga0451839_1455947
742 Ga0451841_0657186
743 Ga0451853_1502345
744 Ga0439431_0003938
745 Ga0439431_0016515
746 Ga0439431_0249457
747 Ga0439442_001693
748 Ga0439449_0046964
749 Ga0439450_003783
750 Ga0439462_0036347
751 Ga0450921_001618
752 Ga0450923_000582
753 Ga0450888_010222
754 Ga0450894_012623
755 Ga0450894_042545
756 Ga0450896_043792
757 Ga0450899_009791
758 Ga0450899_017045
759 Ga0450906_000506
760 Ga0439446_0018417
761 Ga0439446_0057413
762 Ga0439446_0204705
763 Ga0450908_000591
764 Ga0450909_007248
765 Ga0439434_0003667
766 Ga0450918_002701
767 Ga0450893_0017716
768 Ga0451577_0893092
769 Ga0466972_0023701
770 Ga0466963_0738788
771 Ga0453684_1953042
772 Ga0466968_0084521
773 Ga0466970_0251274
774 Ga0495638_0229779
775 Ga0495582_0134208
776 Ga0495582_0292264
777 Ga0495632_0005828
778 Ga0495663_0102167
779 Ga0495642_0089616
780 Ga0495642_0132560
781 Ga0495598_0191712
782 Ga0495621_0140551
783 Ga0495633_0101122
784 Ga0495656_0049139
785 Ga0495588_0121432
786 Ga0495647_0081320
787 Ga0495658_0050308
788 Ga0495624_0786668
789 Ga0495660_0313364
790 Ga0495615_0005961
791 Ga0496100_1564614
792 Ga0496102_0673500
793 Ga0496104_1792310
794 Ga0496105_0447014
795 Ga0496112_0048047
796 Ga0496113_0110559
797 Ga0496122_0039031
798 Ga0496123_0157830
799 Ga0496124_0026598
800 Ga0496125_0003822
801 Ga0496126_0048700
802 Ga0501031_0249732
803 Ga0501074_0244676
804 Ga0501238_013266
805 Ga0501249_005623
806 Ga0501225_0249508
807 Ga0501080_0655943
808 Ga0501270_147422
809 Ga0501035_0054443
810 Ga0501044_0125265
811 nmdc:mga03683_355537_c1
812 nmdc:mga00v17_193926_c1
813 nmdc:mga00v17_479448_c1
814 nmdc:mga0k408_1174_c1
815 nmdc:mga0k408_33839_c1
816 nmdc:mga0k408_729_c1
817 nmdc:mga06z11_42458_c1
818 nmdc:mga07m45_4514_c1
819 nmdc:mga07m45_79327_c1
820 nmdc:mga05p37_1122966_c1
821 nmdc:mga09592_404914_c1
822 nmdc:mga0qj67_1122603_c1
823 nmdc:mga0qj67_429354_c1
824 nmdc:mga06r32_717248_c1
825 nmdc:mga0rr50_1892_c1
826 Ga0500635_0019526
827 Ga0500646_0053460
828 Ga0500651_0009413
829 Ga0500650_0064615
830 Ga0500562_007029
831 Ga0500623_140030
832 Ga0500642_0067417
833 Ga0500652_000771
834 Ga0500652_238908
835 Ga0500655_005628
836 Ga0500568_0112357
837 Ga0500577_0021804
838 Ga0500586_015493
839 Ga0500588_0401817
840 Ga0500622_0000890
841 Ga0500596_030340
842 2574431348
843 2587734976
844 2644164028
845 2739241762
846 2784261109
847 2816470933
848 2842678635
849 2842733903
850 2842752382
851 2842846424
852 2880231052
853 2894023833
854 2919488768
855 2919708480
856 2945909590
857 2945988428
858 2990199643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

22

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9771 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9761 1 145
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.974 1 143
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9704 1 145
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9696 1 145
ID Description Score Start End Superfamily
af_Q95Y87_1_153_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9991 10 22 3.40.140.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9771 1 145 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.974 1 143 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9734 1 144 3.50.80.10
af_O14274_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9707 1 144 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A3N7CBZ6-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9999 1 146 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A0K8NVV5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9997 1 146 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-E7RUJ3-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9993 2 145 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A7X7BFM1-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.994 1 143 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A7X6QQM4-F1-model_v4 deleted 0.9936 1 144

Map