F441523
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 427 | 253 | 426 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300046506|Ga0495583_0017315|Ga0495583_0017315_999_1505 |
| Length | 168 |
| Sequence | MEVAAARSRRRTRTLKQVQGAVGLGGKDAIARTMPSLSDLHDEYEFLDADDRYRLLIDLGRTLEPMPEALKTDATLVRGCSASVWVYPTVRDDGALHFLADSNAAITKGIIALVLLTVQDRQPADILATDIEAALAPFDLRNQLSSNRTQGIPNMIALIKATAERYAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 74 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 146 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 147 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 151 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 161 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 210 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 211 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 232 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 237 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 244 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 245 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 247 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 248 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 249 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 251 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 252 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.83 |
| Metatranscriptomes | 0.94 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.79 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 81.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1041488 | 3300001904 | Bacteria | 707 |
| 2 | JGI24741J21665_1000978 | 3300001915 | Bacteria | 8581 |
| 3 | JGI24741J21665_1006510 | 3300001915 | Bacteria | 2341 |
| 4 | JGI24741J21665_1008203 | 3300001915 | Bacteria | 1982 |
| 5 | JGI24740J21852_10029863 | 3300001979 | Bacteria | 1783 |
| 6 | JGI24737J22298_10013770 | 3300001990 | Bacteria | 2630 |
| 7 | JGI24735J21928_10131461 | 3300002067 | Bacteria | 721 |
| 8 | JGI24749J21850_1000020 | 3300002076 | Bacteria | 31050 |
| 9 | JGI24744J21845_10039723 | 3300002077 | Bacteria | 882 |
| 10 | JGI24034J26672_10017695 | 3300002239 | Bacteria | 1104 |
| 11 | JGI24751J29686_10000177 | 3300002459 | Bacteria | 29687 |
| 12 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 13 | Ga0055525_1000051 | 3300003759 | Bacteria | 240942 |
| 14 | Ga0055542_1000020 | 3300003762 | Bacteria | 335745 |
| 15 | Ga0055529_1000016 | 3300003763 | Bacteria | 364775 |
| 16 | Ga0065707_10111756 | 3300005295 | Bacteria | 2384 |
| 17 | Ga0070658_10000029 | 3300005327 | Bacteria | 156910 |
| 18 | Ga0070658_10000077 | 3300005327 | Bacteria | 94332 |
| 19 | Ga0070658_10099945 | 3300005327 | Bacteria | 2397 |
| 20 | Ga0070676_10747240 | 3300005328 | Bacteria | 718 |
| 21 | Ga0070676_11070766 | 3300005328 | Bacteria | 608 |
| 22 | Ga0070690_100463110 | 3300005330 | Bacteria | 942 |
| 23 | Ga0070670_100000008 | 3300005331 | Bacteria | 292132 |
| 24 | Ga0070670_100000570 | 3300005331 | Bacteria | 29190 |
| 25 | Ga0070670_100234409 | 3300005331 | Bacteria | 1597 |
| 26 | Ga0070670_100332690 | 3300005331 | Bacteria | 1332 |
| 27 | Ga0068869_100086685 | 3300005334 | Bacteria | 2347 |
| 28 | Ga0070666_11302078 | 3300005335 | Bacteria | 542 |
| 29 | Ga0070660_100185490 | 3300005339 | Bacteria | 1684 |
| 30 | Ga0070660_100411622 | 3300005339 | Bacteria | 1119 |
| 31 | Ga0070661_100001114 | 3300005344 | Bacteria | 18878 |
| 32 | Ga0070661_100155532 | 3300005344 | Bacteria | 1730 |
| 33 | Ga0070661_100236916 | 3300005344 | Bacteria | 1404 |
| 34 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 35 | Ga0070668_100009825 | 3300005347 | Bacteria | 7089 |
| 36 | Ga0070668_100739499 | 3300005347 | Bacteria | 870 |
| 37 | Ga0070669_100000240 | 3300005353 | Bacteria | 45481 |
| 38 | Ga0070669_100022464 | 3300005353 | Bacteria | 4510 |
| 39 | Ga0070669_100145210 | 3300005353 | Bacteria | 1833 |
| 40 | Ga0070669_100726683 | 3300005353 | Bacteria | 840 |
| 41 | Ga0070675_100167969 | 3300005354 | Bacteria | 1890 |
| 42 | Ga0070675_101643082 | 3300005354 | Bacteria | 593 |
| 43 | Ga0070671_100000167 | 3300005355 | Bacteria | 43269 |
| 44 | Ga0070671_100017555 | 3300005355 | Bacteria | 5798 |
| 45 | Ga0070671_100067759 | 3300005355 | Bacteria | 2976 |
| 46 | Ga0070671_100376537 | 3300005355 | Bacteria | 1213 |
| 47 | Ga0070674_100000284 | 3300005356 | Bacteria | 24799 |
| 48 | Ga0070674_100201632 | 3300005356 | Bacteria | 1537 |
| 49 | Ga0070673_100123619 | 3300005364 | Bacteria | 2162 |
| 50 | Ga0070673_100300608 | 3300005364 | Bacteria | 1413 |
| 51 | Ga0070659_100111827 | 3300005366 | Bacteria | 2205 |
| 52 | Ga0070659_100208666 | 3300005366 | Bacteria | 1609 |
| 53 | Ga0070659_100247460 | 3300005366 | Bacteria | 1477 |
| 54 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 55 | Ga0070667_100001022 | 3300005367 | Bacteria | 25550 |
| 56 | Ga0070667_100212696 | 3300005367 | Bacteria | 1719 |
| 57 | Ga0070663_100063589 | 3300005455 | Bacteria | 2665 |
| 58 | Ga0070678_100000043 | 3300005456 | Bacteria | 43023 |
| 59 | Ga0070662_100075342 | 3300005457 | Bacteria | 2498 |
| 60 | Ga0068867_100054692 | 3300005459 | Bacteria | 2949 |
| 61 | Ga0070684_100354800 | 3300005535 | Bacteria | 1349 |
| 62 | Ga0068853_100141494 | 3300005539 | Bacteria | 2160 |
| 63 | Ga0068853_100183689 | 3300005539 | Bacteria | 1897 |
| 64 | Ga0070665_100000535 | 3300005548 | Bacteria | 53560 |
| 65 | Ga0070665_100740459 | 3300005548 | Bacteria | 996 |
| 66 | Ga0068855_100002699 | 3300005563 | Bacteria | 21866 |
| 67 | Ga0068855_100196903 | 3300005563 | Bacteria | 2270 |
| 68 | Ga0068855_100931108 | 3300005563 | Bacteria | 916 |
| 69 | Ga0070664_100276778 | 3300005564 | Bacteria | 1513 |
| 70 | Ga0070664_100384183 | 3300005564 | Bacteria | 1282 |
| 71 | Ga0068857_100028595 | 3300005577 | Bacteria | 4919 |
| 72 | Ga0068857_100507712 | 3300005577 | Bacteria | 1132 |
| 73 | Ga0068857_101301047 | 3300005577 | Bacteria | 705 |
| 74 | Ga0068854_100033178 | 3300005578 | Bacteria | 3598 |
| 75 | Ga0068854_100177321 | 3300005578 | Bacteria | 1662 |
| 76 | Ga0068854_100188008 | 3300005578 | Bacteria | 1617 |
| 77 | Ga0068856_100052505 | 3300005614 | Bacteria | 4020 |
| 78 | Ga0068856_100103811 | 3300005614 | Bacteria | 2836 |
| 79 | Ga0068856_100205243 | 3300005614 | Bacteria | 1985 |
| 80 | Ga0068852_100003815 | 3300005616 | Bacteria | 10581 |
| 81 | Ga0068852_101000875 | 3300005616 | Bacteria | 854 |
| 82 | Ga0068852_101503165 | 3300005616 | Bacteria | 696 |
| 83 | Ga0068859_100002976 | 3300005617 | Bacteria | 17180 |
| 84 | Ga0068859_100023802 | 3300005617 | Bacteria | 6147 |
| 85 | Ga0068859_100028919 | 3300005617 | Bacteria | 5560 |
| 86 | Ga0068859_100072333 | 3300005617 | Bacteria | 3485 |
| 87 | Ga0068859_101843859 | 3300005617 | Bacteria | 668 |
| 88 | Ga0068864_100000027 | 3300005618 | Bacteria | 229759 |
| 89 | Ga0068866_10177524 | 3300005718 | Bacteria | 1255 |
| 90 | Ga0068861_100000879 | 3300005719 | Bacteria | 18239 |
| 91 | Ga0068861_100056780 | 3300005719 | Bacteria | 2989 |
| 92 | Ga0068861_100073568 | 3300005719 | Bacteria | 2655 |
| 93 | Ga0068861_100073769 | 3300005719 | Bacteria | 2652 |
| 94 | Ga0068851_10051088 | 3300005834 | Bacteria | 2100 |
| 95 | Ga0068851_10551453 | 3300005834 | Bacteria | 697 |
| 96 | Ga0068863_100001776 | 3300005841 | Bacteria | 21388 |
| 97 | Ga0068863_100009676 | 3300005841 | Bacteria | 9407 |
| 98 | Ga0068863_100049253 | 3300005841 | Bacteria | 3995 |
| 99 | Ga0068863_100304188 | 3300005841 | Bacteria | 1547 |
| 100 | Ga0068858_100000412 | 3300005842 | Bacteria | 44458 |
| 101 | Ga0068858_100002389 | 3300005842 | Bacteria | 18994 |
| 102 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 103 | Ga0068860_100000120 | 3300005843 | Bacteria | 125823 |
| 104 | Ga0068862_100000143 | 3300005844 | Bacteria | 80650 |
| 105 | Ga0068862_100000365 | 3300005844 | Bacteria | 49043 |
| 106 | Ga0081539_10057928 | 3300005985 | Bacteria | 2141 |
| 107 | Ga0075364_10713748 | 3300006051 | Bacteria | 684 |
| 108 | Ga0075369_10033067 | 3300006186 | Bacteria | 2190 |
| 109 | Ga0075369_10451651 | 3300006186 | Bacteria | 609 |
| 110 | Ga0075366_10614979 | 3300006195 | Bacteria | 674 |
| 111 | Ga0097621_100052964 | 3300006237 | Bacteria | 3307 |
| 112 | Ga0097621_102190756 | 3300006237 | Bacteria | 529 |
| 113 | Ga0068871_100323224 | 3300006358 | Bacteria | 1359 |
| 114 | Ga0097620_100002976 | 3300006931 | Bacteria | 17180 |
| 115 | Ga0097620_100023802 | 3300006931 | Bacteria | 6147 |
| 116 | Ga0097620_100028919 | 3300006931 | Bacteria | 5560 |
| 117 | Ga0097620_100072334 | 3300006931 | Bacteria | 3485 |
| 118 | Ga0097620_101843474 | 3300006931 | Bacteria | 668 |
| 119 | Ga0105240_10056792 | 3300009093 | Bacteria | 4896 |
| 120 | Ga0105240_10951627 | 3300009093 | Bacteria | 921 |
| 121 | Ga0105240_11089184 | 3300009093 | Bacteria | 851 |
| 122 | Ga0105245_10001962 | 3300009098 | Bacteria | 18682 |
| 123 | Ga0105247_10845663 | 3300009101 | Bacteria | 702 |
| 124 | Ga0105243_10000038 | 3300009148 | Bacteria | 174351 |
| 125 | Ga0105241_10006215 | 3300009174 | Bacteria | 8808 |
| 126 | Ga0105241_10516443 | 3300009174 | Bacteria | 1068 |
| 127 | Ga0105242_10205422 | 3300009176 | Bacteria | 1752 |
| 128 | Ga0105242_10289857 | 3300009176 | Bacteria | 1490 |
| 129 | Ga0105248_10000156 | 3300009177 | Bacteria | 79110 |
| 130 | Ga0105248_10004792 | 3300009177 | Bacteria | 14977 |
| 131 | Ga0105248_10049231 | 3300009177 | Bacteria | 4726 |
| 132 | Ga0105248_10261711 | 3300009177 | Bacteria | 1947 |
| 133 | Ga0105237_10351675 | 3300009545 | Bacteria | 1478 |
| 134 | Ga0105237_10357223 | 3300009545 | Bacteria | 1465 |
| 135 | Ga0105238_10145702 | 3300009551 | Bacteria | 2345 |
| 136 | Ga0105238_10187309 | 3300009551 | Bacteria | 2046 |
| 137 | Ga0105238_10328047 | 3300009551 | Bacteria | 1517 |
| 138 | Ga0105249_10270258 | 3300009553 | Bacteria | 1693 |
| 139 | Ga0105249_10631378 | 3300009553 | Bacteria | 1128 |
| 140 | Ga0105249_12049827 | 3300009553 | Bacteria | 645 |
| 141 | Ga0105239_10292340 | 3300010375 | Bacteria | 1835 |
| 142 | Ga0105246_10470669 | 3300011119 | Bacteria | 1061 |
| 143 | Ga0157327_1006219 | 3300012512 | Bacteria | 998 |
| 144 | Ga0157326_1034753 | 3300012513 | Bacteria | 683 |
| 145 | Ga0157373_10224462 | 3300013100 | Bacteria | 1326 |
| 146 | Ga0157373_10869836 | 3300013100 | Bacteria | 667 |
| 147 | Ga0157371_10000146 | 3300013102 | Bacteria | 103290 |
| 148 | Ga0157370_10356740 | 3300013104 | Bacteria | 1347 |
| 149 | Ga0157369_10892146 | 3300013105 | Bacteria | 912 |
| 150 | Ga0157374_10265841 | 3300013296 | Bacteria | 1691 |
| 151 | Ga0157374_10458264 | 3300013296 | Bacteria | 1277 |
| 152 | Ga0157378_10114288 | 3300013297 | Bacteria | 2479 |
| 153 | Ga0157378_10510569 | 3300013297 | Bacteria | 1202 |
| 154 | Ga0157378_11111995 | 3300013297 | Bacteria | 827 |
| 155 | Ga0163162_11289153 | 3300013306 | Bacteria | 830 |
| 156 | Ga0157372_10258128 | 3300013307 | Bacteria | 2024 |
| 157 | Ga0157372_10788676 | 3300013307 | Bacteria | 1104 |
| 158 | Ga0157375_11568481 | 3300013308 | Bacteria | 778 |
| 159 | Ga0163163_10612395 | 3300014325 | Bacteria | 1152 |
| 160 | Ga0157380_10000416 | 3300014326 | Bacteria | 25905 |
| 161 | Ga0157379_10027765 | 3300014968 | Bacteria | 5037 |
| 162 | Ga0163161_11602377 | 3300017792 | Bacteria | 574 |
| 163 | Ga0206354_10728589 | 3300020081 | Bacteria | 961 |
| 164 | Ga0206353_11000466 | 3300020082 | Bacteria | 7140 |
| 165 | Ga0213875_10000415 | 3300021388 | Bacteria | 37517 |
| 166 | Ga0209674_106880 | 3300025226 | Bacteria | 1493 |
| 167 | Ga0209563_100019 | 3300025230 | Bacteria | 697828 |
| 168 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 169 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 170 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 171 | Ga0207656_10003278 | 3300025321 | Bacteria | 5546 |
| 172 | Ga0207680_10049539 | 3300025903 | Bacteria | 2501 |
| 173 | Ga0207680_10152224 | 3300025903 | Bacteria | 1543 |
| 174 | Ga0207647_10006193 | 3300025904 | Bacteria | 8717 |
| 175 | Ga0207645_10029774 | 3300025907 | Bacteria | 3518 |
| 176 | Ga0207643_10695113 | 3300025908 | Bacteria | 657 |
| 177 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 178 | Ga0207705_10000182 | 3300025909 | Bacteria | 66143 |
| 179 | Ga0207705_10054808 | 3300025909 | Bacteria | 2874 |
| 180 | Ga0207705_10171343 | 3300025909 | Bacteria | 1634 |
| 181 | Ga0207654_10005373 | 3300025911 | Bacteria | 6475 |
| 182 | Ga0207707_10431581 | 3300025912 | Bacteria | 1128 |
| 183 | Ga0207695_10042140 | 3300025913 | Bacteria | 4880 |
| 184 | Ga0207695_10564408 | 3300025913 | Bacteria | 1020 |
| 185 | Ga0207695_10821423 | 3300025913 | Bacteria | 810 |
| 186 | Ga0207671_10007048 | 3300025914 | Bacteria | 9844 |
| 187 | Ga0207671_10216590 | 3300025914 | Bacteria | 1499 |
| 188 | Ga0207660_10098688 | 3300025917 | Bacteria | 2179 |
| 189 | Ga0207657_10285162 | 3300025919 | Bacteria | 1310 |
| 190 | Ga0207657_10322960 | 3300025919 | Bacteria | 1220 |
| 191 | Ga0207657_10340975 | 3300025919 | Bacteria | 1183 |
| 192 | Ga0207649_10008115 | 3300025920 | Bacteria | 5713 |
| 193 | Ga0207649_10095049 | 3300025920 | Bacteria | 1960 |
| 194 | Ga0207649_10112047 | 3300025920 | Bacteria | 1825 |
| 195 | Ga0207652_10843417 | 3300025921 | Bacteria | 812 |
| 196 | Ga0207681_10000022 | 3300025923 | Bacteria | 230079 |
| 197 | Ga0207681_10117303 | 3300025923 | Bacteria | 1946 |
| 198 | Ga0207694_10011662 | 3300025924 | Bacteria | 6630 |
| 199 | Ga0207694_10130618 | 3300025924 | Bacteria | 2013 |
| 200 | Ga0207650_10000019 | 3300025925 | Bacteria | 344751 |
| 201 | Ga0207650_10000020 | 3300025925 | Bacteria | 342596 |
| 202 | Ga0207650_10014606 | 3300025925 | Bacteria | 5454 |
| 203 | Ga0207650_10380785 | 3300025925 | Bacteria | 1165 |
| 204 | Ga0207650_10801056 | 3300025925 | Bacteria | 798 |
| 205 | Ga0207659_10579490 | 3300025926 | Bacteria | 955 |
| 206 | Ga0207644_10000047 | 3300025931 | Bacteria | 103158 |
| 207 | Ga0207644_10129027 | 3300025931 | Bacteria | 1933 |
| 208 | Ga0207644_10611364 | 3300025931 | Bacteria | 905 |
| 209 | Ga0207690_10003832 | 3300025932 | Bacteria | 8899 |
| 210 | Ga0207690_10166446 | 3300025932 | Bacteria | 1648 |
| 211 | Ga0207690_10320089 | 3300025932 | Bacteria | 1219 |
| 212 | Ga0207706_10041501 | 3300025933 | Bacteria | 4079 |
| 213 | Ga0207709_10000031 | 3300025935 | Bacteria | 329046 |
| 214 | Ga0207669_10000079 | 3300025937 | Bacteria | 49257 |
| 215 | Ga0207669_10148698 | 3300025937 | Bacteria | 1637 |
| 216 | Ga0207711_10001087 | 3300025941 | Bacteria | 25938 |
| 217 | Ga0207711_10003462 | 3300025941 | Bacteria | 13667 |
| 218 | Ga0207711_10885969 | 3300025941 | Bacteria | 830 |
| 219 | Ga0207711_11393209 | 3300025941 | Bacteria | 644 |
| 220 | Ga0207679_10407324 | 3300025945 | Bacteria | 1197 |
| 221 | Ga0207679_10543587 | 3300025945 | Bacteria | 1041 |
| 222 | Ga0207667_10000220 | 3300025949 | Bacteria | 80179 |
| 223 | Ga0207667_10004725 | 3300025949 | Bacteria | 16676 |
| 224 | Ga0207667_10478790 | 3300025949 | Bacteria | 1264 |
| 225 | Ga0207651_10101579 | 3300025960 | Bacteria | 2135 |
| 226 | Ga0207712_10303778 | 3300025961 | Bacteria | 1311 |
| 227 | Ga0207712_10525706 | 3300025961 | Bacteria | 1014 |
| 228 | Ga0207712_10698442 | 3300025961 | Bacteria | 885 |
| 229 | Ga0207668_10000043 | 3300025972 | Bacteria | 103738 |
| 230 | Ga0207668_10135867 | 3300025972 | Bacteria | 1884 |
| 231 | Ga0207640_10006151 | 3300025981 | Bacteria | 6570 |
| 232 | Ga0207640_10014457 | 3300025981 | Bacteria | 4546 |
| 233 | Ga0207640_10451989 | 3300025981 | Bacteria | 1059 |
| 234 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 235 | Ga0207658_10001027 | 3300025986 | Bacteria | 22729 |
| 236 | Ga0207703_10003516 | 3300026035 | Bacteria | 13106 |
| 237 | Ga0207639_10068115 | 3300026041 | Bacteria | 2772 |
| 238 | Ga0207639_10116580 | 3300026041 | Bacteria | 2187 |
| 239 | Ga0207678_10004217 | 3300026067 | Bacteria | 12903 |
| 240 | Ga0207702_10003378 | 3300026078 | Bacteria | 14631 |
| 241 | Ga0207702_10249784 | 3300026078 | Bacteria | 1665 |
| 242 | Ga0207702_10711177 | 3300026078 | Bacteria | 990 |
| 243 | Ga0207641_10000294 | 3300026088 | Bacteria | 62469 |
| 244 | Ga0207641_10012528 | 3300026088 | Bacteria | 6951 |
| 245 | Ga0207648_10061940 | 3300026089 | Bacteria | 3262 |
| 246 | Ga0207676_10000022 | 3300026095 | Bacteria | 296286 |
| 247 | Ga0207676_10148646 | 3300026095 | Bacteria | 2015 |
| 248 | Ga0207676_10900482 | 3300026095 | Bacteria | 868 |
| 249 | Ga0207674_10007739 | 3300026116 | Bacteria | 12506 |
| 250 | Ga0207674_10065229 | 3300026116 | Bacteria | 3671 |
| 251 | Ga0207674_10223792 | 3300026116 | Bacteria | 1830 |
| 252 | Ga0207675_100000049 | 3300026118 | Bacteria | 84016 |
| 253 | Ga0207675_100001151 | 3300026118 | Bacteria | 26249 |
| 254 | Ga0207675_100257143 | 3300026118 | Bacteria | 1692 |
| 255 | Ga0207675_101114564 | 3300026118 | Bacteria | 809 |
| 256 | Ga0207683_10000418 | 3300026121 | Bacteria | 39246 |
| 257 | Ga0207698_10126356 | 3300026142 | Bacteria | 2176 |
| 258 | Ga0207698_10145553 | 3300026142 | Bacteria | 2049 |
| 259 | Ga0207698_11277523 | 3300026142 | Bacteria | 749 |
| 260 | Ga0209999_1055318 | 3300027543 | Bacteria | 752 |
| 261 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 262 | Ga0268266_10813914 | 3300028379 | Bacteria | 902 |
| 263 | Ga0268265_10000031 | 3300028380 | Bacteria | 226725 |
| 264 | Ga0268265_10000143 | 3300028380 | Bacteria | 90469 |
| 265 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 266 | Ga0307517_10107974 | 3300028786 | Bacteria | 2140 |
| 267 | Ga0307517_10155161 | 3300028786 | Bacteria | 1556 |
| 268 | Ga0307513_10044569 | 3300031456 | Bacteria | 4858 |
| 269 | Ga0307513_10076258 | 3300031456 | Bacteria | 3478 |
| 270 | Ga0307408_100397560 | 3300031548 | Bacteria | 1182 |
| 271 | Ga0307413_10008465 | 3300031824 | Bacteria | 4859 |
| 272 | Ga0307413_10154279 | 3300031824 | Bacteria | 1604 |
| 273 | Ga0307413_10325179 | 3300031824 | Bacteria | 1176 |
| 274 | Ga0307410_10311988 | 3300031852 | Bacteria | 1245 |
| 275 | Ga0307410_11185665 | 3300031852 | Bacteria | 665 |
| 276 | Ga0307406_10007002 | 3300031901 | Bacteria | 6243 |
| 277 | Ga0307412_10000557 | 3300031911 | Bacteria | 22165 |
| 278 | Ga0307412_10013770 | 3300031911 | Bacteria | 4751 |
| 279 | Ga0307412_10083479 | 3300031911 | Bacteria | 2215 |
| 280 | Ga0307412_10747383 | 3300031911 | Bacteria | 844 |
| 281 | Ga0307416_100092066 | 3300032002 | Bacteria | 2606 |
| 282 | Ga0307414_10000288 | 3300032004 | Bacteria | 29634 |
| 283 | Ga0307414_11348331 | 3300032004 | Bacteria | 662 |
| 284 | Ga0307414_11924776 | 3300032004 | Bacteria | 552 |
| 285 | Ga0307411_11298353 | 3300032005 | Bacteria | 663 |
| 286 | Ga0307415_101819415 | 3300032126 | Unclassified | 590 |
| 287 | Ga0307510_10369622 | 3300033180 | Bacteria | 881 |
| 288 | Ga0373937_0268196 | 3300036401 | Bacteria | 1611 |
| 289 | Ga0395899_0810078 | 3300037312 | Bacteria | 578 |
| 290 | Ga0395905_0082648 | 3300037471 | Bacteria | 3010 |
| 291 | Ga0395905_0910011 | 3300037471 | Bacteria | 783 |
| 292 | Ga0436364_1487636 | 3300037853 | Bacteria | 30336 |
| 293 | Ga0395901_0380357 | 3300038443 | Bacteria | 1453 |
| 294 | Ga0436365_1480551 | 3300039437 | Bacteria | 997 |
| 295 | Ga0436363_0292113 | 3300039450 | Bacteria | 2199 |
| 296 | Ga0451847_0322971 | 3300041503 | Bacteria | 534 |
| 297 | Ga0466963_0623115 | 3300044694 | Bacteria | 762 |
| 298 | Ga0495617_065633 | 3300046452 | Bacteria | 1197 |
| 299 | Ga0495650_0000492 | 3300046471 | Bacteria | 59983 |
| 300 | Ga0495584_0065461 | 3300046491 | Bacteria | 1828 |
| 301 | Ga0495585_0054568 | 3300046492 | Bacteria | 2209 |
| 302 | Ga0495585_0130457 | 3300046492 | Bacteria | 1323 |
| 303 | Ga0495596_0007772 | 3300046500 | Bacteria | 4813 |
| 304 | Ga0495607_0086043 | 3300046501 | Bacteria | 1715 |
| 305 | Ga0495583_0002265 | 3300046506 | Bacteria | 16893 |
| 306 | Ga0495583_0017315 | 3300046506 | Bacteria | 3830 |
| 307 | Ga0495583_0023515 | 3300046506 | Bacteria | 3115 |
| 308 | Ga0495606_0001167 | 3300046507 | Bacteria | 37141 |
| 309 | Ga0495606_0106327 | 3300046507 | Bacteria | 1699 |
| 310 | Ga0495606_0385095 | 3300046507 | Bacteria | 734 |
| 311 | Ga0495616_0138872 | 3300046513 | Bacteria | 1108 |
| 312 | Ga0495631_0037626 | 3300046518 | Bacteria | 2155 |
| 313 | Ga0495643_0001143 | 3300046522 | Bacteria | 26034 |
| 314 | Ga0495643_0002634 | 3300046522 | Bacteria | 13930 |
| 315 | Ga0495643_0032834 | 3300046522 | Bacteria | 2878 |
| 316 | Ga0495643_0215249 | 3300046522 | Bacteria | 914 |
| 317 | Ga0495643_0290954 | 3300046522 | Bacteria | 748 |
| 318 | Ga0495648_0000430 | 3300046524 | Bacteria | 45832 |
| 319 | Ga0495648_0214036 | 3300046524 | Bacteria | 955 |
| 320 | Ga0495663_0000448 | 3300046525 | Bacteria | 15077 |
| 321 | Ga0495587_0409743 | 3300046536 | Bacteria | 753 |
| 322 | Ga0495609_0179358 | 3300046538 | Bacteria | 892 |
| 323 | Ga0495633_0006053 | 3300046558 | Bacteria | 7255 |
| 324 | Ga0495633_0023766 | 3300046558 | Bacteria | 3034 |
| 325 | Ga0495633_0296845 | 3300046558 | Bacteria | 734 |
| 326 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 327 | Ga0495668_0419839 | 3300046616 | Bacteria | 735 |
| 328 | Ga0495611_0010553 | 3300046648 | Bacteria | 3908 |
| 329 | Ga0495611_0036236 | 3300046648 | Bacteria | 2188 |
| 330 | Ga0495625_0000167 | 3300046660 | Bacteria | 102783 |
| 331 | Ga0495625_0057825 | 3300046660 | Bacteria | 2756 |
| 332 | Ga0495625_0100717 | 3300046660 | Bacteria | 1985 |
| 333 | Ga0495625_0594830 | 3300046660 | Bacteria | 665 |
| 334 | Ga0495624_0651219 | 3300046690 | Bacteria | 627 |
| 335 | Ga0495670_0078881 | 3300046691 | Bacteria | 1675 |
| 336 | Ga0495671_0355154 | 3300046692 | Bacteria | 703 |
| 337 | Ga0495649_0074373 | 3300046694 | Bacteria | 1820 |
| 338 | Ga0495600_0046592 | 3300046809 | Bacteria | 2828 |
| 339 | Ga0495660_0153901 | 3300046810 | Bacteria | 1133 |
| 340 | Ga0495672_0405175 | 3300047320 | Bacteria | 623 |
| 341 | Ga0495683_0007573 | 3300047323 | Bacteria | 5855 |
| 342 | Ga0495687_000973 | 3300047443 | Bacteria | 29058 |
| 343 | Ga0495677_0008856 | 3300047445 | Bacteria | 3727 |
| 344 | Ga0495677_0083309 | 3300047445 | Bacteria | 1200 |
| 345 | Ga0495673_0199612 | 3300047469 | Bacteria | 749 |
| 346 | Ga0495681_0013093 | 3300047470 | Bacteria | 4836 |
| 347 | Ga0495686_0001337 | 3300047472 | Bacteria | 27585 |
| 348 | Ga0495686_0010076 | 3300047472 | Bacteria | 6750 |
| 349 | Ga0495686_0085895 | 3300047472 | Bacteria | 1915 |
| 350 | Ga0496100_0376874 | 3300048903 | Bacteria | 1077 |
| 351 | Ga0496101_0515111 | 3300048904 | Bacteria | 945 |
| 352 | Ga0496101_0681247 | 3300048904 | Bacteria | 812 |
| 353 | Ga0496102_0001617 | 3300048905 | Bacteria | 19867 |
| 354 | Ga0496103_0000173 | 3300048906 | Bacteria | 67412 |
| 355 | Ga0496103_0000457 | 3300048906 | Bacteria | 34763 |
| 356 | Ga0496104_0097442 | 3300048907 | Bacteria | 2815 |
| 357 | Ga0496104_0111901 | 3300048907 | Bacteria | 2618 |
| 358 | Ga0496105_0007688 | 3300048908 | Bacteria | 8358 |
| 359 | Ga0496105_0260581 | 3300048908 | Bacteria | 1402 |
| 360 | Ga0496105_0481574 | 3300048908 | Bacteria | 976 |
| 361 | Ga0496107_0432613 | 3300048910 | Bacteria | 978 |
| 362 | Ga0496108_0026662 | 3300048911 | Bacteria | 4768 |
| 363 | Ga0496109_1556945 | 3300048912 | Bacteria | 596 |
| 364 | Ga0496110_0055510 | 3300048913 | Bacteria | 3486 |
| 365 | Ga0496111_0003239 | 3300048914 | Bacteria | 10047 |
| 366 | Ga0496111_0106460 | 3300048914 | Bacteria | 2064 |
| 367 | Ga0496113_0028315 | 3300048916 | Bacteria | 4028 |
| 368 | Ga0496113_0086138 | 3300048916 | Bacteria | 2414 |
| 369 | Ga0496114_0023337 | 3300048917 | Bacteria | 5048 |
| 370 | Ga0496115_0001154 | 3300048918 | Bacteria | 19089 |
| 371 | Ga0496116_0000566 | 3300048919 | Bacteria | 49509 |
| 372 | Ga0496116_0020367 | 3300048919 | Bacteria | 5039 |
| 373 | Ga0496117_0000424 | 3300048920 | Bacteria | 71078 |
| 374 | Ga0496117_0000485 | 3300048920 | Bacteria | 65840 |
| 375 | Ga0496118_0000190 | 3300048921 | Bacteria | 108017 |
| 376 | Ga0496118_0001508 | 3300048921 | Bacteria | 34697 |
| 377 | Ga0496119_0021776 | 3300048922 | Bacteria | 4617 |
| 378 | Ga0496119_0029743 | 3300048922 | Bacteria | 3695 |
| 379 | Ga0496120_0025696 | 3300048923 | Bacteria | 3651 |
| 380 | Ga0496120_0256453 | 3300048923 | Bacteria | 818 |
| 381 | Ga0496121_0000597 | 3300048924 | Bacteria | 67845 |
| 382 | Ga0496122_0009971 | 3300048925 | Bacteria | 9892 |
| 383 | Ga0496123_0086072 | 3300048926 | Bacteria | 1887 |
| 384 | Ga0496124_0000082 | 3300048927 | Bacteria | 208248 |
| 385 | Ga0496124_0000546 | 3300048927 | Bacteria | 63624 |
| 386 | Ga0496125_0000638 | 3300048928 | Bacteria | 58580 |
| 387 | Ga0496125_0007610 | 3300048928 | Bacteria | 11498 |
| 388 | Ga0496126_0001589 | 3300048929 | Bacteria | 34677 |
| 389 | Ga0496126_1130809 | 3300048929 | Bacteria | 580 |
| 390 | Ga0501307_000257 | 3300049162 | Bacteria | 3196 |
| 391 | Ga0501314_003841 | 3300049530 | Bacteria | 1225 |
| 392 | Ga0501032_0084877 | 3300049569 | Bacteria | 2105 |
| 393 | Ga0501034_0170545 | 3300049571 | Bacteria | 2143 |
| 394 | Ga0501036_0087577 | 3300049572 | Bacteria | 2632 |
| 395 | Ga0501036_1085166 | 3300049572 | Bacteria | 654 |
| 396 | Ga0501047_0000793 | 3300049581 | Bacteria | 33043 |
| 397 | Ga0501047_1215355 | 3300049581 | Bacteria | 567 |
| 398 | Ga0501048_0064530 | 3300049582 | Bacteria | 2590 |
| 399 | Ga0501069_0003685 | 3300049585 | Bacteria | 7884 |
| 400 | Ga0501070_0096165 | 3300049586 | Bacteria | 2450 |
| 401 | Ga0501223_000821 | 3300049663 | Bacteria | 7346 |
| 402 | Ga0501224_000033 | 3300049664 | Bacteria | 39112 |
| 403 | Ga0501249_000326 | 3300049679 | Bacteria | 13090 |
| 404 | Ga0501225_0000791 | 3300049705 | Bacteria | 9890 |
| 405 | Ga0501234_000286 | 3300049707 | Bacteria | 7413 |
| 406 | Ga0501035_0269349 | 3300049822 | Bacteria | 1442 |
| 407 | Ga0501044_0161557 | 3300049823 | Bacteria | 2217 |
| 408 | Ga0501204_003776 | 3300049850 | Bacteria | 1610 |
| 409 | Ga0501226_000056 | 3300049853 | Bacteria | 39071 |
| 410 | nmdc:mga0k408_119652_c1 | 3300050493 | Bacteria | 1559 |
| 411 | nmdc:mga0k408_427612_c1 | 3300050493 | Bacteria | 787 |
| 412 | nmdc:mga07m45_460513_c1 | 3300050496 | Bacteria | 737 |
| 413 | nmdc:mga0qj67_19080_c1 | 3300050509 | Bacteria | 1337 |
| 414 | nmdc:mga0sz30_580432_c1 | 3300050516 | Bacteria | 507 |
| 415 | Ga0500610_0000143 | 3300053079 | Bacteria | 21397 |
| 416 | Ga0500595_004157 | 3300053119 | Bacteria | 6561 |
| 417 | Ga0500597_078262 | 3300053120 | Bacteria | 1433 |
| 418 | Ga0500642_0004333 | 3300053130 | Bacteria | 4429 |
| 419 | Ga0500573_0000034 | 3300053140 | Bacteria | 113547 |
| 420 | Ga0500604_0054094 | 3300053151 | Bacteria | 1246 |
| 421 | Ga0500624_000001 | 3300053157 | Bacteria | 284974 |
| 422 | Ga0500636_0006292 | 3300053177 | Bacteria | 6812 |
| 423 | Ga0500637_0000156 | 3300053178 | Bacteria | 24981 |
| 424 | Ga0500645_000011 | 3300053730 | Bacteria | 169616 |
| 425 | Ga0500596_023196 | 3300053735 | Bacteria | 940 |
| 426 | Ga0500587_029146 | 3300053739 | Bacteria | 751 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041503 | Ga0451847_0322971 | Ga0451847_0322971_180_521 | 112 |
| 2 | iso_pu_bacteria | 2895880812 | 2895888350 | 130 |
| 3 | 3300031824 | Ga0307413_10154279 | Ga0307413_101542793 | 133 |
| 4 | 3300002076 | JGI24749J21850_1000020 | JGI24749J21850_100002017 | 134 |
| 5 | 3300002239 | JGI24034J26672_10017695 | JGI24034J26672_100176953 | 134 |
| 6 | 3300002459 | JGI24751J29686_10000177 | JGI24751J29686_1000017717 | 134 |
| 7 | 3300005295 | Ga0065707_10111756 | Ga0065707_101117564 | 134 |
| 8 | 3300005327 | Ga0070658_10099945 | Ga0070658_100999452 | 134 |
| 9 | 3300005328 | Ga0070676_11070766 | Ga0070676_110707661 | 134 |
| 10 | 3300005330 | Ga0070690_100463110 | Ga0070690_1004631101 | 134 |
| 11 | 3300005331 | Ga0070670_100000008 | Ga0070670_10000000871 | 134 |
| 12 | 3300005331 | Ga0070670_100000570 | Ga0070670_10000057010 | 134 |
| 13 | 3300005331 | Ga0070670_100332690 | Ga0070670_1003326901 | 134 |
| 14 | 3300005334 | Ga0068869_100086685 | Ga0068869_1000866852 | 134 |
| 15 | 3300005335 | Ga0070666_11302078 | Ga0070666_113020781 | 134 |
| 16 | 3300005339 | Ga0070660_100411622 | Ga0070660_1004116223 | 134 |
| 17 | 3300005344 | Ga0070661_100236916 | Ga0070661_1002369162 | 134 |
| 18 | 3300005347 | Ga0070668_100000001 | Ga0070668_100000001159 | 134 |
| 19 | 3300005347 | Ga0070668_100739499 | Ga0070668_1007394991 | 134 |
| 20 | 3300005353 | Ga0070669_100000240 | Ga0070669_10000024044 | 134 |
| 21 | 3300005353 | Ga0070669_100022464 | Ga0070669_1000224644 | 134 |
| 22 | 3300005353 | Ga0070669_100145210 | Ga0070669_1001452103 | 134 |
| 23 | 3300005354 | Ga0070675_101643082 | Ga0070675_1016430821 | 134 |
| 24 | 3300005355 | Ga0070671_100000167 | Ga0070671_10000016733 | 134 |
| 25 | 3300005355 | Ga0070671_100017555 | Ga0070671_10001755510 | 134 |
| 26 | 3300005355 | Ga0070671_100067759 | Ga0070671_1000677596 | 134 |
| 27 | 3300005364 | Ga0070673_100300608 | Ga0070673_1003006081 | 134 |
| 28 | 3300005367 | Ga0070667_100000006 | Ga0070667_100000006134 | 134 |
| 29 | 3300005367 | Ga0070667_100001022 | Ga0070667_10000102222 | 134 |
| 30 | 3300005563 | Ga0068855_100196903 | Ga0068855_1001969038 | 134 |
| 31 | 3300005564 | Ga0070664_100384183 | Ga0070664_1003841833 | 134 |
| 32 | 3300005577 | Ga0068857_100028595 | Ga0068857_1000285959 | 134 |
| 33 | 3300005577 | Ga0068857_100507712 | Ga0068857_1005077122 | 134 |
| 34 | 3300005578 | Ga0068854_100033178 | Ga0068854_1000331787 | 134 |
| 35 | 3300005614 | Ga0068856_100103811 | Ga0068856_1001038116 | 134 |
| 36 | 3300005616 | Ga0068852_100003815 | Ga0068852_1000038154 | 134 |
| 37 | 3300005616 | Ga0068852_101503165 | Ga0068852_1015031651 | 134 |
| 38 | 3300005617 | Ga0068859_100002976 | Ga0068859_10000297616 | 134 |
| 39 | 3300005617 | Ga0068859_100028919 | Ga0068859_1000289197 | 134 |
| 40 | 3300005618 | Ga0068864_100000027 | Ga0068864_10000002749 | 134 |
| 41 | 3300005719 | Ga0068861_100056780 | Ga0068861_1000567801 | 134 |
| 42 | 3300005719 | Ga0068861_100073769 | Ga0068861_1000737693 | 134 |
| 43 | 3300005841 | Ga0068863_100001776 | Ga0068863_10000177621 | 134 |
| 44 | 3300005841 | Ga0068863_100009676 | Ga0068863_1000096768 | 134 |
| 45 | 3300005841 | Ga0068863_100049253 | Ga0068863_1000492532 | 134 |
| 46 | 3300005841 | Ga0068863_100304188 | Ga0068863_1003041882 | 134 |
| 47 | 3300005842 | Ga0068858_100000412 | Ga0068858_10000041241 | 134 |
| 48 | 3300005842 | Ga0068858_100002389 | Ga0068858_10000238915 | 134 |
| 49 | 3300005843 | Ga0068860_100000013 | Ga0068860_100000013254 | 134 |
| 50 | 3300005843 | Ga0068860_100000120 | Ga0068860_100000120103 | 134 |
| 51 | 3300005844 | Ga0068862_100000143 | Ga0068862_10000014327 | 134 |
| 52 | 3300005844 | Ga0068862_100000365 | Ga0068862_10000036547 | 134 |
| 53 | 3300006051 | Ga0075364_10713748 | Ga0075364_107137481 | 134 |
| 54 | 3300006195 | Ga0075366_10614979 | Ga0075366_106149791 | 134 |
| 55 | 3300006237 | Ga0097621_102190756 | Ga0097621_1021907561 | 134 |
| 56 | 3300006931 | Ga0097620_100002976 | Ga0097620_10000297616 | 134 |
| 57 | 3300006931 | Ga0097620_100028919 | Ga0097620_1000289197 | 134 |
| 58 | 3300009098 | Ga0105245_10001962 | Ga0105245_100019626 | 134 |
| 59 | 3300009101 | Ga0105247_10845663 | Ga0105247_108456632 | 134 |
| 60 | 3300009176 | Ga0105242_10205422 | Ga0105242_102054224 | 134 |
| 61 | 3300009177 | Ga0105248_10000156 | Ga0105248_1000015649 | 134 |
| 62 | 3300009177 | Ga0105248_10004792 | Ga0105248_100047928 | 134 |
| 63 | 3300009177 | Ga0105248_10261711 | Ga0105248_102617113 | 134 |
| 64 | 3300009551 | Ga0105238_10328047 | Ga0105238_103280471 | 134 |
| 65 | 3300009553 | Ga0105249_10270258 | Ga0105249_102702583 | 134 |
| 66 | 3300009553 | Ga0105249_12049827 | Ga0105249_120498271 | 134 |
| 67 | 3300013100 | Ga0157373_10869836 | Ga0157373_108698361 | 134 |
| 68 | 3300013296 | Ga0157374_10265841 | Ga0157374_102658416 | 134 |
| 69 | 3300013297 | Ga0157378_10114288 | Ga0157378_101142886 | 134 |
| 70 | 3300013297 | Ga0157378_11111995 | Ga0157378_111119951 | 134 |
| 71 | 3300013306 | Ga0163162_11289153 | Ga0163162_112891531 | 134 |
| 72 | 3300013308 | Ga0157375_11568481 | Ga0157375_115684811 | 134 |
| 73 | 3300014325 | Ga0163163_10612395 | Ga0163163_106123951 | 134 |
| 74 | 3300014326 | Ga0157380_10000416 | Ga0157380_1000041623 | 134 |
| 75 | 3300025903 | Ga0207680_10049539 | Ga0207680_100495391 | 134 |
| 76 | 3300025903 | Ga0207680_10152224 | Ga0207680_101522241 | 134 |
| 77 | 3300025909 | Ga0207705_10054808 | Ga0207705_100548084 | 134 |
| 78 | 3300025909 | Ga0207705_10171343 | Ga0207705_101713432 | 134 |
| 79 | 3300025919 | Ga0207657_10340975 | Ga0207657_103409753 | 134 |
| 80 | 3300025920 | Ga0207649_10095049 | Ga0207649_100950492 | 134 |
| 81 | 3300025921 | Ga0207652_10843417 | Ga0207652_108434172 | 134 |
| 82 | 3300025923 | Ga0207681_10000022 | Ga0207681_1000002250 | 134 |
| 83 | 3300025923 | Ga0207681_10117303 | Ga0207681_101173033 | 134 |
| 84 | 3300025925 | Ga0207650_10000019 | Ga0207650_10000019260 | 134 |
| 85 | 3300025925 | Ga0207650_10000020 | Ga0207650_10000020253 | 134 |
| 86 | 3300025925 | Ga0207650_10014606 | Ga0207650_100146063 | 134 |
| 87 | 3300025925 | Ga0207650_10380785 | Ga0207650_103807854 | 134 |
| 88 | 3300025925 | Ga0207650_10801056 | Ga0207650_108010561 | 134 |
| 89 | 3300025931 | Ga0207644_10000047 | Ga0207644_1000004741 | 134 |
| 90 | 3300025931 | Ga0207644_10129027 | Ga0207644_101290272 | 134 |
| 91 | 3300025931 | Ga0207644_10611364 | Ga0207644_106113642 | 134 |
| 92 | 3300025941 | Ga0207711_10001087 | Ga0207711_1000108722 | 134 |
| 93 | 3300025941 | Ga0207711_10003462 | Ga0207711_1000346216 | 134 |
| 94 | 3300025941 | Ga0207711_11393209 | Ga0207711_113932091 | 134 |
| 95 | 3300025945 | Ga0207679_10407324 | Ga0207679_104073243 | 134 |
| 96 | 3300025961 | Ga0207712_10303778 | Ga0207712_103037782 | 134 |
| 97 | 3300025961 | Ga0207712_10698442 | Ga0207712_106984422 | 134 |
| 98 | 3300025972 | Ga0207668_10000043 | Ga0207668_100000432 | 134 |
| 99 | 3300025981 | Ga0207640_10014457 | Ga0207640_100144571 | 134 |
| 100 | 3300025986 | Ga0207658_10000010 | Ga0207658_10000010132 | 134 |
| 101 | 3300025986 | Ga0207658_10001027 | Ga0207658_100010275 | 134 |
| 102 | 3300026035 | Ga0207703_10003516 | Ga0207703_100035167 | 134 |
| 103 | 3300026078 | Ga0207702_10249784 | Ga0207702_102497843 | 134 |
| 104 | 3300026088 | Ga0207641_10000294 | Ga0207641_1000029429 | 134 |
| 105 | 3300026088 | Ga0207641_10012528 | Ga0207641_100125286 | 134 |
| 106 | 3300026095 | Ga0207676_10000022 | Ga0207676_10000022204 | 134 |
| 107 | 3300026095 | Ga0207676_10148646 | Ga0207676_101486463 | 134 |
| 108 | 3300026116 | Ga0207674_10007739 | Ga0207674_1000773912 | 134 |
| 109 | 3300026116 | Ga0207674_10223792 | Ga0207674_102237922 | 134 |
| 110 | 3300026118 | Ga0207675_100001151 | Ga0207675_1000011512 | 134 |
| 111 | 3300026118 | Ga0207675_100257143 | Ga0207675_1002571432 | 134 |
| 112 | 3300026142 | Ga0207698_10145553 | Ga0207698_101455533 | 134 |
| 113 | 3300026142 | Ga0207698_11277523 | Ga0207698_112775232 | 134 |
| 114 | 3300027543 | Ga0209999_1055318 | Ga0209999_10553182 | 134 |
| 115 | 3300028380 | Ga0268265_10000031 | Ga0268265_1000003176 | 134 |
| 116 | 3300028380 | Ga0268265_10000143 | Ga0268265_1000014346 | 134 |
| 117 | 3300028381 | Ga0268264_10000070 | Ga0268264_1000007072 | 134 |
| 118 | 3300031824 | Ga0307413_10008465 | Ga0307413_100084655 | 134 |
| 119 | 3300031824 | Ga0307413_10325179 | Ga0307413_103251792 | 134 |
| 120 | 3300031852 | Ga0307410_10311988 | Ga0307410_103119882 | 134 |
| 121 | 3300031911 | Ga0307412_10000557 | Ga0307412_100005577 | 134 |
| 122 | 3300031911 | Ga0307412_10083479 | Ga0307412_100834793 | 134 |
| 123 | 3300032004 | Ga0307414_10000288 | Ga0307414_1000028827 | 134 |
| 124 | 3300032004 | Ga0307414_11348331 | Ga0307414_113483312 | 134 |
| 125 | 3300032004 | Ga0307414_11924776 | Ga0307414_119247762 | 134 |
| 126 | 3300037471 | Ga0395905_0082648 | Ga0395905_0082648_2141_2557 | 134 |
| 127 | 3300046501 | Ga0495607_0086043 | Ga0495607_0086043_263_670 | 134 |
| 128 | 3300047472 | Ga0495686_0010076 | Ga0495686_0010076_4370_4777 | 134 |
| 129 | 3300047472 | Ga0495686_0085895 | Ga0495686_0085895_1190_1597 | 134 |
| 130 | 3300048903 | Ga0496100_0376874 | Ga0496100_0376874_627_1043 | 134 |
| 131 | 3300048904 | Ga0496101_0515111 | Ga0496101_0515111_329_745 | 134 |
| 132 | 3300048907 | Ga0496104_0097442 | Ga0496104_0097442_1708_2124 | 134 |
| 133 | 3300048908 | Ga0496105_0260581 | Ga0496105_0260581_701_1117 | 134 |
| 134 | 3300048910 | Ga0496107_0432613 | Ga0496107_0432613_319_735 | 134 |
| 135 | 3300048911 | Ga0496108_0026662 | Ga0496108_0026662_1794_2210 | 134 |
| 136 | 3300048914 | Ga0496111_0106460 | Ga0496111_0106460_1007_1423 | 134 |
| 137 | 3300048916 | Ga0496113_0028315 | Ga0496113_0028315_2912_3328 | 134 |
| 138 | 3300048916 | Ga0496113_0086138 | Ga0496113_0086138_1350_1769 | 134 |
| 139 | 3300048928 | Ga0496125_0007610 | Ga0496125_0007610_8166_8573 | 134 |
| 140 | 3300049162 | Ga0501307_000257 | Ga0501307_000257_2654_3067 | 134 |
| 141 | 3300049569 | Ga0501032_0084877 | Ga0501032_0084877_1260_1673 | 134 |
| 142 | 3300049571 | Ga0501034_0170545 | Ga0501034_0170545_254_661 | 134 |
| 143 | 3300049572 | Ga0501036_0087577 | Ga0501036_0087577_1026_1439 | 134 |
| 144 | 3300049572 | Ga0501036_1085166 | Ga0501036_1085166_191_598 | 134 |
| 145 | 3300049581 | Ga0501047_0000793 | Ga0501047_0000793_6643_7056 | 134 |
| 146 | 3300049582 | Ga0501048_0064530 | Ga0501048_0064530_2138_2551 | 134 |
| 147 | 3300049585 | Ga0501069_0003685 | Ga0501069_0003685_6491_6898 | 134 |
| 148 | 3300049586 | Ga0501070_0096165 | Ga0501070_0096165_692_1099 | 134 |
| 149 | 3300049679 | Ga0501249_000326 | Ga0501249_000326_7851_8264 | 134 |
| 150 | 3300049823 | Ga0501044_0161557 | Ga0501044_0161557_115_522 | 134 |
| 151 | 3300049850 | Ga0501204_003776 | Ga0501204_003776_878_1291 | 134 |
| 152 | 3300050493 | nmdc:mga0k408_427612_c1 | nmdc:mga0k408_427612_c1_66_479 | 134 |
| 153 | 3300050496 | nmdc:mga07m45_460513_c1 | nmdc:mga07m45_460513_c1_37_450 | 134 |
| 154 | 3300001904 | JGI24736J21556_1041488 | JGI24736J21556_10414881 | 135 |
| 155 | 3300001915 | JGI24741J21665_1000978 | JGI24741J21665_100097818 | 135 |
| 156 | 3300001915 | JGI24741J21665_1006510 | JGI24741J21665_10065104 | 135 |
| 157 | 3300001915 | JGI24741J21665_1008203 | JGI24741J21665_10082034 | 135 |
| 158 | 3300001979 | JGI24740J21852_10029863 | JGI24740J21852_100298633 | 135 |
| 159 | 3300001990 | JGI24737J22298_10013770 | JGI24737J22298_100137704 | 135 |
| 160 | 3300002067 | JGI24735J21928_10131461 | JGI24735J21928_101314612 | 135 |
| 161 | 3300002077 | JGI24744J21845_10039723 | JGI24744J21845_100397231 | 135 |
| 162 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006308 | 135 |
| 163 | 3300003759 | Ga0055525_1000051 | Ga0055525_1000051137 | 135 |
| 164 | 3300003762 | Ga0055542_1000020 | Ga0055542_1000020255 | 135 |
| 165 | 3300003763 | Ga0055529_1000016 | Ga0055529_100001691 | 135 |
| 166 | 3300005327 | Ga0070658_10000029 | Ga0070658_10000029143 | 135 |
| 167 | 3300005327 | Ga0070658_10000077 | Ga0070658_1000007730 | 135 |
| 168 | 3300005328 | Ga0070676_10747240 | Ga0070676_107472401 | 135 |
| 169 | 3300005331 | Ga0070670_100234409 | Ga0070670_1002344092 | 135 |
| 170 | 3300005339 | Ga0070660_100185490 | Ga0070660_1001854904 | 135 |
| 171 | 3300005344 | Ga0070661_100001114 | Ga0070661_10000111422 | 135 |
| 172 | 3300005344 | Ga0070661_100155532 | Ga0070661_1001555321 | 135 |
| 173 | 3300005347 | Ga0070668_100009825 | Ga0070668_1000098253 | 135 |
| 174 | 3300005353 | Ga0070669_100726683 | Ga0070669_1007266832 | 135 |
| 175 | 3300005354 | Ga0070675_100167969 | Ga0070675_1001679691 | 135 |
| 176 | 3300005355 | Ga0070671_100376537 | Ga0070671_1003765372 | 135 |
| 177 | 3300005356 | Ga0070674_100000284 | Ga0070674_1000002847 | 135 |
| 178 | 3300005356 | Ga0070674_100201632 | Ga0070674_1002016323 | 135 |
| 179 | 3300005364 | Ga0070673_100123619 | Ga0070673_1001236194 | 135 |
| 180 | 3300005366 | Ga0070659_100111827 | Ga0070659_1001118274 | 135 |
| 181 | 3300005366 | Ga0070659_100208666 | Ga0070659_1002086663 | 135 |
| 182 | 3300005366 | Ga0070659_100247460 | Ga0070659_1002474602 | 135 |
| 183 | 3300005367 | Ga0070667_100212696 | Ga0070667_1002126963 | 135 |
| 184 | 3300005455 | Ga0070663_100063589 | Ga0070663_1000635893 | 135 |
| 185 | 3300005456 | Ga0070678_100000043 | Ga0070678_10000004322 | 135 |
| 186 | 3300005457 | Ga0070662_100075342 | Ga0070662_1000753422 | 135 |
| 187 | 3300005459 | Ga0068867_100054692 | Ga0068867_1000546926 | 135 |
| 188 | 3300005535 | Ga0070684_100354800 | Ga0070684_1003548001 | 135 |
| 189 | 3300005539 | Ga0068853_100141494 | Ga0068853_1001414943 | 135 |
| 190 | 3300005539 | Ga0068853_100183689 | Ga0068853_1001836895 | 135 |
| 191 | 3300005548 | Ga0070665_100000535 | Ga0070665_10000053545 | 135 |
| 192 | 3300005548 | Ga0070665_100740459 | Ga0070665_1007404592 | 135 |
| 193 | 3300005563 | Ga0068855_100002699 | Ga0068855_10000269914 | 135 |
| 194 | 3300005563 | Ga0068855_100931108 | Ga0068855_1009311082 | 135 |
| 195 | 3300005564 | Ga0070664_100276778 | Ga0070664_1002767783 | 135 |
| 196 | 3300005577 | Ga0068857_101301047 | Ga0068857_1013010472 | 135 |
| 197 | 3300005578 | Ga0068854_100177321 | Ga0068854_1001773214 | 135 |
| 198 | 3300005578 | Ga0068854_100188008 | Ga0068854_1001880082 | 135 |
| 199 | 3300005614 | Ga0068856_100052505 | Ga0068856_1000525052 | 135 |
| 200 | 3300005614 | Ga0068856_100205243 | Ga0068856_1002052433 | 135 |
| 201 | 3300005616 | Ga0068852_101000875 | Ga0068852_1010008752 | 135 |
| 202 | 3300005617 | Ga0068859_100023802 | Ga0068859_1000238026 | 135 |
| 203 | 3300005617 | Ga0068859_100072333 | Ga0068859_1000723333 | 135 |
| 204 | 3300005617 | Ga0068859_101843859 | Ga0068859_1018438591 | 135 |
| 205 | 3300005718 | Ga0068866_10177524 | Ga0068866_101775243 | 135 |
| 206 | 3300005719 | Ga0068861_100000879 | Ga0068861_10000087915 | 135 |
| 207 | 3300005719 | Ga0068861_100073568 | Ga0068861_1000735684 | 135 |
| 208 | 3300005834 | Ga0068851_10051088 | Ga0068851_100510883 | 135 |
| 209 | 3300005834 | Ga0068851_10551453 | Ga0068851_105514531 | 135 |
| 210 | 3300005985 | Ga0081539_10057928 | Ga0081539_100579282 | 135 |
| 211 | 3300006186 | Ga0075369_10033067 | Ga0075369_100330672 | 135 |
| 212 | 3300006186 | Ga0075369_10451651 | Ga0075369_104516511 | 135 |
| 213 | 3300006237 | Ga0097621_100052964 | Ga0097621_1000529648 | 135 |
| 214 | 3300006358 | Ga0068871_100323224 | Ga0068871_1003232242 | 135 |
| 215 | 3300006931 | Ga0097620_100023802 | Ga0097620_1000238026 | 135 |
| 216 | 3300006931 | Ga0097620_100072334 | Ga0097620_1000723343 | 135 |
| 217 | 3300006931 | Ga0097620_101843474 | Ga0097620_1018434741 | 135 |
| 218 | 3300009093 | Ga0105240_10056792 | Ga0105240_100567923 | 135 |
| 219 | 3300009093 | Ga0105240_10951627 | Ga0105240_109516271 | 135 |
| 220 | 3300009093 | Ga0105240_11089184 | Ga0105240_110891841 | 135 |
| 221 | 3300009148 | Ga0105243_10000038 | Ga0105243_1000003852 | 135 |
| 222 | 3300009174 | Ga0105241_10006215 | Ga0105241_100062153 | 135 |
| 223 | 3300009174 | Ga0105241_10516443 | Ga0105241_105164432 | 135 |
| 224 | 3300009176 | Ga0105242_10289857 | Ga0105242_102898571 | 135 |
| 225 | 3300009177 | Ga0105248_10049231 | Ga0105248_100492312 | 135 |
| 226 | 3300009545 | Ga0105237_10351675 | Ga0105237_103516753 | 135 |
| 227 | 3300009545 | Ga0105237_10357223 | Ga0105237_103572232 | 135 |
| 228 | 3300009551 | Ga0105238_10145702 | Ga0105238_101457024 | 135 |
| 229 | 3300009551 | Ga0105238_10187309 | Ga0105238_101873093 | 135 |
| 230 | 3300009553 | Ga0105249_10631378 | Ga0105249_106313783 | 135 |
| 231 | 3300010375 | Ga0105239_10292340 | Ga0105239_102923401 | 135 |
| 232 | 3300011119 | Ga0105246_10470669 | Ga0105246_104706693 | 135 |
| 233 | 3300012512 | Ga0157327_1006219 | Ga0157327_10062191 | 135 |
| 234 | 3300012513 | Ga0157326_1034753 | Ga0157326_10347531 | 135 |
| 235 | 3300013100 | Ga0157373_10224462 | Ga0157373_102244622 | 135 |
| 236 | 3300013102 | Ga0157371_10000146 | Ga0157371_1000014613 | 135 |
| 237 | 3300013104 | Ga0157370_10356740 | Ga0157370_103567403 | 135 |
| 238 | 3300013105 | Ga0157369_10892146 | Ga0157369_108921462 | 135 |
| 239 | 3300013296 | Ga0157374_10458264 | Ga0157374_104582643 | 135 |
| 240 | 3300013297 | Ga0157378_10510569 | Ga0157378_105105691 | 135 |
| 241 | 3300013307 | Ga0157372_10258128 | Ga0157372_102581282 | 135 |
| 242 | 3300013307 | Ga0157372_10788676 | Ga0157372_107886763 | 135 |
| 243 | 3300014968 | Ga0157379_10027765 | Ga0157379_100277658 | 135 |
| 244 | 3300017792 | Ga0163161_11602377 | Ga0163161_116023771 | 135 |
| 245 | 3300020081 | Ga0206354_10728589 | Ga0206354_107285892 | 135 |
| 246 | 3300020082 | Ga0206353_11000466 | Ga0206353_1100046612 | 135 |
| 247 | 3300021388 | Ga0213875_10000415 | Ga0213875_1000041521 | 135 |
| 248 | 3300025226 | Ga0209674_106880 | Ga0209674_1068802 | 135 |
| 249 | 3300025230 | Ga0209563_100019 | Ga0209563_100019369 | 135 |
| 250 | 3300025254 | Ga0209148_1000017 | Ga0209148_1000017656 | 135 |
| 251 | 3300025272 | Ga0209455_1000005 | Ga0209455_1000005656 | 135 |
| 252 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011517 | 135 |
| 253 | 3300025321 | Ga0207656_10003278 | Ga0207656_100032784 | 135 |
| 254 | 3300025904 | Ga0207647_10006193 | Ga0207647_1000619310 | 135 |
| 255 | 3300025907 | Ga0207645_10029774 | Ga0207645_1002977410 | 135 |
| 256 | 3300025908 | Ga0207643_10695113 | Ga0207643_106951131 | 135 |
| 257 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002877 | 135 |
| 258 | 3300025909 | Ga0207705_10000182 | Ga0207705_1000018258 | 135 |
| 259 | 3300025911 | Ga0207654_10005373 | Ga0207654_100053739 | 135 |
| 260 | 3300025912 | Ga0207707_10431581 | Ga0207707_104315812 | 135 |
| 261 | 3300025913 | Ga0207695_10042140 | Ga0207695_100421403 | 135 |
| 262 | 3300025913 | Ga0207695_10564408 | Ga0207695_105644081 | 135 |
| 263 | 3300025913 | Ga0207695_10821423 | Ga0207695_108214232 | 135 |
| 264 | 3300025914 | Ga0207671_10007048 | Ga0207671_100070484 | 135 |
| 265 | 3300025914 | Ga0207671_10216590 | Ga0207671_102165902 | 135 |
| 266 | 3300025917 | Ga0207660_10098688 | Ga0207660_100986883 | 135 |
| 267 | 3300025919 | Ga0207657_10285162 | Ga0207657_102851623 | 135 |
| 268 | 3300025919 | Ga0207657_10322960 | Ga0207657_103229602 | 135 |
| 269 | 3300025920 | Ga0207649_10008115 | Ga0207649_100081159 | 135 |
| 270 | 3300025920 | Ga0207649_10112047 | Ga0207649_101120472 | 135 |
| 271 | 3300025924 | Ga0207694_10011662 | Ga0207694_100116624 | 135 |
| 272 | 3300025924 | Ga0207694_10130618 | Ga0207694_101306183 | 135 |
| 273 | 3300025926 | Ga0207659_10579490 | Ga0207659_105794902 | 135 |
| 274 | 3300025932 | Ga0207690_10003832 | Ga0207690_1000383213 | 135 |
| 275 | 3300025932 | Ga0207690_10166446 | Ga0207690_101664462 | 135 |
| 276 | 3300025932 | Ga0207690_10320089 | Ga0207690_103200891 | 135 |
| 277 | 3300025933 | Ga0207706_10041501 | Ga0207706_1004150110 | 135 |
| 278 | 3300025935 | Ga0207709_10000031 | Ga0207709_10000031231 | 135 |
| 279 | 3300025937 | Ga0207669_10000079 | Ga0207669_1000007911 | 135 |
| 280 | 3300025937 | Ga0207669_10148698 | Ga0207669_101486984 | 135 |
| 281 | 3300025941 | Ga0207711_10885969 | Ga0207711_108859692 | 135 |
| 282 | 3300025945 | Ga0207679_10543587 | Ga0207679_105435872 | 135 |
| 283 | 3300025949 | Ga0207667_10000220 | Ga0207667_1000022085 | 135 |
| 284 | 3300025949 | Ga0207667_10004725 | Ga0207667_1000472517 | 135 |
| 285 | 3300025949 | Ga0207667_10478790 | Ga0207667_104787903 | 135 |
| 286 | 3300025960 | Ga0207651_10101579 | Ga0207651_101015796 | 135 |
| 287 | 3300025961 | Ga0207712_10525706 | Ga0207712_105257062 | 135 |
| 288 | 3300025972 | Ga0207668_10135867 | Ga0207668_101358674 | 135 |
| 289 | 3300025981 | Ga0207640_10006151 | Ga0207640_100061515 | 135 |
| 290 | 3300025981 | Ga0207640_10451989 | Ga0207640_104519892 | 135 |
| 291 | 3300026041 | Ga0207639_10068115 | Ga0207639_100681152 | 135 |
| 292 | 3300026041 | Ga0207639_10116580 | Ga0207639_101165803 | 135 |
| 293 | 3300026067 | Ga0207678_10004217 | Ga0207678_1000421720 | 135 |
| 294 | 3300026078 | Ga0207702_10003378 | Ga0207702_100033789 | 135 |
| 295 | 3300026078 | Ga0207702_10711177 | Ga0207702_107111772 | 135 |
| 296 | 3300026089 | Ga0207648_10061940 | Ga0207648_100619404 | 135 |
| 297 | 3300026095 | Ga0207676_10900482 | Ga0207676_109004822 | 135 |
| 298 | 3300026116 | Ga0207674_10065229 | Ga0207674_100652295 | 135 |
| 299 | 3300026118 | Ga0207675_100000049 | Ga0207675_10000004924 | 135 |
| 300 | 3300026118 | Ga0207675_101114564 | Ga0207675_1011145641 | 135 |
| 301 | 3300026121 | Ga0207683_10000418 | Ga0207683_1000041815 | 135 |
| 302 | 3300026142 | Ga0207698_10126356 | Ga0207698_101263565 | 135 |
| 303 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022331 | 135 |
| 304 | 3300028379 | Ga0268266_10813914 | Ga0268266_108139142 | 135 |
| 305 | 3300028786 | Ga0307517_10107974 | Ga0307517_101079743 | 135 |
| 306 | 3300028786 | Ga0307517_10155161 | Ga0307517_101551611 | 135 |
| 307 | 3300031456 | Ga0307513_10044569 | Ga0307513_100445694 | 135 |
| 308 | 3300031456 | Ga0307513_10076258 | Ga0307513_100762588 | 135 |
| 309 | 3300031548 | Ga0307408_100397560 | Ga0307408_1003975602 | 135 |
| 310 | 3300031852 | Ga0307410_11185665 | Ga0307410_111856652 | 135 |
| 311 | 3300031901 | Ga0307406_10007002 | Ga0307406_100070028 | 135 |
| 312 | 3300031911 | Ga0307412_10013770 | Ga0307412_100137703 | 135 |
| 313 | 3300031911 | Ga0307412_10747383 | Ga0307412_107473831 | 135 |
| 314 | 3300032002 | Ga0307416_100092066 | Ga0307416_1000920664 | 135 |
| 315 | 3300032005 | Ga0307411_11298353 | Ga0307411_112983531 | 135 |
| 316 | 3300032126 | Ga0307415_101819415 | Ga0307415_1018194152 | 135 |
| 317 | 3300033180 | Ga0307510_10369622 | Ga0307510_103696221 | 135 |
| 318 | 3300036401 | Ga0373937_0268196 | Ga0373937_0268196_702_1109 | 135 |
| 319 | 3300037312 | Ga0395899_0810078 | Ga0395899_0810078_123_530 | 135 |
| 320 | 3300037471 | Ga0395905_0910011 | Ga0395905_0910011_325_735 | 135 |
| 321 | 3300037853 | Ga0436364_1487636 | Ga0436364_1487636_8986_9405 | 135 |
| 322 | 3300038443 | Ga0395901_0380357 | Ga0395901_0380357_582_989 | 135 |
| 323 | 3300039437 | Ga0436365_1480551 | Ga0436365_1480551_495_902 | 135 |
| 324 | 3300039450 | Ga0436363_0292113 | Ga0436363_0292113_666_1076 | 135 |
| 325 | 3300044694 | Ga0466963_0623115 | Ga0466963_0623115_114_521 | 135 |
| 326 | 3300046452 | Ga0495617_065633 | Ga0495617_065633_76_483 | 135 |
| 327 | 3300046471 | Ga0495650_0000492 | Ga0495650_0000492_51756_52166 | 135 |
| 328 | 3300046491 | Ga0495584_0065461 | Ga0495584_0065461_965_1372 | 135 |
| 329 | 3300046492 | Ga0495585_0054568 | Ga0495585_0054568_642_1052 | 135 |
| 330 | 3300046492 | Ga0495585_0130457 | Ga0495585_0130457_31_438 | 135 |
| 331 | 3300046500 | Ga0495596_0007772 | Ga0495596_0007772_1155_1562 | 135 |
| 332 | 3300046506 | Ga0495583_0002265 | Ga0495583_0002265_16104_16514 | 135 |
| 333 | 3300046506 | Ga0495583_0017315 | Ga0495583_0017315_999_1505 | 135 |
| 334 | 3300046506 | Ga0495583_0023515 | Ga0495583_0023515_764_1171 | 135 |
| 335 | 3300046507 | Ga0495606_0001167 | Ga0495606_0001167_8556_8963 | 135 |
| 336 | 3300046507 | Ga0495606_0106327 | Ga0495606_0106327_38_445 | 135 |
| 337 | 3300046507 | Ga0495606_0385095 | Ga0495606_0385095_283_690 | 135 |
| 338 | 3300046513 | Ga0495616_0138872 | Ga0495616_0138872_281_790 | 135 |
| 339 | 3300046518 | Ga0495631_0037626 | Ga0495631_0037626_1201_1611 | 135 |
| 340 | 3300046522 | Ga0495643_0001143 | Ga0495643_0001143_24727_25134 | 135 |
| 341 | 3300046522 | Ga0495643_0002634 | Ga0495643_0002634_901_1308 | 135 |
| 342 | 3300046522 | Ga0495643_0032834 | Ga0495643_0032834_973_1380 | 135 |
| 343 | 3300046522 | Ga0495643_0215249 | Ga0495643_0215249_264_674 | 135 |
| 344 | 3300046522 | Ga0495643_0290954 | Ga0495643_0290954_292_699 | 135 |
| 345 | 3300046524 | Ga0495648_0000430 | Ga0495648_0000430_27107_27517 | 135 |
| 346 | 3300046524 | Ga0495648_0214036 | Ga0495648_0214036_454_864 | 135 |
| 347 | 3300046525 | Ga0495663_0000448 | Ga0495663_0000448_4110_4517 | 135 |
| 348 | 3300046536 | Ga0495587_0409743 | Ga0495587_0409743_253_663 | 135 |
| 349 | 3300046538 | Ga0495609_0179358 | Ga0495609_0179358_192_602 | 135 |
| 350 | 3300046558 | Ga0495633_0006053 | Ga0495633_0006053_3017_3427 | 135 |
| 351 | 3300046558 | Ga0495633_0023766 | Ga0495633_0023766_935_1345 | 135 |
| 352 | 3300046558 | Ga0495633_0296845 | Ga0495633_0296845_220_627 | 135 |
| 353 | 3300046616 | Ga0495668_0000007 | Ga0495668_0000007_94191_94598 | 135 |
| 354 | 3300046616 | Ga0495668_0419839 | Ga0495668_0419839_303_710 | 135 |
| 355 | 3300046648 | Ga0495611_0010553 | Ga0495611_0010553_1789_2196 | 135 |
| 356 | 3300046648 | Ga0495611_0036236 | Ga0495611_0036236_608_1018 | 135 |
| 357 | 3300046660 | Ga0495625_0000167 | Ga0495625_0000167_25006_25413 | 135 |
| 358 | 3300046660 | Ga0495625_0057825 | Ga0495625_0057825_1214_1624 | 135 |
| 359 | 3300046660 | Ga0495625_0100717 | Ga0495625_0100717_1036_1443 | 135 |
| 360 | 3300046660 | Ga0495625_0594830 | Ga0495625_0594830_232_639 | 135 |
| 361 | 3300046690 | Ga0495624_0651219 | Ga0495624_0651219_136_546 | 135 |
| 362 | 3300046691 | Ga0495670_0078881 | Ga0495670_0078881_974_1384 | 135 |
| 363 | 3300046692 | Ga0495671_0355154 | Ga0495671_0355154_219_629 | 135 |
| 364 | 3300046694 | Ga0495649_0074373 | Ga0495649_0074373_596_1006 | 135 |
| 365 | 3300046809 | Ga0495600_0046592 | Ga0495600_0046592_726_1136 | 135 |
| 366 | 3300046810 | Ga0495660_0153901 | Ga0495660_0153901_137_547 | 135 |
| 367 | 3300047320 | Ga0495672_0405175 | Ga0495672_0405175_179_595 | 135 |
| 368 | 3300047323 | Ga0495683_0007573 | Ga0495683_0007573_3289_3696 | 135 |
| 369 | 3300047443 | Ga0495687_000973 | Ga0495687_000973_25525_25932 | 135 |
| 370 | 3300047445 | Ga0495677_0008856 | Ga0495677_0008856_1523_1930 | 135 |
| 371 | 3300047445 | Ga0495677_0083309 | Ga0495677_0083309_104_511 | 135 |
| 372 | 3300047469 | Ga0495673_0199612 | Ga0495673_0199612_217_624 | 135 |
| 373 | 3300047470 | Ga0495681_0013093 | Ga0495681_0013093_1569_1976 | 135 |
| 374 | 3300047472 | Ga0495686_0001337 | Ga0495686_0001337_5625_6059 | 135 |
| 375 | 3300048904 | Ga0496101_0681247 | Ga0496101_0681247_227_634 | 135 |
| 376 | 3300048905 | Ga0496102_0001617 | Ga0496102_0001617_8961_9368 | 135 |
| 377 | 3300048906 | Ga0496103_0000173 | Ga0496103_0000173_52102_52515 | 135 |
| 378 | 3300048906 | Ga0496103_0000457 | Ga0496103_0000457_402_809 | 135 |
| 379 | 3300048907 | Ga0496104_0111901 | Ga0496104_0111901_591_998 | 135 |
| 380 | 3300048908 | Ga0496105_0007688 | Ga0496105_0007688_7586_7993 | 135 |
| 381 | 3300048908 | Ga0496105_0481574 | Ga0496105_0481574_411_824 | 135 |
| 382 | 3300048912 | Ga0496109_1556945 | Ga0496109_1556945_58_468 | 135 |
| 383 | 3300048913 | Ga0496110_0055510 | Ga0496110_0055510_404_811 | 135 |
| 384 | 3300048914 | Ga0496111_0003239 | Ga0496111_0003239_411_818 | 135 |
| 385 | 3300048917 | Ga0496114_0023337 | Ga0496114_0023337_346_753 | 135 |
| 386 | 3300048918 | Ga0496115_0001154 | Ga0496115_0001154_18344_18751 | 135 |
| 387 | 3300048919 | Ga0496116_0000566 | Ga0496116_0000566_43332_43745 | 135 |
| 388 | 3300048919 | Ga0496116_0020367 | Ga0496116_0020367_4304_4711 | 135 |
| 389 | 3300048920 | Ga0496117_0000424 | Ga0496117_0000424_35852_36259 | 135 |
| 390 | 3300048920 | Ga0496117_0000485 | Ga0496117_0000485_14095_14508 | 135 |
| 391 | 3300048921 | Ga0496118_0000190 | Ga0496118_0000190_14095_14508 | 135 |
| 392 | 3300048921 | Ga0496118_0001508 | Ga0496118_0001508_33932_34339 | 135 |
| 393 | 3300048922 | Ga0496119_0021776 | Ga0496119_0021776_2289_2702 | 135 |
| 394 | 3300048922 | Ga0496119_0029743 | Ga0496119_0029743_2988_3395 | 135 |
| 395 | 3300048923 | Ga0496120_0025696 | Ga0496120_0025696_2238_2651 | 135 |
| 396 | 3300048923 | Ga0496120_0256453 | Ga0496120_0256453_248_655 | 135 |
| 397 | 3300048924 | Ga0496121_0000597 | Ga0496121_0000597_35784_36191 | 135 |
| 398 | 3300048925 | Ga0496122_0009971 | Ga0496122_0009971_315_722 | 135 |
| 399 | 3300048926 | Ga0496123_0086072 | Ga0496123_0086072_278_685 | 135 |
| 400 | 3300048927 | Ga0496124_0000082 | Ga0496124_0000082_172473_172880 | 135 |
| 401 | 3300048927 | Ga0496124_0000546 | Ga0496124_0000546_49117_49530 | 135 |
| 402 | 3300048928 | Ga0496125_0000638 | Ga0496125_0000638_57841_58248 | 135 |
| 403 | 3300048929 | Ga0496126_0001589 | Ga0496126_0001589_33943_34350 | 135 |
| 404 | 3300048929 | Ga0496126_1130809 | Ga0496126_1130809_12_434 | 135 |
| 405 | 3300049530 | Ga0501314_003841 | Ga0501314_003841_81_494 | 135 |
| 406 | 3300049581 | Ga0501047_1215355 | Ga0501047_1215355_97_504 | 135 |
| 407 | 3300049663 | Ga0501223_000821 | Ga0501223_000821_2564_2977 | 135 |
| 408 | 3300049664 | Ga0501224_000033 | Ga0501224_000033_32076_32489 | 135 |
| 409 | 3300049705 | Ga0501225_0000791 | Ga0501225_0000791_6488_6901 | 135 |
| 410 | 3300049707 | Ga0501234_000286 | Ga0501234_000286_1513_1926 | 135 |
| 411 | 3300049822 | Ga0501035_0269349 | Ga0501035_0269349_259_672 | 135 |
| 412 | 3300049853 | Ga0501226_000056 | Ga0501226_000056_32030_32443 | 135 |
| 413 | 3300050493 | nmdc:mga0k408_119652_c1 | nmdc:mga0k408_119652_c1_956_1363 | 135 |
| 414 | 3300050509 | nmdc:mga0qj67_19080_c1 | nmdc:mga0qj67_19080_c1_421_843 | 135 |
| 415 | 3300050516 | nmdc:mga0sz30_580432_c1 | nmdc:mga0sz30_580432_c1_23_433 | 135 |
| 416 | 3300053079 | Ga0500610_0000143 | Ga0500610_0000143_7849_8259 | 135 |
| 417 | 3300053119 | Ga0500595_004157 | Ga0500595_004157_230_640 | 135 |
| 418 | 3300053120 | Ga0500597_078262 | Ga0500597_078262_520_933 | 135 |
| 419 | 3300053130 | Ga0500642_0004333 | Ga0500642_0004333_3831_4238 | 135 |
| 420 | 3300053140 | Ga0500573_0000034 | Ga0500573_0000034_38577_38987 | 135 |
| 421 | 3300053151 | Ga0500604_0054094 | Ga0500604_0054094_182_598 | 135 |
| 422 | 3300053157 | Ga0500624_000001 | Ga0500624_000001_79921_80334 | 135 |
| 423 | 3300053177 | Ga0500636_0006292 | Ga0500636_0006292_4994_5404 | 135 |
| 424 | 3300053178 | Ga0500637_0000156 | Ga0500637_0000156_15260_15673 | 135 |
| 425 | 3300053730 | Ga0500645_000011 | Ga0500645_000011_71188_71598 | 135 |
| 426 | 3300053735 | Ga0500596_023196 | Ga0500596_023196_388_798 | 135 |
| 427 | 3300053739 | Ga0500587_029146 | Ga0500587_029146_277_684 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mzg-assembly1.cif.gz_B | x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 | 0.9507 | 1 | 134 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.9433 | 1 | 132 |
| 1mzg-assembly1.cif.gz_B | x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 | 0.9373 | 1 | 134 |
| 3g0m-assembly1.cif.gz_A | crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 | 0.9168 | 1 | 132 |
| 5nq6-assembly1.cif.gz_A | crystal structure of the inhibited form of the redox-sensitive sufe-like sulfur acceptor csde from escherichia coli at 2.40 angstrom resolution | 0.8951 | 3 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3g0mA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9433 | 1 | 132 | 3.90.1010.10 |
| af_A0A0R0FV61_26_157_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9368 | 15 | 134 | 3.90.1010.10 |
| 3g0mA00 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.9168 | 1 | 132 | 3.90.1010.10 |
| af_Q10RM2_1_106_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.901 | 33 | 134 | 3.90.1010.10 |
| af_Q6K258_62_207_3.90.1010.10 | Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; | 0.8843 | 2 | 131 | 3.90.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4I674-F1-model_v4 | Fe-S metabolism protein SufE | 1.003 | 3 | 134 |
|
| AF-A0A031JFY1-F1-model_v4 | deleted | 1.002 | 1 | 135 |
|
| AF-A0A2A4IAS1-F1-model_v4 | Fe-S metabolism protein SufE | 1.002 | 2 | 135 |
|
| AF-A0A258GWD5-F1-model_v4 | Fe-S metabolism protein SufE | 1.002 | 17 | 135 |
|
| AF-A5VAI0-F1-model_v4 | deleted | 0.9963 | 2 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar