F441523

General Info

Members Datasets Scaffolds Average Seq Length
427 253 426 137

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0017315|Ga0495583_0017315_999_1505
Length 168
Sequence MEVAAARSRRRTRTLKQVQGAVGLGGKDAIARTMPSLSDLHDEYEFLDADDRYRLLIDLGRTLEPMPEALKTDATLVRGCSASVWVYPTVRDDGALHFLADSNAAITKGIIALVLLTVQDRQPADILATDIEAALAPFDLRNQLSSNRTQGIPNMIALIKATAERYAG

Samples

Sample ID Description Type Environment
1 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
74 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
190 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
230 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
231 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
232 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
233 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
237 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
248 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
249 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
253 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.94
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 4.92
Rhizosphere 81.26
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1041488 3300001904 Bacteria 707
2 JGI24741J21665_1000978 3300001915 Bacteria 8581
3 JGI24741J21665_1006510 3300001915 Bacteria 2341
4 JGI24741J21665_1008203 3300001915 Bacteria 1982
5 JGI24740J21852_10029863 3300001979 Bacteria 1783
6 JGI24737J22298_10013770 3300001990 Bacteria 2630
7 JGI24735J21928_10131461 3300002067 Bacteria 721
8 JGI24749J21850_1000020 3300002076 Bacteria 31050
9 JGI24744J21845_10039723 3300002077 Bacteria 882
10 JGI24034J26672_10017695 3300002239 Bacteria 1104
11 JGI24751J29686_10000177 3300002459 Bacteria 29687
12 JGI25153J46596_10000006 3300003215 Bacteria 447760
13 Ga0055525_1000051 3300003759 Bacteria 240942
14 Ga0055542_1000020 3300003762 Bacteria 335745
15 Ga0055529_1000016 3300003763 Bacteria 364775
16 Ga0065707_10111756 3300005295 Bacteria 2384
17 Ga0070658_10000029 3300005327 Bacteria 156910
18 Ga0070658_10000077 3300005327 Bacteria 94332
19 Ga0070658_10099945 3300005327 Bacteria 2397
20 Ga0070676_10747240 3300005328 Bacteria 718
21 Ga0070676_11070766 3300005328 Bacteria 608
22 Ga0070690_100463110 3300005330 Bacteria 942
23 Ga0070670_100000008 3300005331 Bacteria 292132
24 Ga0070670_100000570 3300005331 Bacteria 29190
25 Ga0070670_100234409 3300005331 Bacteria 1597
26 Ga0070670_100332690 3300005331 Bacteria 1332
27 Ga0068869_100086685 3300005334 Bacteria 2347
28 Ga0070666_11302078 3300005335 Bacteria 542
29 Ga0070660_100185490 3300005339 Bacteria 1684
30 Ga0070660_100411622 3300005339 Bacteria 1119
31 Ga0070661_100001114 3300005344 Bacteria 18878
32 Ga0070661_100155532 3300005344 Bacteria 1730
33 Ga0070661_100236916 3300005344 Bacteria 1404
34 Ga0070668_100000001 3300005347 Bacteria 275905
35 Ga0070668_100009825 3300005347 Bacteria 7089
36 Ga0070668_100739499 3300005347 Bacteria 870
37 Ga0070669_100000240 3300005353 Bacteria 45481
38 Ga0070669_100022464 3300005353 Bacteria 4510
39 Ga0070669_100145210 3300005353 Bacteria 1833
40 Ga0070669_100726683 3300005353 Bacteria 840
41 Ga0070675_100167969 3300005354 Bacteria 1890
42 Ga0070675_101643082 3300005354 Bacteria 593
43 Ga0070671_100000167 3300005355 Bacteria 43269
44 Ga0070671_100017555 3300005355 Bacteria 5798
45 Ga0070671_100067759 3300005355 Bacteria 2976
46 Ga0070671_100376537 3300005355 Bacteria 1213
47 Ga0070674_100000284 3300005356 Bacteria 24799
48 Ga0070674_100201632 3300005356 Bacteria 1537
49 Ga0070673_100123619 3300005364 Bacteria 2162
50 Ga0070673_100300608 3300005364 Bacteria 1413
51 Ga0070659_100111827 3300005366 Bacteria 2205
52 Ga0070659_100208666 3300005366 Bacteria 1609
53 Ga0070659_100247460 3300005366 Bacteria 1477
54 Ga0070667_100000006 3300005367 Bacteria 336732
55 Ga0070667_100001022 3300005367 Bacteria 25550
56 Ga0070667_100212696 3300005367 Bacteria 1719
57 Ga0070663_100063589 3300005455 Bacteria 2665
58 Ga0070678_100000043 3300005456 Bacteria 43023
59 Ga0070662_100075342 3300005457 Bacteria 2498
60 Ga0068867_100054692 3300005459 Bacteria 2949
61 Ga0070684_100354800 3300005535 Bacteria 1349
62 Ga0068853_100141494 3300005539 Bacteria 2160
63 Ga0068853_100183689 3300005539 Bacteria 1897
64 Ga0070665_100000535 3300005548 Bacteria 53560
65 Ga0070665_100740459 3300005548 Bacteria 996
66 Ga0068855_100002699 3300005563 Bacteria 21866
67 Ga0068855_100196903 3300005563 Bacteria 2270
68 Ga0068855_100931108 3300005563 Bacteria 916
69 Ga0070664_100276778 3300005564 Bacteria 1513
70 Ga0070664_100384183 3300005564 Bacteria 1282
71 Ga0068857_100028595 3300005577 Bacteria 4919
72 Ga0068857_100507712 3300005577 Bacteria 1132
73 Ga0068857_101301047 3300005577 Bacteria 705
74 Ga0068854_100033178 3300005578 Bacteria 3598
75 Ga0068854_100177321 3300005578 Bacteria 1662
76 Ga0068854_100188008 3300005578 Bacteria 1617
77 Ga0068856_100052505 3300005614 Bacteria 4020
78 Ga0068856_100103811 3300005614 Bacteria 2836
79 Ga0068856_100205243 3300005614 Bacteria 1985
80 Ga0068852_100003815 3300005616 Bacteria 10581
81 Ga0068852_101000875 3300005616 Bacteria 854
82 Ga0068852_101503165 3300005616 Bacteria 696
83 Ga0068859_100002976 3300005617 Bacteria 17180
84 Ga0068859_100023802 3300005617 Bacteria 6147
85 Ga0068859_100028919 3300005617 Bacteria 5560
86 Ga0068859_100072333 3300005617 Bacteria 3485
87 Ga0068859_101843859 3300005617 Bacteria 668
88 Ga0068864_100000027 3300005618 Bacteria 229759
89 Ga0068866_10177524 3300005718 Bacteria 1255
90 Ga0068861_100000879 3300005719 Bacteria 18239
91 Ga0068861_100056780 3300005719 Bacteria 2989
92 Ga0068861_100073568 3300005719 Bacteria 2655
93 Ga0068861_100073769 3300005719 Bacteria 2652
94 Ga0068851_10051088 3300005834 Bacteria 2100
95 Ga0068851_10551453 3300005834 Bacteria 697
96 Ga0068863_100001776 3300005841 Bacteria 21388
97 Ga0068863_100009676 3300005841 Bacteria 9407
98 Ga0068863_100049253 3300005841 Bacteria 3995
99 Ga0068863_100304188 3300005841 Bacteria 1547
100 Ga0068858_100000412 3300005842 Bacteria 44458
101 Ga0068858_100002389 3300005842 Bacteria 18994
102 Ga0068860_100000013 3300005843 Bacteria 323055
103 Ga0068860_100000120 3300005843 Bacteria 125823
104 Ga0068862_100000143 3300005844 Bacteria 80650
105 Ga0068862_100000365 3300005844 Bacteria 49043
106 Ga0081539_10057928 3300005985 Bacteria 2141
107 Ga0075364_10713748 3300006051 Bacteria 684
108 Ga0075369_10033067 3300006186 Bacteria 2190
109 Ga0075369_10451651 3300006186 Bacteria 609
110 Ga0075366_10614979 3300006195 Bacteria 674
111 Ga0097621_100052964 3300006237 Bacteria 3307
112 Ga0097621_102190756 3300006237 Bacteria 529
113 Ga0068871_100323224 3300006358 Bacteria 1359
114 Ga0097620_100002976 3300006931 Bacteria 17180
115 Ga0097620_100023802 3300006931 Bacteria 6147
116 Ga0097620_100028919 3300006931 Bacteria 5560
117 Ga0097620_100072334 3300006931 Bacteria 3485
118 Ga0097620_101843474 3300006931 Bacteria 668
119 Ga0105240_10056792 3300009093 Bacteria 4896
120 Ga0105240_10951627 3300009093 Bacteria 921
121 Ga0105240_11089184 3300009093 Bacteria 851
122 Ga0105245_10001962 3300009098 Bacteria 18682
123 Ga0105247_10845663 3300009101 Bacteria 702
124 Ga0105243_10000038 3300009148 Bacteria 174351
125 Ga0105241_10006215 3300009174 Bacteria 8808
126 Ga0105241_10516443 3300009174 Bacteria 1068
127 Ga0105242_10205422 3300009176 Bacteria 1752
128 Ga0105242_10289857 3300009176 Bacteria 1490
129 Ga0105248_10000156 3300009177 Bacteria 79110
130 Ga0105248_10004792 3300009177 Bacteria 14977
131 Ga0105248_10049231 3300009177 Bacteria 4726
132 Ga0105248_10261711 3300009177 Bacteria 1947
133 Ga0105237_10351675 3300009545 Bacteria 1478
134 Ga0105237_10357223 3300009545 Bacteria 1465
135 Ga0105238_10145702 3300009551 Bacteria 2345
136 Ga0105238_10187309 3300009551 Bacteria 2046
137 Ga0105238_10328047 3300009551 Bacteria 1517
138 Ga0105249_10270258 3300009553 Bacteria 1693
139 Ga0105249_10631378 3300009553 Bacteria 1128
140 Ga0105249_12049827 3300009553 Bacteria 645
141 Ga0105239_10292340 3300010375 Bacteria 1835
142 Ga0105246_10470669 3300011119 Bacteria 1061
143 Ga0157327_1006219 3300012512 Bacteria 998
144 Ga0157326_1034753 3300012513 Bacteria 683
145 Ga0157373_10224462 3300013100 Bacteria 1326
146 Ga0157373_10869836 3300013100 Bacteria 667
147 Ga0157371_10000146 3300013102 Bacteria 103290
148 Ga0157370_10356740 3300013104 Bacteria 1347
149 Ga0157369_10892146 3300013105 Bacteria 912
150 Ga0157374_10265841 3300013296 Bacteria 1691
151 Ga0157374_10458264 3300013296 Bacteria 1277
152 Ga0157378_10114288 3300013297 Bacteria 2479
153 Ga0157378_10510569 3300013297 Bacteria 1202
154 Ga0157378_11111995 3300013297 Bacteria 827
155 Ga0163162_11289153 3300013306 Bacteria 830
156 Ga0157372_10258128 3300013307 Bacteria 2024
157 Ga0157372_10788676 3300013307 Bacteria 1104
158 Ga0157375_11568481 3300013308 Bacteria 778
159 Ga0163163_10612395 3300014325 Bacteria 1152
160 Ga0157380_10000416 3300014326 Bacteria 25905
161 Ga0157379_10027765 3300014968 Bacteria 5037
162 Ga0163161_11602377 3300017792 Bacteria 574
163 Ga0206354_10728589 3300020081 Bacteria 961
164 Ga0206353_11000466 3300020082 Bacteria 7140
165 Ga0213875_10000415 3300021388 Bacteria 37517
166 Ga0209674_106880 3300025226 Bacteria 1493
167 Ga0209563_100019 3300025230 Bacteria 697828
168 Ga0209148_1000017 3300025254 Bacteria 787064
169 Ga0209455_1000005 3300025272 Bacteria 1416756
170 Ga0209758_1000001 3300025297 Bacteria 1981790
171 Ga0207656_10003278 3300025321 Bacteria 5546
172 Ga0207680_10049539 3300025903 Bacteria 2501
173 Ga0207680_10152224 3300025903 Bacteria 1543
174 Ga0207647_10006193 3300025904 Bacteria 8717
175 Ga0207645_10029774 3300025907 Bacteria 3518
176 Ga0207643_10695113 3300025908 Bacteria 657
177 Ga0207705_10000002 3300025909 Bacteria 2046852
178 Ga0207705_10000182 3300025909 Bacteria 66143
179 Ga0207705_10054808 3300025909 Bacteria 2874
180 Ga0207705_10171343 3300025909 Bacteria 1634
181 Ga0207654_10005373 3300025911 Bacteria 6475
182 Ga0207707_10431581 3300025912 Bacteria 1128
183 Ga0207695_10042140 3300025913 Bacteria 4880
184 Ga0207695_10564408 3300025913 Bacteria 1020
185 Ga0207695_10821423 3300025913 Bacteria 810
186 Ga0207671_10007048 3300025914 Bacteria 9844
187 Ga0207671_10216590 3300025914 Bacteria 1499
188 Ga0207660_10098688 3300025917 Bacteria 2179
189 Ga0207657_10285162 3300025919 Bacteria 1310
190 Ga0207657_10322960 3300025919 Bacteria 1220
191 Ga0207657_10340975 3300025919 Bacteria 1183
192 Ga0207649_10008115 3300025920 Bacteria 5713
193 Ga0207649_10095049 3300025920 Bacteria 1960
194 Ga0207649_10112047 3300025920 Bacteria 1825
195 Ga0207652_10843417 3300025921 Bacteria 812
196 Ga0207681_10000022 3300025923 Bacteria 230079
197 Ga0207681_10117303 3300025923 Bacteria 1946
198 Ga0207694_10011662 3300025924 Bacteria 6630
199 Ga0207694_10130618 3300025924 Bacteria 2013
200 Ga0207650_10000019 3300025925 Bacteria 344751
201 Ga0207650_10000020 3300025925 Bacteria 342596
202 Ga0207650_10014606 3300025925 Bacteria 5454
203 Ga0207650_10380785 3300025925 Bacteria 1165
204 Ga0207650_10801056 3300025925 Bacteria 798
205 Ga0207659_10579490 3300025926 Bacteria 955
206 Ga0207644_10000047 3300025931 Bacteria 103158
207 Ga0207644_10129027 3300025931 Bacteria 1933
208 Ga0207644_10611364 3300025931 Bacteria 905
209 Ga0207690_10003832 3300025932 Bacteria 8899
210 Ga0207690_10166446 3300025932 Bacteria 1648
211 Ga0207690_10320089 3300025932 Bacteria 1219
212 Ga0207706_10041501 3300025933 Bacteria 4079
213 Ga0207709_10000031 3300025935 Bacteria 329046
214 Ga0207669_10000079 3300025937 Bacteria 49257
215 Ga0207669_10148698 3300025937 Bacteria 1637
216 Ga0207711_10001087 3300025941 Bacteria 25938
217 Ga0207711_10003462 3300025941 Bacteria 13667
218 Ga0207711_10885969 3300025941 Bacteria 830
219 Ga0207711_11393209 3300025941 Bacteria 644
220 Ga0207679_10407324 3300025945 Bacteria 1197
221 Ga0207679_10543587 3300025945 Bacteria 1041
222 Ga0207667_10000220 3300025949 Bacteria 80179
223 Ga0207667_10004725 3300025949 Bacteria 16676
224 Ga0207667_10478790 3300025949 Bacteria 1264
225 Ga0207651_10101579 3300025960 Bacteria 2135
226 Ga0207712_10303778 3300025961 Bacteria 1311
227 Ga0207712_10525706 3300025961 Bacteria 1014
228 Ga0207712_10698442 3300025961 Bacteria 885
229 Ga0207668_10000043 3300025972 Bacteria 103738
230 Ga0207668_10135867 3300025972 Bacteria 1884
231 Ga0207640_10006151 3300025981 Bacteria 6570
232 Ga0207640_10014457 3300025981 Bacteria 4546
233 Ga0207640_10451989 3300025981 Bacteria 1059
234 Ga0207658_10000010 3300025986 Bacteria 240224
235 Ga0207658_10001027 3300025986 Bacteria 22729
236 Ga0207703_10003516 3300026035 Bacteria 13106
237 Ga0207639_10068115 3300026041 Bacteria 2772
238 Ga0207639_10116580 3300026041 Bacteria 2187
239 Ga0207678_10004217 3300026067 Bacteria 12903
240 Ga0207702_10003378 3300026078 Bacteria 14631
241 Ga0207702_10249784 3300026078 Bacteria 1665
242 Ga0207702_10711177 3300026078 Bacteria 990
243 Ga0207641_10000294 3300026088 Bacteria 62469
244 Ga0207641_10012528 3300026088 Bacteria 6951
245 Ga0207648_10061940 3300026089 Bacteria 3262
246 Ga0207676_10000022 3300026095 Bacteria 296286
247 Ga0207676_10148646 3300026095 Bacteria 2015
248 Ga0207676_10900482 3300026095 Bacteria 868
249 Ga0207674_10007739 3300026116 Bacteria 12506
250 Ga0207674_10065229 3300026116 Bacteria 3671
251 Ga0207674_10223792 3300026116 Bacteria 1830
252 Ga0207675_100000049 3300026118 Bacteria 84016
253 Ga0207675_100001151 3300026118 Bacteria 26249
254 Ga0207675_100257143 3300026118 Bacteria 1692
255 Ga0207675_101114564 3300026118 Bacteria 809
256 Ga0207683_10000418 3300026121 Bacteria 39246
257 Ga0207698_10126356 3300026142 Bacteria 2176
258 Ga0207698_10145553 3300026142 Bacteria 2049
259 Ga0207698_11277523 3300026142 Bacteria 749
260 Ga0209999_1055318 3300027543 Bacteria 752
261 Ga0268266_10000002 3300028379 Bacteria 3059047
262 Ga0268266_10813914 3300028379 Bacteria 902
263 Ga0268265_10000031 3300028380 Bacteria 226725
264 Ga0268265_10000143 3300028380 Bacteria 90469
265 Ga0268264_10000070 3300028381 Bacteria 268524
266 Ga0307517_10107974 3300028786 Bacteria 2140
267 Ga0307517_10155161 3300028786 Bacteria 1556
268 Ga0307513_10044569 3300031456 Bacteria 4858
269 Ga0307513_10076258 3300031456 Bacteria 3478
270 Ga0307408_100397560 3300031548 Bacteria 1182
271 Ga0307413_10008465 3300031824 Bacteria 4859
272 Ga0307413_10154279 3300031824 Bacteria 1604
273 Ga0307413_10325179 3300031824 Bacteria 1176
274 Ga0307410_10311988 3300031852 Bacteria 1245
275 Ga0307410_11185665 3300031852 Bacteria 665
276 Ga0307406_10007002 3300031901 Bacteria 6243
277 Ga0307412_10000557 3300031911 Bacteria 22165
278 Ga0307412_10013770 3300031911 Bacteria 4751
279 Ga0307412_10083479 3300031911 Bacteria 2215
280 Ga0307412_10747383 3300031911 Bacteria 844
281 Ga0307416_100092066 3300032002 Bacteria 2606
282 Ga0307414_10000288 3300032004 Bacteria 29634
283 Ga0307414_11348331 3300032004 Bacteria 662
284 Ga0307414_11924776 3300032004 Bacteria 552
285 Ga0307411_11298353 3300032005 Bacteria 663
286 Ga0307415_101819415 3300032126 Unclassified 590
287 Ga0307510_10369622 3300033180 Bacteria 881
288 Ga0373937_0268196 3300036401 Bacteria 1611
289 Ga0395899_0810078 3300037312 Bacteria 578
290 Ga0395905_0082648 3300037471 Bacteria 3010
291 Ga0395905_0910011 3300037471 Bacteria 783
292 Ga0436364_1487636 3300037853 Bacteria 30336
293 Ga0395901_0380357 3300038443 Bacteria 1453
294 Ga0436365_1480551 3300039437 Bacteria 997
295 Ga0436363_0292113 3300039450 Bacteria 2199
296 Ga0451847_0322971 3300041503 Bacteria 534
297 Ga0466963_0623115 3300044694 Bacteria 762
298 Ga0495617_065633 3300046452 Bacteria 1197
299 Ga0495650_0000492 3300046471 Bacteria 59983
300 Ga0495584_0065461 3300046491 Bacteria 1828
301 Ga0495585_0054568 3300046492 Bacteria 2209
302 Ga0495585_0130457 3300046492 Bacteria 1323
303 Ga0495596_0007772 3300046500 Bacteria 4813
304 Ga0495607_0086043 3300046501 Bacteria 1715
305 Ga0495583_0002265 3300046506 Bacteria 16893
306 Ga0495583_0017315 3300046506 Bacteria 3830
307 Ga0495583_0023515 3300046506 Bacteria 3115
308 Ga0495606_0001167 3300046507 Bacteria 37141
309 Ga0495606_0106327 3300046507 Bacteria 1699
310 Ga0495606_0385095 3300046507 Bacteria 734
311 Ga0495616_0138872 3300046513 Bacteria 1108
312 Ga0495631_0037626 3300046518 Bacteria 2155
313 Ga0495643_0001143 3300046522 Bacteria 26034
314 Ga0495643_0002634 3300046522 Bacteria 13930
315 Ga0495643_0032834 3300046522 Bacteria 2878
316 Ga0495643_0215249 3300046522 Bacteria 914
317 Ga0495643_0290954 3300046522 Bacteria 748
318 Ga0495648_0000430 3300046524 Bacteria 45832
319 Ga0495648_0214036 3300046524 Bacteria 955
320 Ga0495663_0000448 3300046525 Bacteria 15077
321 Ga0495587_0409743 3300046536 Bacteria 753
322 Ga0495609_0179358 3300046538 Bacteria 892
323 Ga0495633_0006053 3300046558 Bacteria 7255
324 Ga0495633_0023766 3300046558 Bacteria 3034
325 Ga0495633_0296845 3300046558 Bacteria 734
326 Ga0495668_0000007 3300046616 Bacteria 552902
327 Ga0495668_0419839 3300046616 Bacteria 735
328 Ga0495611_0010553 3300046648 Bacteria 3908
329 Ga0495611_0036236 3300046648 Bacteria 2188
330 Ga0495625_0000167 3300046660 Bacteria 102783
331 Ga0495625_0057825 3300046660 Bacteria 2756
332 Ga0495625_0100717 3300046660 Bacteria 1985
333 Ga0495625_0594830 3300046660 Bacteria 665
334 Ga0495624_0651219 3300046690 Bacteria 627
335 Ga0495670_0078881 3300046691 Bacteria 1675
336 Ga0495671_0355154 3300046692 Bacteria 703
337 Ga0495649_0074373 3300046694 Bacteria 1820
338 Ga0495600_0046592 3300046809 Bacteria 2828
339 Ga0495660_0153901 3300046810 Bacteria 1133
340 Ga0495672_0405175 3300047320 Bacteria 623
341 Ga0495683_0007573 3300047323 Bacteria 5855
342 Ga0495687_000973 3300047443 Bacteria 29058
343 Ga0495677_0008856 3300047445 Bacteria 3727
344 Ga0495677_0083309 3300047445 Bacteria 1200
345 Ga0495673_0199612 3300047469 Bacteria 749
346 Ga0495681_0013093 3300047470 Bacteria 4836
347 Ga0495686_0001337 3300047472 Bacteria 27585
348 Ga0495686_0010076 3300047472 Bacteria 6750
349 Ga0495686_0085895 3300047472 Bacteria 1915
350 Ga0496100_0376874 3300048903 Bacteria 1077
351 Ga0496101_0515111 3300048904 Bacteria 945
352 Ga0496101_0681247 3300048904 Bacteria 812
353 Ga0496102_0001617 3300048905 Bacteria 19867
354 Ga0496103_0000173 3300048906 Bacteria 67412
355 Ga0496103_0000457 3300048906 Bacteria 34763
356 Ga0496104_0097442 3300048907 Bacteria 2815
357 Ga0496104_0111901 3300048907 Bacteria 2618
358 Ga0496105_0007688 3300048908 Bacteria 8358
359 Ga0496105_0260581 3300048908 Bacteria 1402
360 Ga0496105_0481574 3300048908 Bacteria 976
361 Ga0496107_0432613 3300048910 Bacteria 978
362 Ga0496108_0026662 3300048911 Bacteria 4768
363 Ga0496109_1556945 3300048912 Bacteria 596
364 Ga0496110_0055510 3300048913 Bacteria 3486
365 Ga0496111_0003239 3300048914 Bacteria 10047
366 Ga0496111_0106460 3300048914 Bacteria 2064
367 Ga0496113_0028315 3300048916 Bacteria 4028
368 Ga0496113_0086138 3300048916 Bacteria 2414
369 Ga0496114_0023337 3300048917 Bacteria 5048
370 Ga0496115_0001154 3300048918 Bacteria 19089
371 Ga0496116_0000566 3300048919 Bacteria 49509
372 Ga0496116_0020367 3300048919 Bacteria 5039
373 Ga0496117_0000424 3300048920 Bacteria 71078
374 Ga0496117_0000485 3300048920 Bacteria 65840
375 Ga0496118_0000190 3300048921 Bacteria 108017
376 Ga0496118_0001508 3300048921 Bacteria 34697
377 Ga0496119_0021776 3300048922 Bacteria 4617
378 Ga0496119_0029743 3300048922 Bacteria 3695
379 Ga0496120_0025696 3300048923 Bacteria 3651
380 Ga0496120_0256453 3300048923 Bacteria 818
381 Ga0496121_0000597 3300048924 Bacteria 67845
382 Ga0496122_0009971 3300048925 Bacteria 9892
383 Ga0496123_0086072 3300048926 Bacteria 1887
384 Ga0496124_0000082 3300048927 Bacteria 208248
385 Ga0496124_0000546 3300048927 Bacteria 63624
386 Ga0496125_0000638 3300048928 Bacteria 58580
387 Ga0496125_0007610 3300048928 Bacteria 11498
388 Ga0496126_0001589 3300048929 Bacteria 34677
389 Ga0496126_1130809 3300048929 Bacteria 580
390 Ga0501307_000257 3300049162 Bacteria 3196
391 Ga0501314_003841 3300049530 Bacteria 1225
392 Ga0501032_0084877 3300049569 Bacteria 2105
393 Ga0501034_0170545 3300049571 Bacteria 2143
394 Ga0501036_0087577 3300049572 Bacteria 2632
395 Ga0501036_1085166 3300049572 Bacteria 654
396 Ga0501047_0000793 3300049581 Bacteria 33043
397 Ga0501047_1215355 3300049581 Bacteria 567
398 Ga0501048_0064530 3300049582 Bacteria 2590
399 Ga0501069_0003685 3300049585 Bacteria 7884
400 Ga0501070_0096165 3300049586 Bacteria 2450
401 Ga0501223_000821 3300049663 Bacteria 7346
402 Ga0501224_000033 3300049664 Bacteria 39112
403 Ga0501249_000326 3300049679 Bacteria 13090
404 Ga0501225_0000791 3300049705 Bacteria 9890
405 Ga0501234_000286 3300049707 Bacteria 7413
406 Ga0501035_0269349 3300049822 Bacteria 1442
407 Ga0501044_0161557 3300049823 Bacteria 2217
408 Ga0501204_003776 3300049850 Bacteria 1610
409 Ga0501226_000056 3300049853 Bacteria 39071
410 nmdc:mga0k408_119652_c1 3300050493 Bacteria 1559
411 nmdc:mga0k408_427612_c1 3300050493 Bacteria 787
412 nmdc:mga07m45_460513_c1 3300050496 Bacteria 737
413 nmdc:mga0qj67_19080_c1 3300050509 Bacteria 1337
414 nmdc:mga0sz30_580432_c1 3300050516 Bacteria 507
415 Ga0500610_0000143 3300053079 Bacteria 21397
416 Ga0500595_004157 3300053119 Bacteria 6561
417 Ga0500597_078262 3300053120 Bacteria 1433
418 Ga0500642_0004333 3300053130 Bacteria 4429
419 Ga0500573_0000034 3300053140 Bacteria 113547
420 Ga0500604_0054094 3300053151 Bacteria 1246
421 Ga0500624_000001 3300053157 Bacteria 284974
422 Ga0500636_0006292 3300053177 Bacteria 6812
423 Ga0500637_0000156 3300053178 Bacteria 24981
424 Ga0500645_000011 3300053730 Bacteria 169616
425 Ga0500596_023196 3300053735 Bacteria 940
426 Ga0500587_029146 3300053739 Bacteria 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041503 Ga0451847_0322971 Ga0451847_0322971_180_521 112
2 iso_pu_bacteria 2895880812 2895888350 130
3 3300031824 Ga0307413_10154279 Ga0307413_101542793 133
4 3300002076 JGI24749J21850_1000020 JGI24749J21850_100002017 134
5 3300002239 JGI24034J26672_10017695 JGI24034J26672_100176953 134
6 3300002459 JGI24751J29686_10000177 JGI24751J29686_1000017717 134
7 3300005295 Ga0065707_10111756 Ga0065707_101117564 134
8 3300005327 Ga0070658_10099945 Ga0070658_100999452 134
9 3300005328 Ga0070676_11070766 Ga0070676_110707661 134
10 3300005330 Ga0070690_100463110 Ga0070690_1004631101 134
11 3300005331 Ga0070670_100000008 Ga0070670_10000000871 134
12 3300005331 Ga0070670_100000570 Ga0070670_10000057010 134
13 3300005331 Ga0070670_100332690 Ga0070670_1003326901 134
14 3300005334 Ga0068869_100086685 Ga0068869_1000866852 134
15 3300005335 Ga0070666_11302078 Ga0070666_113020781 134
16 3300005339 Ga0070660_100411622 Ga0070660_1004116223 134
17 3300005344 Ga0070661_100236916 Ga0070661_1002369162 134
18 3300005347 Ga0070668_100000001 Ga0070668_100000001159 134
19 3300005347 Ga0070668_100739499 Ga0070668_1007394991 134
20 3300005353 Ga0070669_100000240 Ga0070669_10000024044 134
21 3300005353 Ga0070669_100022464 Ga0070669_1000224644 134
22 3300005353 Ga0070669_100145210 Ga0070669_1001452103 134
23 3300005354 Ga0070675_101643082 Ga0070675_1016430821 134
24 3300005355 Ga0070671_100000167 Ga0070671_10000016733 134
25 3300005355 Ga0070671_100017555 Ga0070671_10001755510 134
26 3300005355 Ga0070671_100067759 Ga0070671_1000677596 134
27 3300005364 Ga0070673_100300608 Ga0070673_1003006081 134
28 3300005367 Ga0070667_100000006 Ga0070667_100000006134 134
29 3300005367 Ga0070667_100001022 Ga0070667_10000102222 134
30 3300005563 Ga0068855_100196903 Ga0068855_1001969038 134
31 3300005564 Ga0070664_100384183 Ga0070664_1003841833 134
32 3300005577 Ga0068857_100028595 Ga0068857_1000285959 134
33 3300005577 Ga0068857_100507712 Ga0068857_1005077122 134
34 3300005578 Ga0068854_100033178 Ga0068854_1000331787 134
35 3300005614 Ga0068856_100103811 Ga0068856_1001038116 134
36 3300005616 Ga0068852_100003815 Ga0068852_1000038154 134
37 3300005616 Ga0068852_101503165 Ga0068852_1015031651 134
38 3300005617 Ga0068859_100002976 Ga0068859_10000297616 134
39 3300005617 Ga0068859_100028919 Ga0068859_1000289197 134
40 3300005618 Ga0068864_100000027 Ga0068864_10000002749 134
41 3300005719 Ga0068861_100056780 Ga0068861_1000567801 134
42 3300005719 Ga0068861_100073769 Ga0068861_1000737693 134
43 3300005841 Ga0068863_100001776 Ga0068863_10000177621 134
44 3300005841 Ga0068863_100009676 Ga0068863_1000096768 134
45 3300005841 Ga0068863_100049253 Ga0068863_1000492532 134
46 3300005841 Ga0068863_100304188 Ga0068863_1003041882 134
47 3300005842 Ga0068858_100000412 Ga0068858_10000041241 134
48 3300005842 Ga0068858_100002389 Ga0068858_10000238915 134
49 3300005843 Ga0068860_100000013 Ga0068860_100000013254 134
50 3300005843 Ga0068860_100000120 Ga0068860_100000120103 134
51 3300005844 Ga0068862_100000143 Ga0068862_10000014327 134
52 3300005844 Ga0068862_100000365 Ga0068862_10000036547 134
53 3300006051 Ga0075364_10713748 Ga0075364_107137481 134
54 3300006195 Ga0075366_10614979 Ga0075366_106149791 134
55 3300006237 Ga0097621_102190756 Ga0097621_1021907561 134
56 3300006931 Ga0097620_100002976 Ga0097620_10000297616 134
57 3300006931 Ga0097620_100028919 Ga0097620_1000289197 134
58 3300009098 Ga0105245_10001962 Ga0105245_100019626 134
59 3300009101 Ga0105247_10845663 Ga0105247_108456632 134
60 3300009176 Ga0105242_10205422 Ga0105242_102054224 134
61 3300009177 Ga0105248_10000156 Ga0105248_1000015649 134
62 3300009177 Ga0105248_10004792 Ga0105248_100047928 134
63 3300009177 Ga0105248_10261711 Ga0105248_102617113 134
64 3300009551 Ga0105238_10328047 Ga0105238_103280471 134
65 3300009553 Ga0105249_10270258 Ga0105249_102702583 134
66 3300009553 Ga0105249_12049827 Ga0105249_120498271 134
67 3300013100 Ga0157373_10869836 Ga0157373_108698361 134
68 3300013296 Ga0157374_10265841 Ga0157374_102658416 134
69 3300013297 Ga0157378_10114288 Ga0157378_101142886 134
70 3300013297 Ga0157378_11111995 Ga0157378_111119951 134
71 3300013306 Ga0163162_11289153 Ga0163162_112891531 134
72 3300013308 Ga0157375_11568481 Ga0157375_115684811 134
73 3300014325 Ga0163163_10612395 Ga0163163_106123951 134
74 3300014326 Ga0157380_10000416 Ga0157380_1000041623 134
75 3300025903 Ga0207680_10049539 Ga0207680_100495391 134
76 3300025903 Ga0207680_10152224 Ga0207680_101522241 134
77 3300025909 Ga0207705_10054808 Ga0207705_100548084 134
78 3300025909 Ga0207705_10171343 Ga0207705_101713432 134
79 3300025919 Ga0207657_10340975 Ga0207657_103409753 134
80 3300025920 Ga0207649_10095049 Ga0207649_100950492 134
81 3300025921 Ga0207652_10843417 Ga0207652_108434172 134
82 3300025923 Ga0207681_10000022 Ga0207681_1000002250 134
83 3300025923 Ga0207681_10117303 Ga0207681_101173033 134
84 3300025925 Ga0207650_10000019 Ga0207650_10000019260 134
85 3300025925 Ga0207650_10000020 Ga0207650_10000020253 134
86 3300025925 Ga0207650_10014606 Ga0207650_100146063 134
87 3300025925 Ga0207650_10380785 Ga0207650_103807854 134
88 3300025925 Ga0207650_10801056 Ga0207650_108010561 134
89 3300025931 Ga0207644_10000047 Ga0207644_1000004741 134
90 3300025931 Ga0207644_10129027 Ga0207644_101290272 134
91 3300025931 Ga0207644_10611364 Ga0207644_106113642 134
92 3300025941 Ga0207711_10001087 Ga0207711_1000108722 134
93 3300025941 Ga0207711_10003462 Ga0207711_1000346216 134
94 3300025941 Ga0207711_11393209 Ga0207711_113932091 134
95 3300025945 Ga0207679_10407324 Ga0207679_104073243 134
96 3300025961 Ga0207712_10303778 Ga0207712_103037782 134
97 3300025961 Ga0207712_10698442 Ga0207712_106984422 134
98 3300025972 Ga0207668_10000043 Ga0207668_100000432 134
99 3300025981 Ga0207640_10014457 Ga0207640_100144571 134
100 3300025986 Ga0207658_10000010 Ga0207658_10000010132 134
101 3300025986 Ga0207658_10001027 Ga0207658_100010275 134
102 3300026035 Ga0207703_10003516 Ga0207703_100035167 134
103 3300026078 Ga0207702_10249784 Ga0207702_102497843 134
104 3300026088 Ga0207641_10000294 Ga0207641_1000029429 134
105 3300026088 Ga0207641_10012528 Ga0207641_100125286 134
106 3300026095 Ga0207676_10000022 Ga0207676_10000022204 134
107 3300026095 Ga0207676_10148646 Ga0207676_101486463 134
108 3300026116 Ga0207674_10007739 Ga0207674_1000773912 134
109 3300026116 Ga0207674_10223792 Ga0207674_102237922 134
110 3300026118 Ga0207675_100001151 Ga0207675_1000011512 134
111 3300026118 Ga0207675_100257143 Ga0207675_1002571432 134
112 3300026142 Ga0207698_10145553 Ga0207698_101455533 134
113 3300026142 Ga0207698_11277523 Ga0207698_112775232 134
114 3300027543 Ga0209999_1055318 Ga0209999_10553182 134
115 3300028380 Ga0268265_10000031 Ga0268265_1000003176 134
116 3300028380 Ga0268265_10000143 Ga0268265_1000014346 134
117 3300028381 Ga0268264_10000070 Ga0268264_1000007072 134
118 3300031824 Ga0307413_10008465 Ga0307413_100084655 134
119 3300031824 Ga0307413_10325179 Ga0307413_103251792 134
120 3300031852 Ga0307410_10311988 Ga0307410_103119882 134
121 3300031911 Ga0307412_10000557 Ga0307412_100005577 134
122 3300031911 Ga0307412_10083479 Ga0307412_100834793 134
123 3300032004 Ga0307414_10000288 Ga0307414_1000028827 134
124 3300032004 Ga0307414_11348331 Ga0307414_113483312 134
125 3300032004 Ga0307414_11924776 Ga0307414_119247762 134
126 3300037471 Ga0395905_0082648 Ga0395905_0082648_2141_2557 134
127 3300046501 Ga0495607_0086043 Ga0495607_0086043_263_670 134
128 3300047472 Ga0495686_0010076 Ga0495686_0010076_4370_4777 134
129 3300047472 Ga0495686_0085895 Ga0495686_0085895_1190_1597 134
130 3300048903 Ga0496100_0376874 Ga0496100_0376874_627_1043 134
131 3300048904 Ga0496101_0515111 Ga0496101_0515111_329_745 134
132 3300048907 Ga0496104_0097442 Ga0496104_0097442_1708_2124 134
133 3300048908 Ga0496105_0260581 Ga0496105_0260581_701_1117 134
134 3300048910 Ga0496107_0432613 Ga0496107_0432613_319_735 134
135 3300048911 Ga0496108_0026662 Ga0496108_0026662_1794_2210 134
136 3300048914 Ga0496111_0106460 Ga0496111_0106460_1007_1423 134
137 3300048916 Ga0496113_0028315 Ga0496113_0028315_2912_3328 134
138 3300048916 Ga0496113_0086138 Ga0496113_0086138_1350_1769 134
139 3300048928 Ga0496125_0007610 Ga0496125_0007610_8166_8573 134
140 3300049162 Ga0501307_000257 Ga0501307_000257_2654_3067 134
141 3300049569 Ga0501032_0084877 Ga0501032_0084877_1260_1673 134
142 3300049571 Ga0501034_0170545 Ga0501034_0170545_254_661 134
143 3300049572 Ga0501036_0087577 Ga0501036_0087577_1026_1439 134
144 3300049572 Ga0501036_1085166 Ga0501036_1085166_191_598 134
145 3300049581 Ga0501047_0000793 Ga0501047_0000793_6643_7056 134
146 3300049582 Ga0501048_0064530 Ga0501048_0064530_2138_2551 134
147 3300049585 Ga0501069_0003685 Ga0501069_0003685_6491_6898 134
148 3300049586 Ga0501070_0096165 Ga0501070_0096165_692_1099 134
149 3300049679 Ga0501249_000326 Ga0501249_000326_7851_8264 134
150 3300049823 Ga0501044_0161557 Ga0501044_0161557_115_522 134
151 3300049850 Ga0501204_003776 Ga0501204_003776_878_1291 134
152 3300050493 nmdc:mga0k408_427612_c1 nmdc:mga0k408_427612_c1_66_479 134
153 3300050496 nmdc:mga07m45_460513_c1 nmdc:mga07m45_460513_c1_37_450 134
154 3300001904 JGI24736J21556_1041488 JGI24736J21556_10414881 135
155 3300001915 JGI24741J21665_1000978 JGI24741J21665_100097818 135
156 3300001915 JGI24741J21665_1006510 JGI24741J21665_10065104 135
157 3300001915 JGI24741J21665_1008203 JGI24741J21665_10082034 135
158 3300001979 JGI24740J21852_10029863 JGI24740J21852_100298633 135
159 3300001990 JGI24737J22298_10013770 JGI24737J22298_100137704 135
160 3300002067 JGI24735J21928_10131461 JGI24735J21928_101314612 135
161 3300002077 JGI24744J21845_10039723 JGI24744J21845_100397231 135
162 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006308 135
163 3300003759 Ga0055525_1000051 Ga0055525_1000051137 135
164 3300003762 Ga0055542_1000020 Ga0055542_1000020255 135
165 3300003763 Ga0055529_1000016 Ga0055529_100001691 135
166 3300005327 Ga0070658_10000029 Ga0070658_10000029143 135
167 3300005327 Ga0070658_10000077 Ga0070658_1000007730 135
168 3300005328 Ga0070676_10747240 Ga0070676_107472401 135
169 3300005331 Ga0070670_100234409 Ga0070670_1002344092 135
170 3300005339 Ga0070660_100185490 Ga0070660_1001854904 135
171 3300005344 Ga0070661_100001114 Ga0070661_10000111422 135
172 3300005344 Ga0070661_100155532 Ga0070661_1001555321 135
173 3300005347 Ga0070668_100009825 Ga0070668_1000098253 135
174 3300005353 Ga0070669_100726683 Ga0070669_1007266832 135
175 3300005354 Ga0070675_100167969 Ga0070675_1001679691 135
176 3300005355 Ga0070671_100376537 Ga0070671_1003765372 135
177 3300005356 Ga0070674_100000284 Ga0070674_1000002847 135
178 3300005356 Ga0070674_100201632 Ga0070674_1002016323 135
179 3300005364 Ga0070673_100123619 Ga0070673_1001236194 135
180 3300005366 Ga0070659_100111827 Ga0070659_1001118274 135
181 3300005366 Ga0070659_100208666 Ga0070659_1002086663 135
182 3300005366 Ga0070659_100247460 Ga0070659_1002474602 135
183 3300005367 Ga0070667_100212696 Ga0070667_1002126963 135
184 3300005455 Ga0070663_100063589 Ga0070663_1000635893 135
185 3300005456 Ga0070678_100000043 Ga0070678_10000004322 135
186 3300005457 Ga0070662_100075342 Ga0070662_1000753422 135
187 3300005459 Ga0068867_100054692 Ga0068867_1000546926 135
188 3300005535 Ga0070684_100354800 Ga0070684_1003548001 135
189 3300005539 Ga0068853_100141494 Ga0068853_1001414943 135
190 3300005539 Ga0068853_100183689 Ga0068853_1001836895 135
191 3300005548 Ga0070665_100000535 Ga0070665_10000053545 135
192 3300005548 Ga0070665_100740459 Ga0070665_1007404592 135
193 3300005563 Ga0068855_100002699 Ga0068855_10000269914 135
194 3300005563 Ga0068855_100931108 Ga0068855_1009311082 135
195 3300005564 Ga0070664_100276778 Ga0070664_1002767783 135
196 3300005577 Ga0068857_101301047 Ga0068857_1013010472 135
197 3300005578 Ga0068854_100177321 Ga0068854_1001773214 135
198 3300005578 Ga0068854_100188008 Ga0068854_1001880082 135
199 3300005614 Ga0068856_100052505 Ga0068856_1000525052 135
200 3300005614 Ga0068856_100205243 Ga0068856_1002052433 135
201 3300005616 Ga0068852_101000875 Ga0068852_1010008752 135
202 3300005617 Ga0068859_100023802 Ga0068859_1000238026 135
203 3300005617 Ga0068859_100072333 Ga0068859_1000723333 135
204 3300005617 Ga0068859_101843859 Ga0068859_1018438591 135
205 3300005718 Ga0068866_10177524 Ga0068866_101775243 135
206 3300005719 Ga0068861_100000879 Ga0068861_10000087915 135
207 3300005719 Ga0068861_100073568 Ga0068861_1000735684 135
208 3300005834 Ga0068851_10051088 Ga0068851_100510883 135
209 3300005834 Ga0068851_10551453 Ga0068851_105514531 135
210 3300005985 Ga0081539_10057928 Ga0081539_100579282 135
211 3300006186 Ga0075369_10033067 Ga0075369_100330672 135
212 3300006186 Ga0075369_10451651 Ga0075369_104516511 135
213 3300006237 Ga0097621_100052964 Ga0097621_1000529648 135
214 3300006358 Ga0068871_100323224 Ga0068871_1003232242 135
215 3300006931 Ga0097620_100023802 Ga0097620_1000238026 135
216 3300006931 Ga0097620_100072334 Ga0097620_1000723343 135
217 3300006931 Ga0097620_101843474 Ga0097620_1018434741 135
218 3300009093 Ga0105240_10056792 Ga0105240_100567923 135
219 3300009093 Ga0105240_10951627 Ga0105240_109516271 135
220 3300009093 Ga0105240_11089184 Ga0105240_110891841 135
221 3300009148 Ga0105243_10000038 Ga0105243_1000003852 135
222 3300009174 Ga0105241_10006215 Ga0105241_100062153 135
223 3300009174 Ga0105241_10516443 Ga0105241_105164432 135
224 3300009176 Ga0105242_10289857 Ga0105242_102898571 135
225 3300009177 Ga0105248_10049231 Ga0105248_100492312 135
226 3300009545 Ga0105237_10351675 Ga0105237_103516753 135
227 3300009545 Ga0105237_10357223 Ga0105237_103572232 135
228 3300009551 Ga0105238_10145702 Ga0105238_101457024 135
229 3300009551 Ga0105238_10187309 Ga0105238_101873093 135
230 3300009553 Ga0105249_10631378 Ga0105249_106313783 135
231 3300010375 Ga0105239_10292340 Ga0105239_102923401 135
232 3300011119 Ga0105246_10470669 Ga0105246_104706693 135
233 3300012512 Ga0157327_1006219 Ga0157327_10062191 135
234 3300012513 Ga0157326_1034753 Ga0157326_10347531 135
235 3300013100 Ga0157373_10224462 Ga0157373_102244622 135
236 3300013102 Ga0157371_10000146 Ga0157371_1000014613 135
237 3300013104 Ga0157370_10356740 Ga0157370_103567403 135
238 3300013105 Ga0157369_10892146 Ga0157369_108921462 135
239 3300013296 Ga0157374_10458264 Ga0157374_104582643 135
240 3300013297 Ga0157378_10510569 Ga0157378_105105691 135
241 3300013307 Ga0157372_10258128 Ga0157372_102581282 135
242 3300013307 Ga0157372_10788676 Ga0157372_107886763 135
243 3300014968 Ga0157379_10027765 Ga0157379_100277658 135
244 3300017792 Ga0163161_11602377 Ga0163161_116023771 135
245 3300020081 Ga0206354_10728589 Ga0206354_107285892 135
246 3300020082 Ga0206353_11000466 Ga0206353_1100046612 135
247 3300021388 Ga0213875_10000415 Ga0213875_1000041521 135
248 3300025226 Ga0209674_106880 Ga0209674_1068802 135
249 3300025230 Ga0209563_100019 Ga0209563_100019369 135
250 3300025254 Ga0209148_1000017 Ga0209148_1000017656 135
251 3300025272 Ga0209455_1000005 Ga0209455_1000005656 135
252 3300025297 Ga0209758_1000001 Ga0209758_10000011517 135
253 3300025321 Ga0207656_10003278 Ga0207656_100032784 135
254 3300025904 Ga0207647_10006193 Ga0207647_1000619310 135
255 3300025907 Ga0207645_10029774 Ga0207645_1002977410 135
256 3300025908 Ga0207643_10695113 Ga0207643_106951131 135
257 3300025909 Ga0207705_10000002 Ga0207705_10000002877 135
258 3300025909 Ga0207705_10000182 Ga0207705_1000018258 135
259 3300025911 Ga0207654_10005373 Ga0207654_100053739 135
260 3300025912 Ga0207707_10431581 Ga0207707_104315812 135
261 3300025913 Ga0207695_10042140 Ga0207695_100421403 135
262 3300025913 Ga0207695_10564408 Ga0207695_105644081 135
263 3300025913 Ga0207695_10821423 Ga0207695_108214232 135
264 3300025914 Ga0207671_10007048 Ga0207671_100070484 135
265 3300025914 Ga0207671_10216590 Ga0207671_102165902 135
266 3300025917 Ga0207660_10098688 Ga0207660_100986883 135
267 3300025919 Ga0207657_10285162 Ga0207657_102851623 135
268 3300025919 Ga0207657_10322960 Ga0207657_103229602 135
269 3300025920 Ga0207649_10008115 Ga0207649_100081159 135
270 3300025920 Ga0207649_10112047 Ga0207649_101120472 135
271 3300025924 Ga0207694_10011662 Ga0207694_100116624 135
272 3300025924 Ga0207694_10130618 Ga0207694_101306183 135
273 3300025926 Ga0207659_10579490 Ga0207659_105794902 135
274 3300025932 Ga0207690_10003832 Ga0207690_1000383213 135
275 3300025932 Ga0207690_10166446 Ga0207690_101664462 135
276 3300025932 Ga0207690_10320089 Ga0207690_103200891 135
277 3300025933 Ga0207706_10041501 Ga0207706_1004150110 135
278 3300025935 Ga0207709_10000031 Ga0207709_10000031231 135
279 3300025937 Ga0207669_10000079 Ga0207669_1000007911 135
280 3300025937 Ga0207669_10148698 Ga0207669_101486984 135
281 3300025941 Ga0207711_10885969 Ga0207711_108859692 135
282 3300025945 Ga0207679_10543587 Ga0207679_105435872 135
283 3300025949 Ga0207667_10000220 Ga0207667_1000022085 135
284 3300025949 Ga0207667_10004725 Ga0207667_1000472517 135
285 3300025949 Ga0207667_10478790 Ga0207667_104787903 135
286 3300025960 Ga0207651_10101579 Ga0207651_101015796 135
287 3300025961 Ga0207712_10525706 Ga0207712_105257062 135
288 3300025972 Ga0207668_10135867 Ga0207668_101358674 135
289 3300025981 Ga0207640_10006151 Ga0207640_100061515 135
290 3300025981 Ga0207640_10451989 Ga0207640_104519892 135
291 3300026041 Ga0207639_10068115 Ga0207639_100681152 135
292 3300026041 Ga0207639_10116580 Ga0207639_101165803 135
293 3300026067 Ga0207678_10004217 Ga0207678_1000421720 135
294 3300026078 Ga0207702_10003378 Ga0207702_100033789 135
295 3300026078 Ga0207702_10711177 Ga0207702_107111772 135
296 3300026089 Ga0207648_10061940 Ga0207648_100619404 135
297 3300026095 Ga0207676_10900482 Ga0207676_109004822 135
298 3300026116 Ga0207674_10065229 Ga0207674_100652295 135
299 3300026118 Ga0207675_100000049 Ga0207675_10000004924 135
300 3300026118 Ga0207675_101114564 Ga0207675_1011145641 135
301 3300026121 Ga0207683_10000418 Ga0207683_1000041815 135
302 3300026142 Ga0207698_10126356 Ga0207698_101263565 135
303 3300028379 Ga0268266_10000002 Ga0268266_100000022331 135
304 3300028379 Ga0268266_10813914 Ga0268266_108139142 135
305 3300028786 Ga0307517_10107974 Ga0307517_101079743 135
306 3300028786 Ga0307517_10155161 Ga0307517_101551611 135
307 3300031456 Ga0307513_10044569 Ga0307513_100445694 135
308 3300031456 Ga0307513_10076258 Ga0307513_100762588 135
309 3300031548 Ga0307408_100397560 Ga0307408_1003975602 135
310 3300031852 Ga0307410_11185665 Ga0307410_111856652 135
311 3300031901 Ga0307406_10007002 Ga0307406_100070028 135
312 3300031911 Ga0307412_10013770 Ga0307412_100137703 135
313 3300031911 Ga0307412_10747383 Ga0307412_107473831 135
314 3300032002 Ga0307416_100092066 Ga0307416_1000920664 135
315 3300032005 Ga0307411_11298353 Ga0307411_112983531 135
316 3300032126 Ga0307415_101819415 Ga0307415_1018194152 135
317 3300033180 Ga0307510_10369622 Ga0307510_103696221 135
318 3300036401 Ga0373937_0268196 Ga0373937_0268196_702_1109 135
319 3300037312 Ga0395899_0810078 Ga0395899_0810078_123_530 135
320 3300037471 Ga0395905_0910011 Ga0395905_0910011_325_735 135
321 3300037853 Ga0436364_1487636 Ga0436364_1487636_8986_9405 135
322 3300038443 Ga0395901_0380357 Ga0395901_0380357_582_989 135
323 3300039437 Ga0436365_1480551 Ga0436365_1480551_495_902 135
324 3300039450 Ga0436363_0292113 Ga0436363_0292113_666_1076 135
325 3300044694 Ga0466963_0623115 Ga0466963_0623115_114_521 135
326 3300046452 Ga0495617_065633 Ga0495617_065633_76_483 135
327 3300046471 Ga0495650_0000492 Ga0495650_0000492_51756_52166 135
328 3300046491 Ga0495584_0065461 Ga0495584_0065461_965_1372 135
329 3300046492 Ga0495585_0054568 Ga0495585_0054568_642_1052 135
330 3300046492 Ga0495585_0130457 Ga0495585_0130457_31_438 135
331 3300046500 Ga0495596_0007772 Ga0495596_0007772_1155_1562 135
332 3300046506 Ga0495583_0002265 Ga0495583_0002265_16104_16514 135
333 3300046506 Ga0495583_0017315 Ga0495583_0017315_999_1505 135
334 3300046506 Ga0495583_0023515 Ga0495583_0023515_764_1171 135
335 3300046507 Ga0495606_0001167 Ga0495606_0001167_8556_8963 135
336 3300046507 Ga0495606_0106327 Ga0495606_0106327_38_445 135
337 3300046507 Ga0495606_0385095 Ga0495606_0385095_283_690 135
338 3300046513 Ga0495616_0138872 Ga0495616_0138872_281_790 135
339 3300046518 Ga0495631_0037626 Ga0495631_0037626_1201_1611 135
340 3300046522 Ga0495643_0001143 Ga0495643_0001143_24727_25134 135
341 3300046522 Ga0495643_0002634 Ga0495643_0002634_901_1308 135
342 3300046522 Ga0495643_0032834 Ga0495643_0032834_973_1380 135
343 3300046522 Ga0495643_0215249 Ga0495643_0215249_264_674 135
344 3300046522 Ga0495643_0290954 Ga0495643_0290954_292_699 135
345 3300046524 Ga0495648_0000430 Ga0495648_0000430_27107_27517 135
346 3300046524 Ga0495648_0214036 Ga0495648_0214036_454_864 135
347 3300046525 Ga0495663_0000448 Ga0495663_0000448_4110_4517 135
348 3300046536 Ga0495587_0409743 Ga0495587_0409743_253_663 135
349 3300046538 Ga0495609_0179358 Ga0495609_0179358_192_602 135
350 3300046558 Ga0495633_0006053 Ga0495633_0006053_3017_3427 135
351 3300046558 Ga0495633_0023766 Ga0495633_0023766_935_1345 135
352 3300046558 Ga0495633_0296845 Ga0495633_0296845_220_627 135
353 3300046616 Ga0495668_0000007 Ga0495668_0000007_94191_94598 135
354 3300046616 Ga0495668_0419839 Ga0495668_0419839_303_710 135
355 3300046648 Ga0495611_0010553 Ga0495611_0010553_1789_2196 135
356 3300046648 Ga0495611_0036236 Ga0495611_0036236_608_1018 135
357 3300046660 Ga0495625_0000167 Ga0495625_0000167_25006_25413 135
358 3300046660 Ga0495625_0057825 Ga0495625_0057825_1214_1624 135
359 3300046660 Ga0495625_0100717 Ga0495625_0100717_1036_1443 135
360 3300046660 Ga0495625_0594830 Ga0495625_0594830_232_639 135
361 3300046690 Ga0495624_0651219 Ga0495624_0651219_136_546 135
362 3300046691 Ga0495670_0078881 Ga0495670_0078881_974_1384 135
363 3300046692 Ga0495671_0355154 Ga0495671_0355154_219_629 135
364 3300046694 Ga0495649_0074373 Ga0495649_0074373_596_1006 135
365 3300046809 Ga0495600_0046592 Ga0495600_0046592_726_1136 135
366 3300046810 Ga0495660_0153901 Ga0495660_0153901_137_547 135
367 3300047320 Ga0495672_0405175 Ga0495672_0405175_179_595 135
368 3300047323 Ga0495683_0007573 Ga0495683_0007573_3289_3696 135
369 3300047443 Ga0495687_000973 Ga0495687_000973_25525_25932 135
370 3300047445 Ga0495677_0008856 Ga0495677_0008856_1523_1930 135
371 3300047445 Ga0495677_0083309 Ga0495677_0083309_104_511 135
372 3300047469 Ga0495673_0199612 Ga0495673_0199612_217_624 135
373 3300047470 Ga0495681_0013093 Ga0495681_0013093_1569_1976 135
374 3300047472 Ga0495686_0001337 Ga0495686_0001337_5625_6059 135
375 3300048904 Ga0496101_0681247 Ga0496101_0681247_227_634 135
376 3300048905 Ga0496102_0001617 Ga0496102_0001617_8961_9368 135
377 3300048906 Ga0496103_0000173 Ga0496103_0000173_52102_52515 135
378 3300048906 Ga0496103_0000457 Ga0496103_0000457_402_809 135
379 3300048907 Ga0496104_0111901 Ga0496104_0111901_591_998 135
380 3300048908 Ga0496105_0007688 Ga0496105_0007688_7586_7993 135
381 3300048908 Ga0496105_0481574 Ga0496105_0481574_411_824 135
382 3300048912 Ga0496109_1556945 Ga0496109_1556945_58_468 135
383 3300048913 Ga0496110_0055510 Ga0496110_0055510_404_811 135
384 3300048914 Ga0496111_0003239 Ga0496111_0003239_411_818 135
385 3300048917 Ga0496114_0023337 Ga0496114_0023337_346_753 135
386 3300048918 Ga0496115_0001154 Ga0496115_0001154_18344_18751 135
387 3300048919 Ga0496116_0000566 Ga0496116_0000566_43332_43745 135
388 3300048919 Ga0496116_0020367 Ga0496116_0020367_4304_4711 135
389 3300048920 Ga0496117_0000424 Ga0496117_0000424_35852_36259 135
390 3300048920 Ga0496117_0000485 Ga0496117_0000485_14095_14508 135
391 3300048921 Ga0496118_0000190 Ga0496118_0000190_14095_14508 135
392 3300048921 Ga0496118_0001508 Ga0496118_0001508_33932_34339 135
393 3300048922 Ga0496119_0021776 Ga0496119_0021776_2289_2702 135
394 3300048922 Ga0496119_0029743 Ga0496119_0029743_2988_3395 135
395 3300048923 Ga0496120_0025696 Ga0496120_0025696_2238_2651 135
396 3300048923 Ga0496120_0256453 Ga0496120_0256453_248_655 135
397 3300048924 Ga0496121_0000597 Ga0496121_0000597_35784_36191 135
398 3300048925 Ga0496122_0009971 Ga0496122_0009971_315_722 135
399 3300048926 Ga0496123_0086072 Ga0496123_0086072_278_685 135
400 3300048927 Ga0496124_0000082 Ga0496124_0000082_172473_172880 135
401 3300048927 Ga0496124_0000546 Ga0496124_0000546_49117_49530 135
402 3300048928 Ga0496125_0000638 Ga0496125_0000638_57841_58248 135
403 3300048929 Ga0496126_0001589 Ga0496126_0001589_33943_34350 135
404 3300048929 Ga0496126_1130809 Ga0496126_1130809_12_434 135
405 3300049530 Ga0501314_003841 Ga0501314_003841_81_494 135
406 3300049581 Ga0501047_1215355 Ga0501047_1215355_97_504 135
407 3300049663 Ga0501223_000821 Ga0501223_000821_2564_2977 135
408 3300049664 Ga0501224_000033 Ga0501224_000033_32076_32489 135
409 3300049705 Ga0501225_0000791 Ga0501225_0000791_6488_6901 135
410 3300049707 Ga0501234_000286 Ga0501234_000286_1513_1926 135
411 3300049822 Ga0501035_0269349 Ga0501035_0269349_259_672 135
412 3300049853 Ga0501226_000056 Ga0501226_000056_32030_32443 135
413 3300050493 nmdc:mga0k408_119652_c1 nmdc:mga0k408_119652_c1_956_1363 135
414 3300050509 nmdc:mga0qj67_19080_c1 nmdc:mga0qj67_19080_c1_421_843 135
415 3300050516 nmdc:mga0sz30_580432_c1 nmdc:mga0sz30_580432_c1_23_433 135
416 3300053079 Ga0500610_0000143 Ga0500610_0000143_7849_8259 135
417 3300053119 Ga0500595_004157 Ga0500595_004157_230_640 135
418 3300053120 Ga0500597_078262 Ga0500597_078262_520_933 135
419 3300053130 Ga0500642_0004333 Ga0500642_0004333_3831_4238 135
420 3300053140 Ga0500573_0000034 Ga0500573_0000034_38577_38987 135
421 3300053151 Ga0500604_0054094 Ga0500604_0054094_182_598 135
422 3300053157 Ga0500624_000001 Ga0500624_000001_79921_80334 135
423 3300053177 Ga0500636_0006292 Ga0500636_0006292_4994_5404 135
424 3300053178 Ga0500637_0000156 Ga0500637_0000156_15260_15673 135
425 3300053730 Ga0500645_000011 Ga0500645_000011_71188_71598 135
426 3300053735 Ga0500596_023196 Ga0500596_023196_388_798 135
427 3300053739 Ga0500587_029146 Ga0500587_029146_277_684 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

41

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.9507 1 134
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.9433 1 132
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.9373 1 134
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.9168 1 132
5nq6-assembly1.cif.gz_A crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution 0.8951 3 132
ID Description Score Start End Superfamily
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9433 1 132 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9368 15 134 3.90.1010.10
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9168 1 132 3.90.1010.10
af_Q10RM2_1_106_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.901 33 134 3.90.1010.10
af_Q6K258_62_207_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8843 2 131 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2T4I674-F1-model_v4 Fe-S metabolism protein SufE 1.003 3 134
AF-A0A031JFY1-F1-model_v4 deleted 1.002 1 135
AF-A0A2A4IAS1-F1-model_v4 Fe-S metabolism protein SufE 1.002 2 135
AF-A0A258GWD5-F1-model_v4 Fe-S metabolism protein SufE 1.002 17 135
AF-A5VAI0-F1-model_v4 deleted 0.9963 2 133

Feature Viewer

pLDDT pTM Quality
94.84 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map