F441866

General Info

Members Datasets Scaffolds Average Seq Length
429 221 858 143

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100747228|Ga0070704_1007472281
Length 144
Sequence MITRLNVASIYVLDKDEALDFYVNKLGLEKGNDVRQGDYRWLTIRVPGDQGATEVSLEQPGAPLHDEATAEQLRNLITKGALGGLVFVTDDARELYETLKDRGVTDFTQEPTDHFYGTDMGIRDPFGNPIRILQQGKARQKATA

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
142 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
146 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
147 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2808606372 Agromyces sp. 23-23 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.93
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 7.23
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100747228 3300005549 Bacteria 871
2 JGI25406J46586_10012295 3300003203 Bacteria 3721
3 JGI25406J46586_10017469 3300003203 Bacteria 2965
4 rootH1_10042555 3300003316 Bacteria 1253
5 rootL2_10003952 3300003322 Bacteria 4746
6 rootH1_10001222 3300003323 Bacteria 3567
7 JGI26129J50193_1002223 3300003349 Bacteria 1363
8 Ga0058863_11699385 3300004799 Bacteria 1389
9 Ga0065715_10194045 3300005293 Bacteria 1397
10 Ga0065707_10157645 3300005295 Bacteria 1583
11 Ga0070658_10515068 3300005327 Bacteria 1034
12 Ga0070683_100609528 3300005329 Bacteria 1045
13 Ga0070666_10373397 3300005335 Bacteria 1023
14 Ga0070680_100398014 3300005336 Bacteria 1174
15 Ga0070680_100827982 3300005336 Bacteria 798
16 Ga0070689_100762266 3300005340 Bacteria 849
17 Ga0070691_10324361 3300005341 Bacteria 848
18 Ga0070692_10064705 3300005345 Bacteria 1934
19 Ga0070692_10390426 3300005345 Bacteria 876
20 Ga0070675_100604287 3300005354 Bacteria 995
21 Ga0070674_101179601 3300005356 Unclassified 679
22 Ga0070667_100270638 3300005367 Bacteria 1523
23 Ga0070703_10015225 3300005406 Bacteria 2200
24 Ga0070703_10019631 3300005406 Bacteria 1960
25 Ga0070711_100812126 3300005439 Bacteria 794
26 Ga0070705_100060990 3300005440 Bacteria 2240
27 Ga0070705_100503292 3300005440 Unclassified 920
28 Ga0070700_100364398 3300005441 Bacteria 1075
29 Ga0070700_100913505 3300005441 Bacteria 716
30 Ga0070694_100093439 3300005444 Bacteria 2114
31 Ga0070694_100353170 3300005444 Bacteria 1139
32 Ga0070694_100434396 3300005444 Bacteria 1034
33 Ga0070708_100007959 3300005445 Bacteria 8491
34 Ga0070708_100028679 3300005445 Bacteria 4793
35 Ga0070708_100233814 3300005445 Bacteria 1725
36 Ga0070708_100596228 3300005445 Bacteria 1042
37 Ga0070708_100990057 3300005445 Bacteria 788
38 Ga0070678_100078161 3300005456 Bacteria 2499
39 Ga0070678_101154731 3300005456 Bacteria 717
40 Ga0070662_100359355 3300005457 Bacteria 1195
41 Ga0070662_100633942 3300005457 Bacteria 901
42 Ga0070681_10103165 3300005458 Bacteria 2796
43 Ga0068867_100523493 3300005459 Bacteria 1023
44 Ga0070706_100000306 3300005467 Bacteria 59517
45 Ga0070706_100001092 3300005467 Bacteria 29314
46 Ga0070706_100022493 3300005467 Bacteria 5802
47 Ga0070706_100085416 3300005467 Bacteria 2924
48 Ga0070706_100596284 3300005467 Bacteria 1027
49 Ga0070706_100603613 3300005467 Bacteria 1020
50 Ga0070706_101684187 3300005467 Bacteria 578
51 Ga0070707_100000777 3300005468 Bacteria 31529
52 Ga0070707_100002346 3300005468 Bacteria 18057
53 Ga0070707_100006820 3300005468 Bacteria 10577
54 Ga0070707_100020453 3300005468 Bacteria 6243
55 Ga0070707_100072443 3300005468 Bacteria 3320
56 Ga0070707_100083703 3300005468 Bacteria 3083
57 Ga0070707_100129286 3300005468 Bacteria 2455
58 Ga0070707_100195528 3300005468 Bacteria 1972
59 Ga0070707_101011857 3300005468 Unclassified 796
60 Ga0070698_100019909 3300005471 Bacteria 7038
61 Ga0070698_100025807 3300005471 Bacteria 6124
62 Ga0070698_100035777 3300005471 Bacteria 5132
63 Ga0070698_100072314 3300005471 Bacteria 3457
64 Ga0070698_100092014 3300005471 Bacteria 3014
65 Ga0070698_100559977 3300005471 Bacteria 1083
66 Ga0070698_100568479 3300005471 Bacteria 1073
67 Ga0070699_100014157 3300005518 Bacteria 6861
68 Ga0070699_100041920 3300005518 Bacteria 3960
69 Ga0070699_100242484 3300005518 Bacteria 1609
70 Ga0070699_100401115 3300005518 Bacteria 1240
71 Ga0070699_101229973 3300005518 Bacteria 687
72 Ga0070679_100080344 3300005530 Bacteria 3250
73 Ga0070684_100399183 3300005535 Bacteria 1267
74 Ga0070697_100113690 3300005536 Bacteria 2258
75 Ga0070697_100128625 3300005536 Bacteria 2123
76 Ga0070697_100131465 3300005536 Bacteria 2099
77 Ga0070697_100652683 3300005536 Bacteria 927
78 Ga0070686_100063376 3300005544 Bacteria 2394
79 Ga0070695_100016841 3300005545 Bacteria 4429
80 Ga0070695_100020773 3300005545 Bacteria 4011
81 Ga0070695_100209422 3300005545 Bacteria 1398
82 Ga0070695_100229782 3300005545 Bacteria 1341
83 Ga0070696_100001393 3300005546 Bacteria 15800
84 Ga0070696_100040516 3300005546 Bacteria 3216
85 Ga0070696_100190111 3300005546 Bacteria 1528
86 Ga0070696_100211197 3300005546 Bacteria 1453
87 Ga0070704_100065964 3300005549 Bacteria 2608
88 Ga0070704_100128012 3300005549 Bacteria 1963
89 Ga0070704_100210902 3300005549 Bacteria 1574
90 Ga0070704_100227128 3300005549 Bacteria 1521
91 Ga0070704_100269806 3300005549 Bacteria 1405
92 Ga0070664_100438612 3300005564 Bacteria 1198
93 Ga0068854_100304408 3300005578 Bacteria 1290
94 Ga0068854_100783794 3300005578 Bacteria 830
95 Ga0068856_100740733 3300005614 Bacteria 1003
96 Ga0070702_100042545 3300005615 Bacteria 2555
97 Ga0068864_100043185 3300005618 Bacteria 3859
98 Ga0068864_101202147 3300005618 Bacteria 757
99 Ga0068863_100059287 3300005841 Bacteria 3622
100 Ga0068863_100604215 3300005841 Bacteria 1086
101 Ga0068863_101667463 3300005841 Bacteria 647
102 Ga0068858_100163952 3300005842 Bacteria 2094
103 Ga0068858_100468816 3300005842 Bacteria 1215
104 Ga0068862_100402262 3300005844 Bacteria 1281
105 Ga0081455_10120962 3300005937 Bacteria 2063
106 Ga0081539_10000906 3300005985 Bacteria 56296
107 Ga0081539_10001072 3300005985 Bacteria 49973
108 Ga0081539_10005501 3300005985 Bacteria 12867
109 Ga0081539_10005653 3300005985 Bacteria 12565
110 Ga0081539_10100239 3300005985 Bacteria 1478
111 Ga0075365_10841016 3300006038 Bacteria 647
112 Ga0075365_11336213 3300006038 Bacteria 503
113 Ga0075364_11062437 3300006051 Unclassified 550
114 Ga0070712_100240850 3300006175 Bacteria 1441
115 Ga0070712_101903383 3300006175 Bacteria 521
116 Ga0097621_100210888 3300006237 Bacteria 1690
117 Ga0075428_100605959 3300006844 Bacteria 1169
118 Ga0075431_100034439 3300006847 Bacteria 5218
119 Ga0075431_101972783 3300006847 Bacteria 539
120 Ga0075433_10753432 3300006852 Bacteria 852
121 Ga0075433_11001431 3300006852 Unclassified 728
122 Ga0075434_100036839 3300006871 Bacteria 4839
123 Ga0075434_101736268 3300006871 Bacteria 632
124 Ga0075436_100491647 3300006914 Bacteria 897
125 Ga0075436_100685244 3300006914 Bacteria 759
126 Ga0075435_100294736 3300007076 Bacteria 1387
127 Ga0075435_100575386 3300007076 Bacteria 976
128 Ga0111539_10094516 3300009094 Bacteria 3512
129 Ga0111539_10522521 3300009094 Bacteria 1383
130 Ga0111539_10688623 3300009094 Bacteria 1190
131 Ga0105245_10065570 3300009098 Bacteria 3284
132 Ga0105245_10309561 3300009098 Bacteria 1553
133 Ga0105247_10170348 3300009101 Bacteria 1447
134 Ga0114129_10726931 3300009147 Unclassified 1273
135 Ga0105243_10709246 3300009148 Bacteria 982
136 Ga0105243_12212496 3300009148 Bacteria 587
137 Ga0105243_12913970 3300009148 Unclassified 519
138 Ga0105241_10345238 3300009174 Bacteria 1291
139 Ga0105241_10377775 3300009174 Bacteria 1237
140 Ga0105242_10165438 3300009176 Bacteria 1940
141 Ga0105242_11085213 3300009176 Bacteria 813
142 Ga0105248_11816472 3300009177 Bacteria 691
143 Ga0105238_10110352 3300009551 Bacteria 2731
144 Ga0105249_10333573 3300009553 Bacteria 1531
145 Ga0105249_10575998 3300009553 Bacteria 1178
146 Ga0105239_10320719 3300010375 Bacteria 1747
147 Ga0105239_10422172 3300010375 Bacteria 1511
148 Ga0105239_10453885 3300010375 Bacteria 1454
149 Ga0105246_10400483 3300011119 Bacteria 1140
150 Ga0105246_10983747 3300011119 Bacteria 763
151 Ga0157371_10355463 3300013102 Bacteria 1067
152 Ga0157378_10010824 3300013297 Bacteria 7975
153 Ga0157378_11693674 3300013297 Bacteria 679
154 Ga0163162_10343422 3300013306 Bacteria 1625
155 Ga0163162_10349263 3300013306 Bacteria 1612
156 Ga0157372_10275817 3300013307 Bacteria 1954
157 Ga0157372_10487782 3300013307 Bacteria 1437
158 Ga0157375_10443424 3300013308 Bacteria 1464
159 Ga0157375_10904026 3300013308 Bacteria 1027
160 Ga0157375_10987891 3300013308 Bacteria 982
161 Ga0157375_11155061 3300013308 Bacteria 907
162 Ga0163163_10008821 3300014325 Bacteria 8975
163 Ga0163163_10129593 3300014325 Bacteria 2562
164 Ga0163163_10491635 3300014325 Bacteria 1288
165 Ga0157380_10865722 3300014326 Bacteria 927
166 Ga0157380_11177406 3300014326 Bacteria 809
167 Ga0157380_11918885 3300014326 Bacteria 653
168 Ga0157377_11689035 3300014745 Bacteria 510
169 Ga0157379_10035184 3300014968 Bacteria 4465
170 Ga0157379_10260354 3300014968 Unclassified 1576
171 Ga0157379_11180774 3300014968 Bacteria 735
172 Ga0157376_11299039 3300014969 Bacteria 757
173 Ga0163161_10062424 3300017792 Bacteria 2715
174 Ga0206356_10743548 3300020070 Bacteria 688
175 Ga0206352_10305167 3300020078 Bacteria 716
176 Ga0207653_10000386 3300025885 Bacteria 20016
177 Ga0207653_10103220 3300025885 Bacteria 1011
178 Ga0207680_10144359 3300025903 Bacteria 1581
179 Ga0207699_10082176 3300025906 Bacteria 2001
180 Ga0207643_10670072 3300025908 Bacteria 670
181 Ga0207684_10000022 3300025910 Bacteria 337007
182 Ga0207684_10000418 3300025910 Bacteria 56722
183 Ga0207684_10026431 3300025910 Bacteria 4948
184 Ga0207684_10468172 3300025910 Bacteria 1081
185 Ga0207684_10883342 3300025910 Bacteria 752
186 Ga0207707_10191260 3300025912 Bacteria 1785
187 Ga0207707_10193745 3300025912 Bacteria 1773
188 Ga0207707_10741525 3300025912 Bacteria 822
189 Ga0207693_10273124 3300025915 Bacteria 1325
190 Ga0207663_10128669 3300025916 Bacteria 1746
191 Ga0207662_10013172 3300025918 Bacteria 4621
192 Ga0207657_10578997 3300025919 Bacteria 877
193 Ga0207646_10000431 3300025922 Bacteria 55919
194 Ga0207646_10006379 3300025922 Bacteria 12197
195 Ga0207646_10010886 3300025922 Bacteria 8838
196 Ga0207646_10094006 3300025922 Bacteria 2685
197 Ga0207646_10100734 3300025922 Bacteria 2589
198 Ga0207646_10142198 3300025922 Bacteria 2162
199 Ga0207646_10368625 3300025922 Bacteria 1297
200 Ga0207681_11336730 3300025923 Bacteria 602
201 Ga0207694_10072492 3300025924 Bacteria 2693
202 Ga0207687_10101792 3300025927 Bacteria 2115
203 Ga0207687_10229344 3300025927 Bacteria 1466
204 Ga0207687_10335321 3300025927 Bacteria 1228
205 Ga0207706_10282152 3300025933 Bacteria 1448
206 Ga0207706_10308271 3300025933 Bacteria 1379
207 Ga0207706_11332073 3300025933 Bacteria 592
208 Ga0207686_10302467 3300025934 Bacteria 1188
209 Ga0207686_10766587 3300025934 Bacteria 771
210 Ga0207670_11110800 3300025936 Unclassified 668
211 Ga0207669_10350968 3300025937 Bacteria 1140
212 Ga0207669_11474749 3300025937 Unclassified 580
213 Ga0207689_10047782 3300025942 Bacteria 3531
214 Ga0207661_10733929 3300025944 Bacteria 909
215 Ga0207712_12134998 3300025961 Bacteria 501
216 Ga0207668_10286834 3300025972 Bacteria 1353
217 Ga0207640_10704089 3300025981 Bacteria 866
218 Ga0207658_10477053 3300025986 Bacteria 1108
219 Ga0207678_10636242 3300026067 Bacteria 937
220 Ga0207678_10982793 3300026067 Bacteria 747
221 Ga0207708_10170213 3300026075 Bacteria 1725
222 Ga0207708_10841720 3300026075 Bacteria 792
223 Ga0207702_10624165 3300026078 Bacteria 1059
224 Ga0207641_10404292 3300026088 Bacteria 1312
225 Ga0207648_10475769 3300026089 Bacteria 1140
226 Ga0207648_11094027 3300026089 Unclassified 747
227 Ga0207676_10006335 3300026095 Bacteria 8358
228 Ga0207676_10297212 3300026095 Bacteria 1473
229 Ga0207676_11432961 3300026095 Bacteria 687
230 Ga0207674_11219094 3300026116 Bacteria 722
231 Ga0207683_10112973 3300026121 Bacteria 2433
232 Ga0210000_1013109 3300027462 Bacteria 1236
233 Ga0209999_1057696 3300027543 Bacteria 737
234 Ga0209970_1006456 3300027614 Bacteria 1924
235 Ga0210002_1008820 3300027617 Bacteria 1538
236 Ga0209983_1024042 3300027665 Bacteria 1281
237 Ga0209971_1007405 3300027682 Bacteria 2605
238 Ga0209998_10000414 3300027717 Bacteria 12127
239 Ga0209998_10036793 3300027717 Bacteria 1100
240 Ga0209974_10000763 3300027876 Bacteria 10995
241 Ga0209974_10047671 3300027876 Bacteria 1436
242 Ga0307413_10177776 3300031824 Bacteria 1514
243 Ga0307413_10403037 3300031824 Bacteria 1072
244 Ga0307410_11108447 3300031852 Bacteria 686
245 Ga0307412_10297327 3300031911 Bacteria 1274
246 Ga0307409_100455496 3300031995 Bacteria 1236
247 Ga0307416_100001121 3300032002 Bacteria 14392
248 Ga0307416_100834546 3300032002 Bacteria 1019
249 Ga0307415_100015885 3300032126 Bacteria 4471
250 Ga0307415_100018976 3300032126 Bacteria 4166
251 Ga0373937_1401702 3300036401 Bacteria 647
252 Ga0395905_0187996 3300037471 Bacteria 1938
253 Ga0395905_0988014 3300037471 Bacteria 745
254 Ga0395901_0128991 3300038443 Bacteria 2658
255 Ga0395901_0595877 3300038443 Bacteria 1115
256 Ga0451791_0038141 3300041451 Bacteria 656
257 Ga0451797_0478184 3300041453 Bacteria 1082
258 Ga0451800_0009593 3300041459 Bacteria 571
259 Ga0451802_0173960 3300041460 Bacteria 585
260 Ga0451802_1226992 3300041460 Unclassified 785
261 Ga0451804_0414899 3300041463 Unclassified 511
262 Ga0451807_2556343 3300041486 Unclassified 566
263 Ga0451833_0029401 3300041491 Bacteria 915
264 Ga0451845_0219526 3300041501 Bacteria 609
265 Ga0451847_0721294 3300041503 Bacteria 971
266 Ga0451853_2953755 3300041512 Bacteria 5150
267 Ga0451853_3395280 3300041512 Bacteria 543
268 Ga0439441_008962 3300042001 Bacteria 1646
269 Ga0439450_044200 3300042008 Bacteria 1043
270 Ga0450888_003683 3300042126 Bacteria 1567
271 Ga0450910_000682 3300042147 Bacteria 4073
272 Ga0439460_0035655 3300042461 Bacteria 1440
273 Ga0451577_0008034 3300042876 Bacteria 10300
274 Ga0466964_0443570 3300044706 Bacteria 687
275 Ga0453684_0182203 3300044712 Bacteria 2465
276 Ga0466960_0445763 3300044901 Bacteria 752
277 Ga0466967_0193525 3300045976 Bacteria 1923
278 Ga0495631_0418060 3300046518 Bacteria 571
279 Ga0495661_0487671 3300046665 Bacteria 589
280 Ga0495670_0232874 3300046691 Bacteria 980
281 Ga0495676_0605582 3300047321 Bacteria 713
282 Ga0496100_0117833 3300048903 Bacteria 1854
283 Ga0496101_0036169 3300048904 Bacteria 3497
284 Ga0496101_1112846 3300048904 Bacteria 620
285 Ga0496102_0002886 3300048905 Bacteria 14573
286 Ga0496102_0364986 3300048905 Bacteria 1359
287 Ga0496103_0017296 3300048906 Bacteria 4314
288 Ga0496106_0171395 3300048909 Bacteria 1720
289 Ga0496106_0727692 3300048909 Bacteria 790
290 Ga0496107_0335245 3300048910 Bacteria 1125
291 Ga0496108_0080472 3300048911 Bacteria 2760
292 Ga0496108_0510511 3300048911 Bacteria 1050
293 Ga0496109_0013990 3300048912 Bacteria 6975
294 Ga0496109_0972578 3300048912 Bacteria 787
295 Ga0496110_0051918 3300048913 Bacteria 3603
296 Ga0496110_0602256 3300048913 Bacteria 997
297 Ga0496110_1207033 3300048913 Bacteria 665
298 Ga0496112_0186609 3300048915 Bacteria 2037
299 Ga0496112_0929709 3300048915 Bacteria 791
300 Ga0496112_1327284 3300048915 Bacteria 635
301 Ga0496113_0263493 3300048916 Bacteria 1377
302 Ga0496114_0009444 3300048917 Bacteria 7744
303 Ga0496114_0152537 3300048917 Bacteria 2005
304 Ga0496114_0640148 3300048917 Bacteria 936
305 Ga0496115_0405350 3300048918 Bacteria 1106
306 Ga0501031_0256016 3300049568 Bacteria 1137
307 Ga0501031_0527871 3300049568 Bacteria 761
308 Ga0501032_0023585 3300049569 Bacteria 4247
309 Ga0501032_0469907 3300049569 Bacteria 805
310 Ga0501033_0009759 3300049570 Bacteria 7374
311 Ga0501034_0011803 3300049571 Bacteria 9040
312 Ga0501036_0030523 3300049572 Bacteria 4552
313 Ga0501036_0036854 3300049572 Bacteria 4137
314 Ga0501036_0250974 3300049572 Bacteria 1483
315 Ga0501036_0269175 3300049572 Bacteria 1426
316 Ga0501037_0030712 3300049573 Bacteria 3969
317 Ga0501037_0033317 3300049573 Bacteria 3805
318 Ga0501038_0026382 3300049574 Bacteria 5174
319 Ga0501038_0101978 3300049574 Bacteria 2389
320 Ga0501038_0254019 3300049574 Bacteria 1391
321 Ga0501039_0012094 3300049575 Bacteria 6581
322 Ga0501039_0029956 3300049575 Bacteria 4193
323 Ga0501039_0169948 3300049575 Bacteria 1714
324 Ga0501039_0249384 3300049575 Bacteria 1396
325 Ga0501039_0270061 3300049575 Archaea 1337
326 Ga0501040_0011911 3300049576 Bacteria 5689
327 Ga0501040_0019965 3300049576 Bacteria 4461
328 Ga0501041_0112732 3300049577 Bacteria 1687
329 Ga0501041_0260251 3300049577 Bacteria 1091
330 Ga0501042_0032948 3300049578 Bacteria 3671
331 Ga0501042_0124311 3300049578 Bacteria 1857
332 Ga0501042_0152774 3300049578 Bacteria 1665
333 Ga0501043_0063393 3300049579 Bacteria 2902
334 Ga0501043_0072799 3300049579 Bacteria 2699
335 Ga0501046_0004534 3300049580 Bacteria 12584
336 Ga0501046_0025351 3300049580 Bacteria 4853
337 Ga0501046_0294526 3300049580 Bacteria 1186
338 Ga0501047_0064009 3300049581 Bacteria 3547
339 Ga0501048_0023641 3300049582 Bacteria 4490
340 Ga0501048_0114658 3300049582 Bacteria 1903
341 Ga0501048_0138351 3300049582 Bacteria 1721
342 Ga0501067_0007514 3300049583 Bacteria 6056
343 Ga0501067_0087518 3300049583 Bacteria 1728
344 Ga0501067_0120178 3300049583 Bacteria 1462
345 Ga0501067_0807219 3300049583 Bacteria 529
346 Ga0501068_0002612 3300049584 Bacteria 9541
347 Ga0501068_0029346 3300049584 Bacteria 3256
348 Ga0501069_0002272 3300049585 Bacteria 9708
349 Ga0501069_0009187 3300049585 Bacteria 5217
350 Ga0501069_0019483 3300049585 Bacteria 3670
351 Ga0501069_0255740 3300049585 Bacteria 1022
352 Ga0501070_0132786 3300049586 Bacteria 2056
353 Ga0501070_0160990 3300049586 Bacteria 1850
354 Ga0501070_0161307 3300049586 Bacteria 1848
355 Ga0501070_1182114 3300049586 Archaea 587
356 Ga0501071_0011178 3300049587 Bacteria 6038
357 Ga0501071_0050998 3300049587 Bacteria 2981
358 Ga0501071_0103057 3300049587 Bacteria 2105
359 Ga0501071_0447809 3300049587 Bacteria 988
360 Ga0501072_0010337 3300049588 Bacteria 7110
361 Ga0501072_0182820 3300049588 Bacteria 1672
362 Ga0501072_0802383 3300049588 Bacteria 737
363 Ga0501073_0179765 3300049589 Bacteria 1464
364 Ga0501074_0020996 3300049590 Bacteria 4742
365 Ga0501074_0058562 3300049590 Bacteria 2776
366 Ga0501074_0794273 3300049590 Bacteria 667
367 Ga0501075_0028583 3300049591 Bacteria 4116
368 Ga0501075_0031922 3300049591 Bacteria 3912
369 Ga0501075_0096944 3300049591 Bacteria 2238
370 Ga0501076_0004311 3300049592 Bacteria 10094
371 Ga0501076_0014395 3300049592 Bacteria 5957
372 Ga0501076_0048211 3300049592 Bacteria 3368
373 Ga0501076_0416040 3300049592 Bacteria 1106
374 Ga0501077_0017291 3300049593 Bacteria 4548
375 Ga0501077_0064467 3300049593 Bacteria 2324
376 Ga0501079_0044706 3300049741 Bacteria 3417
377 Ga0501079_0071289 3300049741 Bacteria 2684
378 Ga0501079_0164461 3300049741 Bacteria 1730
379 Ga0501080_0014904 3300049742 Bacteria 7157
380 Ga0501080_0037503 3300049742 Bacteria 4528
381 Ga0501080_0306779 3300049742 Bacteria 1439
382 Ga0501081_0018778 3300049743 Bacteria 4592
383 Ga0501081_0090259 3300049743 Bacteria 2154
384 Ga0501081_0859224 3300049743 Bacteria 683
385 Ga0501083_0078728 3300049744 Bacteria 2186
386 Ga0501035_0212307 3300049822 Bacteria 1655
387 Ga0501035_0604169 3300049822 Bacteria 893
388 Ga0501044_0073403 3300049823 Bacteria 3477
389 Ga0501044_0091242 3300049823 Bacteria 3073
390 Ga0501045_0007496 3300049824 Bacteria 7579
391 Ga0501045_0066148 3300049824 Bacteria 2654
392 Ga0501045_0084117 3300049824 Bacteria 2347
393 Ga0501045_0289750 3300049824 Archaea 1218
394 Ga0501045_0538645 3300049824 Bacteria 866
395 Ga0501045_0626909 3300049824 Bacteria 795
396 nmdc:mga00v17_661132_c1 3300050491 Unclassified 671
397 nmdc:mga0yw44_791691_c1 3300050492 Bacteria 644
398 nmdc:mga09592_559003_c1 3300050508 Unclassified 982
399 nmdc:mga0qj67_754814_c1 3300050509 Unclassified 772
400 nmdc:mga06r32_54788_c1 3300050510 Bacteria 3824
401 nmdc:mga08y16_1185723_c1 3300050511 Bacteria 735
402 nmdc:mga08y16_510125_c1 3300050511 Unclassified 1221
403 nmdc:mga08y16_887589_c1 3300050511 Bacteria 878
404 nmdc:mga0n895_23595_c1 3300050512 Bacteria 5784
405 nmdc:mga0n895_446561_c1 3300050512 Bacteria 1306
406 nmdc:mga0rr50_19477_c1 3300050513 Bacteria 4582
407 nmdc:mga0rr50_329985_c1 3300050513 Bacteria 1280
408 nmdc:mga0rr50_557014_c1 3300050513 Bacteria 976
409 nmdc:mga0rr50_96761_c1 3300050513 Bacteria 2310
410 nmdc:mga08x19_387672_c1 3300050514 Bacteria 979
411 nmdc:mga08x19_442745_c1 3300050514 Bacteria 914
412 nmdc:mga0a205_1039661_c1 3300050515 Bacteria 666
413 nmdc:mga0a205_238585_c1 3300050515 Bacteria 1699
414 Ga0501084_0040505 3300054114 Bacteria 3898
415 Ga0501084_0074674 3300054114 Bacteria 2839
416 Ga0501084_0240715 3300054114 Unclassified 1527
417 Ga0501084_0252644 3300054114 Bacteria 1488
418 Ga0590071_031434 3300059421 Bacteria 1265
419 Ga0590074_006344 3300059423 Bacteria 1963
420 Ga0590075_037719 3300059424 Bacteria 1232
421 Ga0587083_0188982 3300059505 Bacteria 581
422 Ga0501082_0036230 3300060353 Bacteria 4250
423 Ga0501082_0082915 3300060353 Bacteria 2766
424 Ga0530510_0012402 3300061734 Bacteria 5988
425 Ga0530510_0012719 3300061734 Bacteria 5916
426 Ga0530510_0037472 3300061734 Bacteria 3497
427 Ga0530510_0094895 3300061734 Bacteria 2179
428 Ga0530510_0111884 3300061734 Bacteria 2000
429 2808903715 2808606372 Bacteria 4649509
430 Ga0070704_100747228
431 JGI25406J46586_10012295
432 JGI25406J46586_10017469
433 rootH1_10042555
434 rootL2_10003952
435 rootH1_10001222
436 JGI26129J50193_1002223
437 Ga0058863_11699385
438 Ga0065715_10194045
439 Ga0065707_10157645
440 Ga0070658_10515068
441 Ga0070683_100609528
442 Ga0070666_10373397
443 Ga0070680_100398014
444 Ga0070680_100827982
445 Ga0070689_100762266
446 Ga0070691_10324361
447 Ga0070692_10064705
448 Ga0070692_10390426
449 Ga0070675_100604287
450 Ga0070674_101179601
451 Ga0070667_100270638
452 Ga0070703_10015225
453 Ga0070703_10019631
454 Ga0070711_100812126
455 Ga0070705_100060990
456 Ga0070705_100503292
457 Ga0070700_100364398
458 Ga0070700_100913505
459 Ga0070694_100093439
460 Ga0070694_100353170
461 Ga0070694_100434396
462 Ga0070708_100007959
463 Ga0070708_100028679
464 Ga0070708_100233814
465 Ga0070708_100596228
466 Ga0070708_100990057
467 Ga0070678_100078161
468 Ga0070678_101154731
469 Ga0070662_100359355
470 Ga0070662_100633942
471 Ga0070681_10103165
472 Ga0068867_100523493
473 Ga0070706_100000306
474 Ga0070706_100001092
475 Ga0070706_100022493
476 Ga0070706_100085416
477 Ga0070706_100596284
478 Ga0070706_100603613
479 Ga0070706_101684187
480 Ga0070707_100000777
481 Ga0070707_100002346
482 Ga0070707_100006820
483 Ga0070707_100020453
484 Ga0070707_100072443
485 Ga0070707_100083703
486 Ga0070707_100129286
487 Ga0070707_100195528
488 Ga0070707_101011857
489 Ga0070698_100019909
490 Ga0070698_100025807
491 Ga0070698_100035777
492 Ga0070698_100072314
493 Ga0070698_100092014
494 Ga0070698_100559977
495 Ga0070698_100568479
496 Ga0070699_100014157
497 Ga0070699_100041920
498 Ga0070699_100242484
499 Ga0070699_100401115
500 Ga0070699_101229973
501 Ga0070679_100080344
502 Ga0070684_100399183
503 Ga0070697_100113690
504 Ga0070697_100128625
505 Ga0070697_100131465
506 Ga0070697_100652683
507 Ga0070686_100063376
508 Ga0070695_100016841
509 Ga0070695_100020773
510 Ga0070695_100209422
511 Ga0070695_100229782
512 Ga0070696_100001393
513 Ga0070696_100040516
514 Ga0070696_100190111
515 Ga0070696_100211197
516 Ga0070704_100065964
517 Ga0070704_100128012
518 Ga0070704_100210902
519 Ga0070704_100227128
520 Ga0070704_100269806
521 Ga0070664_100438612
522 Ga0068854_100304408
523 Ga0068854_100783794
524 Ga0068856_100740733
525 Ga0070702_100042545
526 Ga0068864_100043185
527 Ga0068864_101202147
528 Ga0068863_100059287
529 Ga0068863_100604215
530 Ga0068863_101667463
531 Ga0068858_100163952
532 Ga0068858_100468816
533 Ga0068862_100402262
534 Ga0081455_10120962
535 Ga0081539_10000906
536 Ga0081539_10001072
537 Ga0081539_10005501
538 Ga0081539_10005653
539 Ga0081539_10100239
540 Ga0075365_10841016
541 Ga0075365_11336213
542 Ga0075364_11062437
543 Ga0070712_100240850
544 Ga0070712_101903383
545 Ga0097621_100210888
546 Ga0075428_100605959
547 Ga0075431_100034439
548 Ga0075431_101972783
549 Ga0075433_10753432
550 Ga0075433_11001431
551 Ga0075434_100036839
552 Ga0075434_101736268
553 Ga0075436_100491647
554 Ga0075436_100685244
555 Ga0075435_100294736
556 Ga0075435_100575386
557 Ga0111539_10094516
558 Ga0111539_10522521
559 Ga0111539_10688623
560 Ga0105245_10065570
561 Ga0105245_10309561
562 Ga0105247_10170348
563 Ga0114129_10726931
564 Ga0105243_10709246
565 Ga0105243_12212496
566 Ga0105243_12913970
567 Ga0105241_10345238
568 Ga0105241_10377775
569 Ga0105242_10165438
570 Ga0105242_11085213
571 Ga0105248_11816472
572 Ga0105238_10110352
573 Ga0105249_10333573
574 Ga0105249_10575998
575 Ga0105239_10320719
576 Ga0105239_10422172
577 Ga0105239_10453885
578 Ga0105246_10400483
579 Ga0105246_10983747
580 Ga0157371_10355463
581 Ga0157378_10010824
582 Ga0157378_11693674
583 Ga0163162_10343422
584 Ga0163162_10349263
585 Ga0157372_10275817
586 Ga0157372_10487782
587 Ga0157375_10443424
588 Ga0157375_10904026
589 Ga0157375_10987891
590 Ga0157375_11155061
591 Ga0163163_10008821
592 Ga0163163_10129593
593 Ga0163163_10491635
594 Ga0157380_10865722
595 Ga0157380_11177406
596 Ga0157380_11918885
597 Ga0157377_11689035
598 Ga0157379_10035184
599 Ga0157379_10260354
600 Ga0157379_11180774
601 Ga0157376_11299039
602 Ga0163161_10062424
603 Ga0206356_10743548
604 Ga0206352_10305167
605 Ga0207653_10000386
606 Ga0207653_10103220
607 Ga0207680_10144359
608 Ga0207699_10082176
609 Ga0207643_10670072
610 Ga0207684_10000022
611 Ga0207684_10000418
612 Ga0207684_10026431
613 Ga0207684_10468172
614 Ga0207684_10883342
615 Ga0207707_10191260
616 Ga0207707_10193745
617 Ga0207707_10741525
618 Ga0207693_10273124
619 Ga0207663_10128669
620 Ga0207662_10013172
621 Ga0207657_10578997
622 Ga0207646_10000431
623 Ga0207646_10006379
624 Ga0207646_10010886
625 Ga0207646_10094006
626 Ga0207646_10100734
627 Ga0207646_10142198
628 Ga0207646_10368625
629 Ga0207681_11336730
630 Ga0207694_10072492
631 Ga0207687_10101792
632 Ga0207687_10229344
633 Ga0207687_10335321
634 Ga0207706_10282152
635 Ga0207706_10308271
636 Ga0207706_11332073
637 Ga0207686_10302467
638 Ga0207686_10766587
639 Ga0207670_11110800
640 Ga0207669_10350968
641 Ga0207669_11474749
642 Ga0207689_10047782
643 Ga0207661_10733929
644 Ga0207712_12134998
645 Ga0207668_10286834
646 Ga0207640_10704089
647 Ga0207658_10477053
648 Ga0207678_10636242
649 Ga0207678_10982793
650 Ga0207708_10170213
651 Ga0207708_10841720
652 Ga0207702_10624165
653 Ga0207641_10404292
654 Ga0207648_10475769
655 Ga0207648_11094027
656 Ga0207676_10006335
657 Ga0207676_10297212
658 Ga0207676_11432961
659 Ga0207674_11219094
660 Ga0207683_10112973
661 Ga0210000_1013109
662 Ga0209999_1057696
663 Ga0209970_1006456
664 Ga0210002_1008820
665 Ga0209983_1024042
666 Ga0209971_1007405
667 Ga0209998_10000414
668 Ga0209998_10036793
669 Ga0209974_10000763
670 Ga0209974_10047671
671 Ga0307413_10177776
672 Ga0307413_10403037
673 Ga0307410_11108447
674 Ga0307412_10297327
675 Ga0307409_100455496
676 Ga0307416_100001121
677 Ga0307416_100834546
678 Ga0307415_100015885
679 Ga0307415_100018976
680 Ga0373937_1401702
681 Ga0395905_0187996
682 Ga0395905_0988014
683 Ga0395901_0128991
684 Ga0395901_0595877
685 Ga0451791_0038141
686 Ga0451797_0478184
687 Ga0451800_0009593
688 Ga0451802_0173960
689 Ga0451802_1226992
690 Ga0451804_0414899
691 Ga0451807_2556343
692 Ga0451833_0029401
693 Ga0451845_0219526
694 Ga0451847_0721294
695 Ga0451853_2953755
696 Ga0451853_3395280
697 Ga0439441_008962
698 Ga0439450_044200
699 Ga0450888_003683
700 Ga0450910_000682
701 Ga0439460_0035655
702 Ga0451577_0008034
703 Ga0466964_0443570
704 Ga0453684_0182203
705 Ga0466960_0445763
706 Ga0466967_0193525
707 Ga0495631_0418060
708 Ga0495661_0487671
709 Ga0495670_0232874
710 Ga0495676_0605582
711 Ga0496100_0117833
712 Ga0496101_0036169
713 Ga0496101_1112846
714 Ga0496102_0002886
715 Ga0496102_0364986
716 Ga0496103_0017296
717 Ga0496106_0171395
718 Ga0496106_0727692
719 Ga0496107_0335245
720 Ga0496108_0080472
721 Ga0496108_0510511
722 Ga0496109_0013990
723 Ga0496109_0972578
724 Ga0496110_0051918
725 Ga0496110_0602256
726 Ga0496110_1207033
727 Ga0496112_0186609
728 Ga0496112_0929709
729 Ga0496112_1327284
730 Ga0496113_0263493
731 Ga0496114_0009444
732 Ga0496114_0152537
733 Ga0496114_0640148
734 Ga0496115_0405350
735 Ga0501031_0256016
736 Ga0501031_0527871
737 Ga0501032_0023585
738 Ga0501032_0469907
739 Ga0501033_0009759
740 Ga0501034_0011803
741 Ga0501036_0030523
742 Ga0501036_0036854
743 Ga0501036_0250974
744 Ga0501036_0269175
745 Ga0501037_0030712
746 Ga0501037_0033317
747 Ga0501038_0026382
748 Ga0501038_0101978
749 Ga0501038_0254019
750 Ga0501039_0012094
751 Ga0501039_0029956
752 Ga0501039_0169948
753 Ga0501039_0249384
754 Ga0501039_0270061
755 Ga0501040_0011911
756 Ga0501040_0019965
757 Ga0501041_0112732
758 Ga0501041_0260251
759 Ga0501042_0032948
760 Ga0501042_0124311
761 Ga0501042_0152774
762 Ga0501043_0063393
763 Ga0501043_0072799
764 Ga0501046_0004534
765 Ga0501046_0025351
766 Ga0501046_0294526
767 Ga0501047_0064009
768 Ga0501048_0023641
769 Ga0501048_0114658
770 Ga0501048_0138351
771 Ga0501067_0007514
772 Ga0501067_0087518
773 Ga0501067_0120178
774 Ga0501067_0807219
775 Ga0501068_0002612
776 Ga0501068_0029346
777 Ga0501069_0002272
778 Ga0501069_0009187
779 Ga0501069_0019483
780 Ga0501069_0255740
781 Ga0501070_0132786
782 Ga0501070_0160990
783 Ga0501070_0161307
784 Ga0501070_1182114
785 Ga0501071_0011178
786 Ga0501071_0050998
787 Ga0501071_0103057
788 Ga0501071_0447809
789 Ga0501072_0010337
790 Ga0501072_0182820
791 Ga0501072_0802383
792 Ga0501073_0179765
793 Ga0501074_0020996
794 Ga0501074_0058562
795 Ga0501074_0794273
796 Ga0501075_0028583
797 Ga0501075_0031922
798 Ga0501075_0096944
799 Ga0501076_0004311
800 Ga0501076_0014395
801 Ga0501076_0048211
802 Ga0501076_0416040
803 Ga0501077_0017291
804 Ga0501077_0064467
805 Ga0501079_0044706
806 Ga0501079_0071289
807 Ga0501079_0164461
808 Ga0501080_0014904
809 Ga0501080_0037503
810 Ga0501080_0306779
811 Ga0501081_0018778
812 Ga0501081_0090259
813 Ga0501081_0859224
814 Ga0501083_0078728
815 Ga0501035_0212307
816 Ga0501035_0604169
817 Ga0501044_0073403
818 Ga0501044_0091242
819 Ga0501045_0007496
820 Ga0501045_0066148
821 Ga0501045_0084117
822 Ga0501045_0289750
823 Ga0501045_0538645
824 Ga0501045_0626909
825 nmdc:mga00v17_661132_c1
826 nmdc:mga0yw44_791691_c1
827 nmdc:mga09592_559003_c1
828 nmdc:mga0qj67_754814_c1
829 nmdc:mga06r32_54788_c1
830 nmdc:mga08y16_1185723_c1
831 nmdc:mga08y16_510125_c1
832 nmdc:mga08y16_887589_c1
833 nmdc:mga0n895_23595_c1
834 nmdc:mga0n895_446561_c1
835 nmdc:mga0rr50_19477_c1
836 nmdc:mga0rr50_329985_c1
837 nmdc:mga0rr50_557014_c1
838 nmdc:mga0rr50_96761_c1
839 nmdc:mga08x19_387672_c1
840 nmdc:mga08x19_442745_c1
841 nmdc:mga0a205_1039661_c1
842 nmdc:mga0a205_238585_c1
843 Ga0501084_0040505
844 Ga0501084_0074674
845 Ga0501084_0240715
846 Ga0501084_0252644
847 Ga0590071_031434
848 Ga0590074_006344
849 Ga0590075_037719
850 Ga0587083_0188982
851 Ga0501082_0036230
852 Ga0501082_0082915
853 Ga0530510_0012402
854 Ga0530510_0012719
855 Ga0530510_0037472
856 Ga0530510_0094895
857 Ga0530510_0111884
858 2808903715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

132

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9082 2 134
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9023 1 134
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8989 1 133
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.896 1 134
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8893 2 134
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9086 81 133 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8925 81 133 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8746 83 135 3.30.720.110
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8442 4 133 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.843 1 135 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3T1B438-F1-model_v4 Lyase 0.9772 1 135 GO:0016829
AF-A0A3T1B438-F1-model_v4 Lyase 0.97 1 135 GO:0016829
AF-F6EKA7-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9603 1 136 GO:0051213
AF-A0A839RTB5-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9583 1 136 GO:0016829
GO:0051213
AF-A0A7D3ZZD7-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9558 1 135 GO:0051213

Map