F438811

General Info

Members Datasets Scaffolds Average Seq Length
416 299 347 113

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1042529|Ga0209051_10425292
Length 116
Sequence MMQMYAHAFRISVKPVSTIARLRRLAGPAHHGLLLAALLLFLTGTAQAAGSSMPWEGPLQSILESIQGPVARIVLAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
11 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
12 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
13 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
14 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
15 2643221658 Variovorax sp. Root411 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
18 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
19 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
20 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
21 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
22 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
23 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
24 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
25 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
26 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
27 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
28 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
29 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
30 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
31 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
32 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
33 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
34 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
35 2904456579 Variovorax sp. 2002 Isolate Unclassified
36 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
37 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
38 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
39 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
40 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
41 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
42 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
43 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
44 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
45 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
46 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
47 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
48 2941479691
49 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
50 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
51 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
52 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
53 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
54 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
65 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
66 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
72 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
102 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
103 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
104 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
125 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
126 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
127 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
168 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
179 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
199 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
200 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
272 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
273 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
282 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
283 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
284 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
288 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
291 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
292 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
293 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
294 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
295 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
296 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
297 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
298 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
299 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0.48
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 12.5
Rhizoplane 5.05
Rhizosphere 62.02
Stem 0
Stem Tuber 0.24
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000078 3300003214 Bacteria 179320
2 rootH2_10005575 3300003320 Bacteria 33191
3 Ga0065704_10109871 3300005289 Bacteria 1993
4 Ga0070658_10001343 3300005327 Bacteria 20994
5 Ga0070676_10859980 3300005328 Bacteria 673
6 Ga0068869_100079014 3300005334 Bacteria 2451
7 Ga0070680_100018606 3300005336 Bacteria 5492
8 Ga0070680_100045566 3300005336 Bacteria 3566
9 Ga0070680_100252074 3300005336 Bacteria 1492
10 Ga0070682_101086175 3300005337 Bacteria 669
11 Ga0068868_100011883 3300005338 Bacteria 6349
12 Ga0070660_100005665 3300005339 Bacteria 8654
13 Ga0070691_10021768 3300005341 Bacteria 2969
14 Ga0070687_100131630 3300005343 Bacteria 1445
15 Ga0070692_10172738 3300005345 Bacteria 1247
16 Ga0070671_101937669 3300005355 Bacteria 524
17 Ga0070659_100000049 3300005366 Bacteria 98059
18 Ga0070703_10003360 3300005406 Bacteria 4564
19 Ga0070703_10010897 3300005406 Bacteria 2566
20 Ga0070705_100001653 3300005440 Bacteria 11681
21 Ga0070705_100002052 3300005440 Bacteria 10286
22 Ga0070700_100001179 3300005441 Bacteria 12949
23 Ga0070700_100005573 3300005441 Bacteria 6673
24 Ga0070694_100000994 3300005444 Bacteria 16087
25 Ga0070694_100003559 3300005444 Bacteria 9313
26 Ga0070708_100941102 3300005445 Bacteria 811
27 Ga0070663_100018739 3300005455 Bacteria 4545
28 Ga0070662_100290366 3300005457 Bacteria 1326
29 Ga0070662_100405966 3300005457 Bacteria 1125
30 Ga0070681_10021622 3300005458 Bacteria 6450
31 Ga0070706_100197015 3300005467 Bacteria 1882
32 Ga0070706_101056841 3300005467 Bacteria 748
33 Ga0070706_101747143 3300005467 Bacteria 566
34 Ga0070698_100643004 3300005471 Bacteria 1002
35 Ga0070699_100002822 3300005518 Bacteria 15505
36 Ga0070699_100005947 3300005518 Bacteria 10654
37 Ga0070679_100074395 3300005530 Bacteria 3388
38 Ga0070679_100373991 3300005530 Bacteria 1372
39 Ga0070679_100436270 3300005530 Bacteria 1255
40 Ga0070679_102045690 3300005530 Bacteria 522
41 Ga0070697_100082397 3300005536 Bacteria 2652
42 Ga0068853_100246579 3300005539 Bacteria 1638
43 Ga0068853_101300728 3300005539 Bacteria 703
44 Ga0070695_100001214 3300005545 Bacteria 14175
45 Ga0070695_100001577 3300005545 Bacteria 12723
46 Ga0070696_100003270 3300005546 Bacteria 10809
47 Ga0070693_100276588 3300005547 Bacteria 1123
48 Ga0070704_100003442 3300005549 Bacteria 9077
49 Ga0070704_100010518 3300005549 Bacteria 5632
50 Ga0070704_100939301 3300005549 Bacteria 780
51 Ga0068857_100022523 3300005577 Bacteria 5544
52 Ga0068857_100042271 3300005577 Bacteria 4042
53 Ga0068854_101064950 3300005578 Bacteria 719
54 Ga0068856_100000400 3300005614 Bacteria 47424
55 Ga0068856_101194512 3300005614 Bacteria 777
56 Ga0070702_100698700 3300005615 Bacteria 773
57 Ga0068859_100036400 3300005617 Bacteria 4941
58 Ga0068864_100141769 3300005618 Bacteria 2168
59 Ga0068864_100399639 3300005618 Bacteria 1306
60 Ga0068858_100938477 3300005842 Bacteria 847
61 Ga0068860_100021184 3300005843 Bacteria 6297
62 Ga0068860_100052292 3300005843 Bacteria 3886
63 Ga0068862_100001093 3300005844 Bacteria 25809
64 Ga0068862_100003385 3300005844 Bacteria 13756
65 Ga0075364_10001431 3300006051 Bacteria 12927
66 Ga0075367_10366028 3300006178 Bacteria 910
67 Ga0075431_100428217 3300006847 Bacteria 1322
68 Ga0068865_100358836 3300006881 Bacteria 1183
69 Ga0097620_100036399 3300006931 Bacteria 4941
70 Ga0099825_1043131 3300006941 Bacteria 1220
71 Ga0099824_1026543 3300006942 Bacteria 2965
72 Ga0099822_1005508 3300006943 Bacteria 16531
73 Ga0099822_1040047 3300006943 Bacteria 2638
74 Ga0099823_1000059 3300006944 Bacteria 53113
75 Ga0099823_1000747 3300006944 Bacteria 23809
76 Ga0099823_1008537 3300006944 Bacteria 10423
77 Ga0105240_10109445 3300009093 Bacteria 3346
78 Ga0105240_11168516 3300009093 Bacteria 816
79 Ga0111539_12460481 3300009094 Bacteria 604
80 Ga0105245_10090648 3300009098 Bacteria 2812
81 Ga0105245_10547254 3300009098 Bacteria 1179
82 Ga0105243_10131414 3300009148 Bacteria 2124
83 Ga0105243_10264985 3300009148 Bacteria 1540
84 Ga0105241_10772220 3300009174 Bacteria 883
85 Ga0105237_10273214 3300009545 Bacteria 1693
86 Ga0105237_12622761 3300009545 Bacteria 515
87 Ga0105238_11411039 3300009551 Bacteria 724
88 Ga0105249_10038819 3300009553 Bacteria 4321
89 Ga0105239_10061990 3300010375 Bacteria 4105
90 Ga0105239_10751148 3300010375 Bacteria 1116
91 Ga0105239_10911899 3300010375 Bacteria 1009
92 Ga0105239_11938450 3300010375 Bacteria 683
93 Ga0105246_10182141 3300011119 Bacteria 1618
94 Ga0157373_10106744 3300013100 Bacteria 1969
95 Ga0157378_12897583 3300013297 Bacteria 532
96 Ga0157380_10932928 3300014326 Bacteria 897
97 Ga0182008_10000282 3300014497 Bacteria 39753
98 Ga0182008_10085263 3300014497 Bacteria 1556
99 Ga0157379_10762892 3300014968 Bacteria 911
100 Ga0157376_11040546 3300014969 Bacteria 843
101 Ga0182006_1082382 3300015261 Bacteria 1171
102 Ga0182007_10034359 3300015262 Bacteria 1714
103 Ga0163161_11339483 3300017792 Bacteria 623
104 Ga0214544_1006236 3300021320 Bacteria 22202
105 Ga0214542_1006137 3300021321 Bacteria 22200
106 Ga0214545_1005727 3300021324 Bacteria 22200
107 Ga0214543_1005902 3300021327 Bacteria 22184
108 Ga0213872_10000276 3300021361 Bacteria 43790
109 Ga0213874_10286166 3300021377 Bacteria 617
110 Ga0209672_119848 3300025228 Bacteria 667
111 Ga0209233_1000150 3300025261 Bacteria 179401
112 Ga0209233_1016987 3300025261 Bacteria 1992
113 Ga0209025_1184926 3300025294 Bacteria 530
114 Ga0209051_1042529 3300025303 Bacteria 1605
115 Ga0207653_10000399 3300025885 Bacteria 19222
116 Ga0207653_10009883 3300025885 Bacteria 2976
117 Ga0207647_10147677 3300025904 Bacteria 1375
118 Ga0207647_10270612 3300025904 Bacteria 971
119 Ga0207647_10345919 3300025904 Bacteria 842
120 Ga0207645_10377310 3300025907 Bacteria 951
121 Ga0207645_10483140 3300025907 Bacteria 838
122 Ga0207705_10000071 3300025909 Bacteria 128862
123 Ga0207684_10024032 3300025910 Bacteria 5199
124 Ga0207684_10682186 3300025910 Bacteria 874
125 Ga0207707_10006973 3300025912 Bacteria 9855
126 Ga0207695_10069091 3300025913 Bacteria 3616
127 Ga0207695_10725236 3300025913 Bacteria 874
128 Ga0207671_10000106 3300025914 Bacteria 129102
129 Ga0207671_10097099 3300025914 Bacteria 2227
130 Ga0207660_10011342 3300025917 Bacteria 5798
131 Ga0207660_10020515 3300025917 Bacteria 4436
132 Ga0207660_10549854 3300025917 Bacteria 939
133 Ga0207662_10300513 3300025918 Bacteria 1067
134 Ga0207657_10003535 3300025919 Bacteria 16692
135 Ga0207652_10058160 3300025921 Bacteria 3331
136 Ga0207652_10246499 3300025921 Bacteria 1611
137 Ga0207646_10341577 3300025922 Bacteria 1353
138 Ga0207681_11091859 3300025923 Bacteria 670
139 Ga0207694_10782645 3300025924 Bacteria 806
140 Ga0207687_10049132 3300025927 Bacteria 2932
141 Ga0207644_11852016 3300025931 Bacteria 505
142 Ga0207690_10001208 3300025932 Bacteria 16324
143 Ga0207706_10266670 3300025933 Bacteria 1495
144 Ga0207709_10074409 3300025935 Bacteria 2167
145 Ga0207709_11279160 3300025935 Bacteria 606
146 Ga0207689_10148345 3300025942 Bacteria 1933
147 Ga0207712_10004880 3300025961 Bacteria 8483
148 Ga0207712_10365546 3300025961 Bacteria 1203
149 Ga0207640_10489798 3300025981 Bacteria 1022
150 Ga0207640_11107745 3300025981 Bacteria 701
151 Ga0207677_10002745 3300026023 Bacteria 9288
152 Ga0207639_10111891 3300026041 Bacteria 2227
153 Ga0207639_11003424 3300026041 Bacteria 782
154 Ga0207678_10061971 3300026067 Bacteria 3217
155 Ga0207678_10072404 3300026067 Bacteria 2953
156 Ga0207708_10018300 3300026075 Bacteria 5275
157 Ga0207708_10021720 3300026075 Bacteria 4842
158 Ga0207702_10000125 3300026078 Bacteria 90604
159 Ga0207702_10225493 3300026078 Bacteria 1748
160 Ga0207702_11544842 3300026078 Bacteria 657
161 Ga0207676_10039063 3300026095 Bacteria 3628
162 Ga0207676_10101931 3300026095 Bacteria 2381
163 Ga0207674_10013031 3300026116 Bacteria 9262
164 Ga0207674_10095256 3300026116 Bacteria 2963
165 Ga0207675_100103838 3300026118 Bacteria 2678
166 Ga0207698_11502666 3300026142 Bacteria 689
167 Ga0209389_1000055 3300027296 Bacteria 108798
168 Ga0209389_1000167 3300027296 Bacteria 53121
169 Ga0209389_1005813 3300027296 Bacteria 10594
170 Ga0209389_1025086 3300027296 Bacteria 5203
171 Ga0209589_1000008 3300027357 Bacteria 259970
172 Ga0209589_1000024 3300027357 Bacteria 169886
173 Ga0209489_100123 3300027361 Bacteria 113105
174 Ga0209489_102905 3300027361 Bacteria 34209
175 Ga0209700_100029 3300027363 Bacteria 214607
176 Ga0209968_1039377 3300027526 Bacteria 806
177 Ga0209983_1054823 3300027665 Bacteria 875
178 Ga0268266_10600346 3300028379 Bacteria 1057
179 Ga0268266_11912797 3300028379 Bacteria 567
180 Ga0268265_10000277 3300028380 Bacteria 58316
181 Ga0268265_10022253 3300028380 Bacteria 4451
182 Ga0268264_10001243 3300028381 Bacteria 24302
183 Ga0268264_10019232 3300028381 Bacteria 5582
184 Ga0265323_10255997 3300028653 Bacteria 544
185 Ga0307517_10000005 3300028786 Bacteria 260207
186 Ga0307515_10000104 3300028794 Bacteria 198238
187 Ga0307511_10165207 3300030521 Bacteria 1231
188 Ga0265770_1095684 3300030878 Bacteria 598
189 Ga0265760_10129717 3300031090 Bacteria 815
190 Ga0265328_10001115 3300031239 Bacteria 12375
191 Ga0265327_10139592 3300031251 Bacteria 1133
192 Ga0307513_10455250 3300031456 Bacteria 1003
193 Ga0307513_10910436 3300031456 Bacteria 587
194 Ga0307509_10157126 3300031507 Bacteria 2178
195 Ga0307408_100000004 3300031548 Bacteria 572889
196 Ga0307408_100000230 3300031548 Bacteria 58926
197 Ga0307508_10004530 3300031616 Bacteria 13550
198 Ga0307508_10097113 3300031616 Bacteria 2538
199 Ga0307516_10017485 3300031730 Bacteria 7475
200 Ga0307516_10026336 3300031730 Bacteria 5907
201 Ga0307406_10000420 3300031901 Bacteria 24709
202 Ga0307406_10254893 3300031901 Bacteria 1324
203 Ga0307412_10009296 3300031911 Bacteria 5635
204 Ga0307412_10557102 3300031911 Bacteria 964
205 Ga0373958_0055868 3300034819 Bacteria 844
206 Ga0373952_0001365 3300035092 Bacteria 4469
207 Ga0373931_0565022 3300035691 Bacteria 740
208 Ga0395900_0506319 3300037418 Bacteria 1157
209 Ga0395898_0019531 3300037466 Bacteria 6895
210 Ga0395905_0000033 3300037471 Bacteria 279363
211 Ga0395905_0001362 3300037471 Bacteria 29750
212 Ga0395901_0029968 3300038443 Bacteria 5605
213 Ga0436361_0526559 3300039447 Bacteria 60778
214 Ga0439436_0000095 3300041404 Bacteria 20869
215 Ga0439436_0012616 3300041404 Bacteria 2565
216 Ga0439438_025844 3300041405 Bacteria 1596
217 Ga0439447_028871 3300041407 Bacteria 1407
218 Ga0439432_005911 3300042006 Bacteria 4393
219 Ga0439455_0077434 3300042012 Bacteria 900
220 Ga0450900_018838 3300042136 Bacteria 949
221 Ga0439458_0023131 3300042157 Bacteria 1448
222 Ga0439434_0032895 3300042435 Bacteria 1579
223 Ga0439460_0169559 3300042461 Bacteria 734
224 Ga0466969_0176423 3300044656 Bacteria 978
225 Ga0466972_0052131 3300044658 Bacteria 1973
226 Ga0466965_0010972 3300044683 Bacteria 4237
227 Ga0466961_0045488 3300044693 Bacteria 2808
228 Ga0466963_0308940 3300044694 Bacteria 1112
229 Ga0466964_0324834 3300044706 Bacteria 783
230 Ga0466971_0017974 3300044719 Bacteria 3131
231 Ga0466968_0268159 3300044735 Bacteria 814
232 Ga0466970_0085627 3300044765 Bacteria 1707
233 Ga0466957_0014003 3300044842 Bacteria 4664
234 Ga0466960_0171762 3300044901 Bacteria 1170
235 Ga0466959_0082993 3300045049 Bacteria 2308
236 Ga0466959_0795140 3300045049 Bacteria 632
237 Ga0466958_0006921 3300045836 Bacteria 6204
238 Ga0495638_0027320 3300046460 Bacteria 3695
239 Ga0495607_0000237 3300046501 Bacteria 59197
240 Ga0495610_0403134 3300046512 Bacteria 504
241 Ga0495631_0257885 3300046518 Bacteria 743
242 Ga0495637_0203094 3300046520 Bacteria 727
243 Ga0495643_0000042 3300046522 Bacteria 229665
244 Ga0495643_0157619 3300046522 Bacteria 1119
245 Ga0495643_0180118 3300046522 Bacteria 1027
246 Ga0495648_0002050 3300046524 Bacteria 19121
247 Ga0495652_0112676 3300046529 Bacteria 2185
248 Ga0495654_0263225 3300046530 Bacteria 714
249 Ga0495633_0125761 3300046558 Bacteria 1186
250 Ga0495611_0584376 3300046648 Bacteria 505
251 Ga0495588_0543388 3300046674 Bacteria 609
252 Ga0495686_0164182 3300047472 Bacteria 1296
253 Ga0496101_0005828 3300048904 Bacteria 7882
254 Ga0496102_0003651 3300048905 Bacteria 13017
255 Ga0496102_0084697 3300048905 Bacteria 2926
256 Ga0496103_0020165 3300048906 Bacteria 4003
257 Ga0496104_0000255 3300048907 Bacteria 47426
258 Ga0496104_0471618 3300048907 Bacteria 1167
259 Ga0496105_0000078 3300048908 Bacteria 74087
260 Ga0496106_0000342 3300048909 Bacteria 32843
261 Ga0496106_0002094 3300048909 Bacteria 14962
262 Ga0496107_0019267 3300048910 Bacteria 4814
263 Ga0496108_0130902 3300048911 Bacteria 2157
264 Ga0496109_0211878 3300048912 Bacteria 1822
265 Ga0496112_0274907 3300048915 Bacteria 1632
266 Ga0496112_1158045 3300048915 Bacteria 691
267 Ga0496113_0079591 3300048916 Bacteria 2509
268 Ga0496113_0817756 3300048916 Bacteria 740
269 Ga0496115_0050847 3300048918 Bacteria 3322
270 Ga0496117_0000237 3300048920 Bacteria 104534
271 Ga0496118_0000280 3300048921 Bacteria 89951
272 Ga0496119_0000107 3300048922 Bacteria 116784
273 Ga0496120_0000011 3300048923 Bacteria 365549
274 Ga0496120_0055713 3300048923 Bacteria 2234
275 Ga0496120_0245596 3300048923 Bacteria 843
276 Ga0496121_0002146 3300048924 Bacteria 30925
277 Ga0496121_0050046 3300048924 Bacteria 3535
278 Ga0496121_0125917 3300048924 Bacteria 1926
279 Ga0496121_0691436 3300048924 Bacteria 615
280 Ga0496122_0000034 3300048925 Bacteria 320661
281 Ga0496122_0001950 3300048925 Bacteria 30922
282 Ga0496122_0029844 3300048925 Bacteria 4586
283 Ga0496123_0000069 3300048926 Bacteria 201579
284 Ga0496123_0001440 3300048926 Bacteria 33152
285 Ga0496123_0038614 3300048926 Bacteria 3353
286 Ga0496123_0383473 3300048926 Bacteria 644
287 Ga0496124_0045259 3300048927 Bacteria 3773
288 Ga0496124_0123377 3300048927 Bacteria 2067
289 Ga0496124_0448342 3300048927 Bacteria 881
290 Ga0496125_0001686 3300048928 Bacteria 30917
291 Ga0496125_0063117 3300048928 Bacteria 2956
292 Ga0496125_0234259 3300048928 Bacteria 1171
293 Ga0495682_0000392 3300049460 Bacteria 31589
294 Ga0501290_019906 3300049513 Bacteria 913
295 Ga0501031_0000005 3300049568 Bacteria 183960
296 Ga0501032_0000337 3300049569 Bacteria 39238
297 Ga0501032_0007316 3300049569 Bacteria 8075
298 Ga0501033_0000129 3300049570 Bacteria 73102
299 Ga0501033_0015233 3300049570 Bacteria 5834
300 Ga0501033_0056067 3300049570 Bacteria 2913
301 Ga0501034_0002799 3300049571 Bacteria 20395
302 Ga0501036_0000014 3300049572 Bacteria 148705
303 Ga0501037_0000042 3300049573 Bacteria 118407
304 Ga0501037_0029061 3300049573 Bacteria 4083
305 Ga0501037_0316334 3300049573 Bacteria 1081
306 Ga0501038_0000024 3300049574 Bacteria 148705
307 Ga0501038_0168268 3300049574 Bacteria 1776
308 Ga0501038_0960668 3300049574 Bacteria 629
309 Ga0501039_0000122 3300049575 Bacteria 53871
310 Ga0501039_0258749 3300049575 Bacteria 1368
311 Ga0501039_0821845 3300049575 Bacteria 725
312 Ga0501040_0004151 3300049576 Bacteria 9428
313 Ga0501040_0506666 3300049576 Bacteria 870
314 Ga0501041_0321549 3300049577 Bacteria 976
315 Ga0501043_0170211 3300049579 Bacteria 1699
316 Ga0501046_0028877 3300049580 Bacteria 4513
317 Ga0501046_0827926 3300049580 Bacteria 648
318 Ga0501047_0006906 3300049581 Bacteria 10663
319 Ga0501047_0084365 3300049581 Bacteria 3053
320 Ga0501070_0050594 3300049586 Bacteria 3449
321 Ga0501075_0322082 3300049591 Bacteria 1178
322 Ga0501223_053763 3300049663 Bacteria 782
323 Ga0501083_0056782 3300049744 Bacteria 2623
324 Ga0501083_0722928 3300049744 Bacteria 648
325 Ga0501266_000344 3300049763 Bacteria 6176
326 Ga0501035_0000045 3300049822 Bacteria 148705
327 Ga0501044_0000044 3300049823 Bacteria 148705
328 Ga0501044_0046475 3300049823 Bacteria 4494
329 Ga0501044_0857801 3300049823 Bacteria 785
330 nmdc:mga00v17_1397_c1 3300050491 Bacteria 12677
331 nmdc:mga06r32_523831_c1 3300050510 Bacteria 1161
332 Ga0500610_0000014 3300053079 Bacteria 84868
333 Ga0500555_033572 3300053103 Bacteria 1446
334 Ga0500555_042940 3300053103 Bacteria 1254
335 Ga0500555_047230 3300053103 Bacteria 1185
336 Ga0500555_048906 3300053103 Bacteria 1161
337 Ga0500595_009683 3300053119 Bacteria 3879
338 Ga0500595_016359 3300053119 Bacteria 2764
339 Ga0500597_000031 3300053120 Bacteria 29789
340 Ga0500608_000742 3300053122 Bacteria 11917
341 Ga0500618_047317 3300053125 Bacteria 978
342 Ga0500621_099070 3300053126 Bacteria 1152
343 Ga0500622_0134302 3300053156 Bacteria 1186
344 Ga0500636_0017863 3300053177 Bacteria 4192
345 Ga0500645_014110 3300053730 Bacteria 2552
346 Ga0500552_000122 3300053733 Bacteria 6467
347 Ga0466962_0008601 3300061719 Bacteria 4892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10273214 Ga0105237_102732142 81
2 3300048904 Ga0496101_0005828 Ga0496101_0005828_6382_6717 81
3 3300048915 Ga0496112_0274907 Ga0496112_0274907_289_624 81
4 3300048916 Ga0496113_0079591 Ga0496113_0079591_481_816 81
5 3300048924 Ga0496121_0002146 Ga0496121_0002146_18326_18661 81
6 3300048925 Ga0496122_0001950 Ga0496122_0001950_12262_12597 81
7 3300048926 Ga0496123_0001440 Ga0496123_0001440_18326_18661 81
8 3300048928 Ga0496125_0001686 Ga0496125_0001686_18326_18661 81
9 3300005327 Ga0070658_10001343 Ga0070658_1000134319 82
10 3300005336 Ga0070680_100252074 Ga0070680_1002520743 82
11 3300005337 Ga0070682_101086175 Ga0070682_1010861751 82
12 3300005339 Ga0070660_100005665 Ga0070660_1000056652 82
13 3300005366 Ga0070659_100000049 Ga0070659_10000004968 82
14 3300005458 Ga0070681_10021622 Ga0070681_100216224 82
15 3300005530 Ga0070679_100074395 Ga0070679_1000743952 82
16 3300005530 Ga0070679_102045690 Ga0070679_1020456902 82
17 3300025909 Ga0207705_10000071 Ga0207705_1000007155 82
18 3300025912 Ga0207707_10006973 Ga0207707_100069734 82
19 3300025917 Ga0207660_10549854 Ga0207660_105498542 82
20 3300025919 Ga0207657_10003535 Ga0207657_1000353513 82
21 3300025921 Ga0207652_10058160 Ga0207652_100581602 82
22 3300025932 Ga0207690_10001208 Ga0207690_1000120820 82
23 3300053119 Ga0500595_016359 Ga0500595_016359_1841_2167 82
24 3300049570 Ga0501033_0056067 Ga0501033_0056067_1296_1628 83
25 3300053733 Ga0500552_000122 Ga0500552_000122_4279_4605 83
26 3300009093 Ga0105240_10109445 Ga0105240_101094452 86
27 3300025913 Ga0207695_10069091 Ga0207695_100690913 86
28 3300026078 Ga0207702_11544842 Ga0207702_115448421 86
29 3300025981 Ga0207640_10489798 Ga0207640_104897982 87
30 3300006051 Ga0075364_10001431 Ga0075364_100014313 88
31 3300044901 Ga0466960_0171762 Ga0466960_0171762_812_1144 88
32 3300046512 Ga0495610_0403134 Ga0495610_0403134_93_476 88
33 3300046522 Ga0495643_0000042 Ga0495643_0000042_103604_103936 88
34 3300050491 nmdc:mga00v17_1397_c1 nmdc:mga00v17_1397_c1_11137_11469 88
35 3300053120 Ga0500597_000031 Ga0500597_000031_21852_22190 89
36 3300005614 Ga0068856_100000400 Ga0068856_10000040050 91
37 3300026078 Ga0207702_10000125 Ga0207702_1000012546 91
38 3300048924 Ga0496121_0050046 Ga0496121_0050046_2399_2773 93
39 3300025303 Ga0209051_1042529 Ga0209051_10425292 98
40 iso_pu_bacteria 2600255389 2602010875 98
41 iso_pu_bacteria 651053060 651176320 98
42 3300046522 Ga0495643_0157619 Ga0495643_0157619_90_476 99
43 3300028653 Ga0265323_10255997 Ga0265323_102559971 100
44 3300046524 Ga0495648_0002050 Ga0495648_0002050_8279_8653 100
45 3300048925 Ga0496122_0029844 Ga0496122_0029844_2023_2409 100
46 3300048926 Ga0496123_0038614 Ga0496123_0038614_2221_2607 100
47 3300053126 Ga0500621_099070 Ga0500621_099070_176_550 100
48 3300006178 Ga0075367_10366028 Ga0075367_103660281 101
49 3300025907 Ga0207645_10483140 Ga0207645_104831402 101
50 iso_pu_bacteria 2599185214 2599623766 101
51 iso_pu_bacteria 2599185226 2599671615 101
52 iso_pu_bacteria 2599185227 2599681372 101
53 iso_pu_bacteria 2599185229 2599693225 101
54 iso_pu_bacteria 2643221658 2644326223 101
55 iso_pu_bacteria 2904449895 2904449911 101
56 iso_pu_bacteria 2904456579 2904457262 101
57 iso_pu_bacteria 2945972063 2945976202 101
58 3300031548 Ga0307408_100000004 Ga0307408_100000004502 102
59 3300041404 Ga0439436_0012616 Ga0439436_0012616_1386_1727 102
60 3300041405 Ga0439438_025844 Ga0439438_025844_220_561 102
61 3300041407 Ga0439447_028871 Ga0439447_028871_467_808 102
62 3300042435 Ga0439434_0032895 Ga0439434_0032895_590_931 102
63 3300049569 Ga0501032_0007316 Ga0501032_0007316_5509_5850 102
64 3300049573 Ga0501037_0029061 Ga0501037_0029061_3540_3881 102
65 3300049575 Ga0501039_0258749 Ga0501039_0258749_197_538 102
66 3300005328 Ga0070676_10859980 Ga0070676_108599802 103
67 3300014497 Ga0182008_10000282 Ga0182008_1000028237 103
68 3300025914 Ga0207671_10097099 Ga0207671_100970993 103
69 3300042006 Ga0439432_005911 Ga0439432_005911_1855_2214 103
70 3300049575 Ga0501039_0821845 Ga0501039_0821845_16_342 103
71 iso_pu_bacteria 2687453129 2687578873 103
72 iso_pu_bacteria 2854601825 2854602877 103
73 3300005539 Ga0068853_100246579 Ga0068853_1002465792 104
74 3300009551 Ga0105238_11411039 Ga0105238_114110392 104
75 3300021377 Ga0213874_10286166 Ga0213874_102861661 104
76 3300025924 Ga0207694_10782645 Ga0207694_107826452 104
77 3300025981 Ga0207640_11107745 Ga0207640_111077451 104
78 3300026041 Ga0207639_10111891 Ga0207639_101118912 104
79 iso_pu_bacteria 2643221713 2644619812 104
80 iso_pu_bacteria 2928115317 2928118116 104
81 iso_pu_bacteria 2928115317 2928121243 104
82 3300003320 rootH2_10005575 rootH2_1000557511 105
83 3300005338 Ga0068868_100011883 Ga0068868_1000118832 105
84 3300005355 Ga0070671_101937669 Ga0070671_1019376691 105
85 3300005467 Ga0070706_101747143 Ga0070706_1017471431 105
86 3300009098 Ga0105245_10090648 Ga0105245_100906482 105
87 3300009098 Ga0105245_10547254 Ga0105245_105472542 105
88 3300010375 Ga0105239_10061990 Ga0105239_100619904 105
89 3300017792 Ga0163161_11339483 Ga0163161_113394831 105
90 3300025228 Ga0209672_119848 Ga0209672_1198482 105
91 3300025927 Ga0207687_10049132 Ga0207687_100491324 105
92 3300025931 Ga0207644_11852016 Ga0207644_118520162 105
93 3300026023 Ga0207677_10002745 Ga0207677_100027459 105
94 3300028786 Ga0307517_10000005 Ga0307517_10000005153 105
95 3300028794 Ga0307515_10000104 Ga0307515_1000010455 105
96 3300031507 Ga0307509_10157126 Ga0307509_101571262 105
97 3300031548 Ga0307408_100000230 Ga0307408_10000023042 105
98 3300031616 Ga0307508_10004530 Ga0307508_100045308 105
99 3300031616 Ga0307508_10097113 Ga0307508_100971132 105
100 3300031730 Ga0307516_10017485 Ga0307516_100174853 105
101 3300031730 Ga0307516_10026336 Ga0307516_100263363 105
102 3300031901 Ga0307406_10000420 Ga0307406_1000042023 105
103 3300031911 Ga0307412_10557102 Ga0307412_105571022 105
104 3300035092 Ga0373952_0001365 Ga0373952_0001365_3634_3966 105
105 3300037471 Ga0395905_0000033 Ga0395905_0000033_89935_90276 105
106 3300042136 Ga0450900_018838 Ga0450900_018838_528_920 105
107 3300044658 Ga0466972_0052131 Ga0466972_0052131_699_1067 105
108 3300046518 Ga0495631_0257885 Ga0495631_0257885_142_501 105
109 3300046529 Ga0495652_0112676 Ga0495652_0112676_395_727 105
110 3300046530 Ga0495654_0263225 Ga0495654_0263225_110_475 105
111 3300046674 Ga0495588_0543388 Ga0495588_0543388_236_568 105
112 3300049823 Ga0501044_0046475 Ga0501044_0046475_3564_3896 105
113 3300053079 Ga0500610_0000014 Ga0500610_0000014_40979_41311 105
114 3300053103 Ga0500555_047230 Ga0500555_047230_320_652 105
115 3300053122 Ga0500608_000742 Ga0500608_000742_2317_2649 105
116 3300053156 Ga0500622_0134302 Ga0500622_0134302_524_883 105
117 iso_pu_bacteria 2501025501 2501070177 105
118 iso_pu_bacteria 2510917015 2511105175 105
119 iso_pu_bacteria 2728369097 2729147704 105
120 iso_pu_bacteria 2842324504 2842329201 105
121 iso_pu_bacteria 2842348783 2842353380 105
122 iso_pu_bacteria 2961064222 2961068360 105
123 iso_pu_bacteria 8011350971 8011352410 105
124 3300006847 Ga0075431_100428217 Ga0075431_1004282172 106
125 3300031456 Ga0307513_10910436 Ga0307513_109104361 106
126 3300047472 Ga0495686_0164182 Ga0495686_0164182_755_1129 106
127 3300050510 nmdc:mga06r32_523831_c1 nmdc:mga06r32_523831_c1_399_734 106
128 3300053730 Ga0500645_014110 Ga0500645_014110_411_785 106
129 iso_pu_bacteria 2643221683 2644464672 106
130 iso_pu_bacteria 2643221683 2644468643 106
131 iso_pu_bacteria 2842357229 2842362953 106
132 iso_pu_bacteria 2891088606 2891091105 106
133 iso_pu_bacteria 2941479691 2941485660 106
134 iso_pu_bacteria 3000135777 3000142194 106
135 iso_pu_bacteria 641228493 641336691 106
136 3300025918 Ga0207662_10300513 Ga0207662_103005132 107
137 3300026142 Ga0207698_11502666 Ga0207698_115026662 107
138 3300035691 Ga0373931_0565022 Ga0373931_0565022_57_434 107
139 3300037471 Ga0395905_0001362 Ga0395905_0001362_13155_13493 107
140 3300038443 Ga0395901_0029968 Ga0395901_0029968_2215_2553 107
141 3300046460 Ga0495638_0027320 Ga0495638_0027320_2033_2410 107
142 3300046501 Ga0495607_0000237 Ga0495607_0000237_42238_42615 107
143 3300046520 Ga0495637_0203094 Ga0495637_0203094_130_507 107
144 3300049763 Ga0501266_000344 Ga0501266_000344_5287_5664 107
145 3300005289 Ga0065704_10109871 Ga0065704_101098713 108
146 3300005334 Ga0068869_100079014 Ga0068869_1000790143 108
147 3300005336 Ga0070680_100018606 Ga0070680_1000186063 108
148 3300005336 Ga0070680_100045566 Ga0070680_1000455662 108
149 3300005341 Ga0070691_10021768 Ga0070691_100217684 108
150 3300005343 Ga0070687_100131630 Ga0070687_1001316301 108
151 3300005345 Ga0070692_10172738 Ga0070692_101727382 108
152 3300005406 Ga0070703_10003360 Ga0070703_100033603 108
153 3300005406 Ga0070703_10010897 Ga0070703_100108972 108
154 3300005440 Ga0070705_100001653 Ga0070705_1000016532 108
155 3300005440 Ga0070705_100002052 Ga0070705_10000205210 108
156 3300005441 Ga0070700_100001179 Ga0070700_1000011796 108
157 3300005441 Ga0070700_100005573 Ga0070700_1000055733 108
158 3300005444 Ga0070694_100000994 Ga0070694_1000009944 108
159 3300005444 Ga0070694_100003559 Ga0070694_1000035596 108
160 3300005445 Ga0070708_100941102 Ga0070708_1009411022 108
161 3300005455 Ga0070663_100018739 Ga0070663_1000187394 108
162 3300005457 Ga0070662_100290366 Ga0070662_1002903662 108
163 3300005457 Ga0070662_100405966 Ga0070662_1004059662 108
164 3300005467 Ga0070706_100197015 Ga0070706_1001970153 108
165 3300005467 Ga0070706_101056841 Ga0070706_1010568412 108
166 3300005471 Ga0070698_100643004 Ga0070698_1006430042 108
167 3300005518 Ga0070699_100002822 Ga0070699_10000282211 108
168 3300005518 Ga0070699_100005947 Ga0070699_10000594710 108
169 3300005530 Ga0070679_100373991 Ga0070679_1003739913 108
170 3300005530 Ga0070679_100436270 Ga0070679_1004362702 108
171 3300005536 Ga0070697_100082397 Ga0070697_1000823975 108
172 3300005539 Ga0068853_101300728 Ga0068853_1013007282 108
173 3300005545 Ga0070695_100001214 Ga0070695_1000012143 108
174 3300005545 Ga0070695_100001577 Ga0070695_1000015774 108
175 3300005546 Ga0070696_100003270 Ga0070696_1000032705 108
176 3300005547 Ga0070693_100276588 Ga0070693_1002765882 108
177 3300005549 Ga0070704_100003442 Ga0070704_1000034426 108
178 3300005549 Ga0070704_100010518 Ga0070704_1000105183 108
179 3300005549 Ga0070704_100939301 Ga0070704_1009393012 108
180 3300005577 Ga0068857_100022523 Ga0068857_1000225233 108
181 3300005577 Ga0068857_100042271 Ga0068857_1000422714 108
182 3300005578 Ga0068854_101064950 Ga0068854_1010649502 108
183 3300005615 Ga0070702_100698700 Ga0070702_1006987002 108
184 3300005617 Ga0068859_100036400 Ga0068859_1000364004 108
185 3300005618 Ga0068864_100141769 Ga0068864_1001417692 108
186 3300005618 Ga0068864_100399639 Ga0068864_1003996392 108
187 3300005842 Ga0068858_100938477 Ga0068858_1009384772 108
188 3300005843 Ga0068860_100021184 Ga0068860_1000211843 108
189 3300005843 Ga0068860_100052292 Ga0068860_1000522924 108
190 3300005844 Ga0068862_100001093 Ga0068862_1000010936 108
191 3300005844 Ga0068862_100003385 Ga0068862_1000033855 108
192 3300006881 Ga0068865_100358836 Ga0068865_1003588362 108
193 3300006931 Ga0097620_100036399 Ga0097620_1000363993 108
194 3300009094 Ga0111539_12460481 Ga0111539_124604812 108
195 3300009148 Ga0105243_10264985 Ga0105243_102649852 108
196 3300009174 Ga0105241_10772220 Ga0105241_107722202 108
197 3300009553 Ga0105249_10038819 Ga0105249_100388194 108
198 3300010375 Ga0105239_11938450 Ga0105239_119384502 108
199 3300011119 Ga0105246_10182141 Ga0105246_101821413 108
200 3300014326 Ga0157380_10932928 Ga0157380_109329282 108
201 3300014968 Ga0157379_10762892 Ga0157379_107628921 108
202 3300014969 Ga0157376_11040546 Ga0157376_110405462 108
203 3300021361 Ga0213872_10000276 Ga0213872_1000027630 108
204 3300025885 Ga0207653_10000399 Ga0207653_100003993 108
205 3300025885 Ga0207653_10009883 Ga0207653_100098833 108
206 3300025904 Ga0207647_10270612 Ga0207647_102706122 108
207 3300025904 Ga0207647_10345919 Ga0207647_103459192 108
208 3300025907 Ga0207645_10377310 Ga0207645_103773102 108
209 3300025910 Ga0207684_10024032 Ga0207684_100240322 108
210 3300025910 Ga0207684_10682186 Ga0207684_106821862 108
211 3300025917 Ga0207660_10011342 Ga0207660_100113423 108
212 3300025917 Ga0207660_10020515 Ga0207660_100205153 108
213 3300025921 Ga0207652_10246499 Ga0207652_102464993 108
214 3300025922 Ga0207646_10341577 Ga0207646_103415772 108
215 3300025923 Ga0207681_11091859 Ga0207681_110918591 108
216 3300025933 Ga0207706_10266670 Ga0207706_102666702 108
217 3300025935 Ga0207709_11279160 Ga0207709_112791602 108
218 3300025942 Ga0207689_10148345 Ga0207689_101483453 108
219 3300025961 Ga0207712_10004880 Ga0207712_100048806 108
220 3300025961 Ga0207712_10365546 Ga0207712_103655462 108
221 3300026041 Ga0207639_11003424 Ga0207639_110034242 108
222 3300026067 Ga0207678_10061971 Ga0207678_100619713 108
223 3300026067 Ga0207678_10072404 Ga0207678_100724043 108
224 3300026075 Ga0207708_10018300 Ga0207708_100183005 108
225 3300026075 Ga0207708_10021720 Ga0207708_100217203 108
226 3300026095 Ga0207676_10039063 Ga0207676_100390635 108
227 3300026095 Ga0207676_10101931 Ga0207676_101019312 108
228 3300026116 Ga0207674_10013031 Ga0207674_100130317 108
229 3300026116 Ga0207674_10095256 Ga0207674_100952564 108
230 3300026118 Ga0207675_100103838 Ga0207675_1001038383 108
231 3300027665 Ga0209983_1054823 Ga0209983_10548232 108
232 3300028380 Ga0268265_10000277 Ga0268265_1000027722 108
233 3300028380 Ga0268265_10022253 Ga0268265_100222535 108
234 3300028381 Ga0268264_10001243 Ga0268264_100012434 108
235 3300028381 Ga0268264_10019232 Ga0268264_100192323 108
236 3300030521 Ga0307511_10165207 Ga0307511_101652072 108
237 3300031901 Ga0307406_10254893 Ga0307406_102548931 108
238 3300031911 Ga0307412_10009296 Ga0307412_100092962 108
239 3300034819 Ga0373958_0055868 Ga0373958_0055868_173_505 108
240 3300039447 Ga0436361_0526559 Ga0436361_0526559_41406_41801 108
241 3300046648 Ga0495611_0584376 Ga0495611_0584376_52_384 108
242 3300048905 Ga0496102_0003651 Ga0496102_0003651_9598_9930 108
243 3300048905 Ga0496102_0084697 Ga0496102_0084697_1398_1742 108
244 3300048906 Ga0496103_0020165 Ga0496103_0020165_3087_3419 108
245 3300048909 Ga0496106_0000342 Ga0496106_0000342_6412_6744 108
246 3300048909 Ga0496106_0002094 Ga0496106_0002094_6052_6396 108
247 3300048910 Ga0496107_0019267 Ga0496107_0019267_2095_2427 108
248 3300048911 Ga0496108_0130902 Ga0496108_0130902_160_504 108
249 3300048912 Ga0496109_0211878 Ga0496109_0211878_15_347 108
250 3300048916 Ga0496113_0817756 Ga0496113_0817756_266_610 108
251 3300048918 Ga0496115_0050847 Ga0496115_0050847_2366_2710 108
252 3300048928 Ga0496125_0063117 Ga0496125_0063117_692_1078 108
253 3300049460 Ga0495682_0000392 Ga0495682_0000392_22387_22764 108
254 3300049574 Ga0501038_0960668 Ga0501038_0960668_75_407 108
255 3300049576 Ga0501040_0506666 Ga0501040_0506666_372_716 108
256 3300049577 Ga0501041_0321549 Ga0501041_0321549_58_402 108
257 3300049580 Ga0501046_0827926 Ga0501046_0827926_99_443 108
258 3300049591 Ga0501075_0322082 Ga0501075_0322082_805_1149 108
259 3300049744 Ga0501083_0056782 Ga0501083_0056782_59_403 108
260 3300049744 Ga0501083_0722928 Ga0501083_0722928_96_440 108
261 3300053103 Ga0500555_033572 Ga0500555_033572_897_1229 108
262 3300053103 Ga0500555_042940 Ga0500555_042940_846_1178 108
263 3300053103 Ga0500555_048906 Ga0500555_048906_560_904 108
264 3300006944 Ga0099823_1000747 Ga0099823_100074713 109
265 3300009093 Ga0105240_11168516 Ga0105240_111685162 109
266 3300009148 Ga0105243_10131414 Ga0105243_101314142 109
267 3300015261 Ga0182006_1082382 Ga0182006_10823822 109
268 3300025294 Ga0209025_1184926 Ga0209025_11849262 109
269 3300025913 Ga0207695_10725236 Ga0207695_107252362 109
270 3300025935 Ga0207709_10074409 Ga0207709_100744092 109
271 3300027296 Ga0209389_1025086 Ga0209389_10250862 109
272 3300041404 Ga0439436_0000095 Ga0439436_0000095_7518_7901 109
273 3300044656 Ga0466969_0176423 Ga0466969_0176423_78_461 109
274 3300044683 Ga0466965_0010972 Ga0466965_0010972_723_1106 109
275 3300044693 Ga0466961_0045488 Ga0466961_0045488_1955_2338 109
276 3300044694 Ga0466963_0308940 Ga0466963_0308940_360_743 109
277 3300044706 Ga0466964_0324834 Ga0466964_0324834_142_525 109
278 3300044719 Ga0466971_0017974 Ga0466971_0017974_2238_2621 109
279 3300044735 Ga0466968_0268159 Ga0466968_0268159_148_531 109
280 3300044765 Ga0466970_0085627 Ga0466970_0085627_725_1108 109
281 3300044842 Ga0466957_0014003 Ga0466957_0014003_2674_3057 109
282 3300045049 Ga0466959_0082993 Ga0466959_0082993_1421_1804 109
283 3300045049 Ga0466959_0795140 Ga0466959_0795140_13_396 109
284 3300045836 Ga0466958_0006921 Ga0466958_0006921_2526_2909 109
285 3300046522 Ga0495643_0180118 Ga0495643_0180118_505_888 109
286 3300048920 Ga0496117_0000237 Ga0496117_0000237_47175_47558 109
287 3300048921 Ga0496118_0000280 Ga0496118_0000280_40435_40818 109
288 3300048922 Ga0496119_0000107 Ga0496119_0000107_68470_68853 109
289 3300048923 Ga0496120_0000011 Ga0496120_0000011_47974_48357 109
290 3300048923 Ga0496120_0055713 Ga0496120_0055713_1595_1978 109
291 3300048924 Ga0496121_0125917 Ga0496121_0125917_336_719 109
292 3300048924 Ga0496121_0691436 Ga0496121_0691436_186_569 109
293 3300048927 Ga0496124_0448342 Ga0496124_0448342_57_440 109
294 3300053125 Ga0500618_047317 Ga0500618_047317_132_515 109
295 3300061719 Ga0466962_0008601 Ga0466962_0008601_3807_4190 109
296 iso_pu_bacteria 2513237087 2513592870 109
297 iso_pu_bacteria 2513237137 2513863417 109
298 iso_pu_bacteria 2513237137 2513864014 109
299 iso_pu_bacteria 2513237137 2513864336 109
300 iso_pu_bacteria 2513237139 2513879741 109
301 iso_pu_bacteria 2515154112 2515630448 109
302 iso_pu_bacteria 2517093001 2517108041 109
303 iso_pu_bacteria 2517572143 2517887622 109
304 iso_pu_bacteria 2524023210 2524471173 109
305 iso_pu_bacteria 2802429603 2805922872 109
306 iso_pu_bacteria 2824746037 2824749505 109
307 iso_pu_bacteria 2841941048 2841949315 109
308 iso_pu_bacteria 2841949485 2841957604 109
309 iso_pu_bacteria 2841974524 2841981411 109
310 iso_pu_bacteria 2847930680 2847931649 109
311 iso_pu_bacteria 2847939898 2847942907 109
312 iso_pu_bacteria 2885366525 2885370899 109
313 iso_pu_bacteria 2888378607 2888378948 109
314 iso_pu_bacteria 2908775508 2908775569 109
315 iso_pu_bacteria 2909399089 2909401320 109
316 iso_pu_bacteria 2929624759 2929633515 109
317 iso_pu_bacteria 2935675223 2935684681 109
318 iso_pu_bacteria 2935703347 2935712845 109
319 iso_pu_bacteria 2935769743 2935775724 109
320 iso_pu_bacteria 2935785616 2935792641 109
321 iso_pu_bacteria 2935793552 2935800679 109
322 iso_pu_bacteria 2935975950 2935982903 109
323 iso_pu_bacteria 2935992306 2936001300 109
324 iso_pu_bacteria 2936055302 2936055759 109
325 iso_pu_bacteria 2941531003 2941537587 109
326 iso_pu_bacteria 3005710791 3005717077 109
327 iso_pu_bacteria 641228493 641336855 109
328 iso_pu_bacteria 643348555 643392333 109
329 iso_pu_bacteria 8019586578 8019592615 109
330 iso_pu_bacteria 8019619141 8019622326 109
331 iso_pu_bacteria 8019629233 8019630985 109
332 iso_pu_bacteria 8019638758 8019639637 109
333 iso_pu_bacteria 8019678201 8019687772 109
334 iso_pu_bacteria 8055742211 8055743067 109
335 3300006944 Ga0099823_1000059 Ga0099823_100005948 110
336 3300013100 Ga0157373_10106744 Ga0157373_101067443 110
337 3300027296 Ga0209389_1000167 Ga0209389_100016713 110
338 3300027526 Ga0209968_1039377 Ga0209968_10393772 110
339 3300031251 Ga0265327_10139592 Ga0265327_101395923 110
340 3300031456 Ga0307513_10455250 Ga0307513_104552502 110
341 3300042461 Ga0439460_0169559 Ga0439460_0169559_171_563 110
342 3300046558 Ga0495633_0125761 Ga0495633_0125761_537_920 110
343 3300048925 Ga0496122_0000034 Ga0496122_0000034_67627_68022 110
344 3300048926 Ga0496123_0000069 Ga0496123_0000069_107452_107847 110
345 3300048926 Ga0496123_0383473 Ga0496123_0383473_99_491 110
346 3300048927 Ga0496124_0045259 Ga0496124_0045259_2046_2429 110
347 3300048927 Ga0496124_0123377 Ga0496124_0123377_877_1269 110
348 3300048928 Ga0496125_0234259 Ga0496125_0234259_135_527 110
349 3300049513 Ga0501290_019906 Ga0501290_019906_258_641 110
350 3300049573 Ga0501037_0316334 Ga0501037_0316334_553_945 110
351 3300049663 Ga0501223_053763 Ga0501223_053763_142_525 110
352 3300031239 Ga0265328_10001115 Ga0265328_1000111512 112
353 3300053119 Ga0500595_009683 Ga0500595_009683_1031_1408 112
354 3300003214 JGI25165J46597_1000078 JGI25165J46597_100007850 113
355 3300005614 Ga0068856_101194512 Ga0068856_1011945122 113
356 3300006941 Ga0099825_1043131 Ga0099825_10431312 113
357 3300006942 Ga0099824_1026543 Ga0099824_10265432 113
358 3300006943 Ga0099822_1005508 Ga0099822_100550817 113
359 3300006943 Ga0099822_1040047 Ga0099822_10400472 113
360 3300006944 Ga0099823_1008537 Ga0099823_10085372 113
361 3300009545 Ga0105237_12622761 Ga0105237_126227612 113
362 3300010375 Ga0105239_10751148 Ga0105239_107511482 113
363 3300010375 Ga0105239_10911899 Ga0105239_109118993 113
364 3300013297 Ga0157378_12897583 Ga0157378_128975831 113
365 3300014497 Ga0182008_10085263 Ga0182008_100852633 113
366 3300015262 Ga0182007_10034359 Ga0182007_100343591 113
367 3300021320 Ga0214544_1006236 Ga0214544_100623618 113
368 3300021321 Ga0214542_1006137 Ga0214542_10061375 113
369 3300021324 Ga0214545_1005727 Ga0214545_10057275 113
370 3300021327 Ga0214543_1005902 Ga0214543_100590218 113
371 3300025261 Ga0209233_1000150 Ga0209233_1000150132 113
372 3300025261 Ga0209233_1016987 Ga0209233_10169872 113
373 3300025904 Ga0207647_10147677 Ga0207647_101476773 113
374 3300025914 Ga0207671_10000106 Ga0207671_10000106117 113
375 3300026078 Ga0207702_10225493 Ga0207702_102254933 113
376 3300027296 Ga0209389_1000055 Ga0209389_1000055117 113
377 3300027296 Ga0209389_1005813 Ga0209389_10058132 113
378 3300027357 Ga0209589_1000008 Ga0209589_100000821 113
379 3300027357 Ga0209589_1000024 Ga0209589_100002414 113
380 3300027361 Ga0209489_100123 Ga0209489_1001237 113
381 3300027361 Ga0209489_102905 Ga0209489_10290531 113
382 3300027363 Ga0209700_100029 Ga0209700_100029207 113
383 3300028379 Ga0268266_10600346 Ga0268266_106003462 113
384 3300028379 Ga0268266_11912797 Ga0268266_119127972 113
385 3300030878 Ga0265770_1095684 Ga0265770_10956842 113
386 3300031090 Ga0265760_10129717 Ga0265760_101297172 113
387 3300037418 Ga0395900_0506319 Ga0395900_0506319_431_772 113
388 3300037466 Ga0395898_0019531 Ga0395898_0019531_249_590 113
389 3300042012 Ga0439455_0077434 Ga0439455_0077434_334_675 113
390 3300042157 Ga0439458_0023131 Ga0439458_0023131_431_772 113
391 3300048907 Ga0496104_0000255 Ga0496104_0000255_35894_36235 113
392 3300048907 Ga0496104_0471618 Ga0496104_0471618_517_858 113
393 3300048908 Ga0496105_0000078 Ga0496105_0000078_62535_62876 113
394 3300048915 Ga0496112_1158045 Ga0496112_1158045_135_476 113
395 3300048923 Ga0496120_0245596 Ga0496120_0245596_418_759 113
396 3300049568 Ga0501031_0000005 Ga0501031_0000005_147107_147448 113
397 3300049569 Ga0501032_0000337 Ga0501032_0000337_3099_3440 113
398 3300049570 Ga0501033_0000129 Ga0501033_0000129_69362_69703 113
399 3300049570 Ga0501033_0015233 Ga0501033_0015233_5285_5626 113
400 3300049571 Ga0501034_0002799 Ga0501034_0002799_10238_10579 113
401 3300049572 Ga0501036_0000014 Ga0501036_0000014_35799_36140 113
402 3300049573 Ga0501037_0000042 Ga0501037_0000042_5501_5842 113
403 3300049574 Ga0501038_0000024 Ga0501038_0000024_35799_36140 113
404 3300049574 Ga0501038_0168268 Ga0501038_0168268_693_1034 113
405 3300049575 Ga0501039_0000122 Ga0501039_0000122_17732_18073 113
406 3300049576 Ga0501040_0004151 Ga0501040_0004151_8421_8762 113
407 3300049579 Ga0501043_0170211 Ga0501043_0170211_405_746 113
408 3300049580 Ga0501046_0028877 Ga0501046_0028877_1403_1744 113
409 3300049581 Ga0501047_0006906 Ga0501047_0006906_1331_1672 113
410 3300049581 Ga0501047_0084365 Ga0501047_0084365_2187_2528 113
411 3300049586 Ga0501070_0050594 Ga0501070_0050594_451_792 113
412 3300049822 Ga0501035_0000045 Ga0501035_0000045_112566_112907 113
413 3300049823 Ga0501044_0000044 Ga0501044_0000044_35799_36140 113
414 3300049823 Ga0501044_0857801 Ga0501044_0857801_354_695 113
415 3300053177 Ga0500636_0017863 Ga0500636_0017863_3517_3858 113
416 iso_pu_bacteria 641228493 641334096 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

17

107

0.91

Feature Viewer

pLDDT pTM Quality
72.15 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map