F438612

General Info

Members Datasets Scaffolds Average Seq Length
415 177 830 158

Family's Representative Sequence

Representative Sequence 3300036457|Ga0265778_038899|Ga0265778_038899_65_619
Length 184
Sequence MDESAQVGGSNRQPCFAGGFFMTTVDFAPLFRTAIGFDRLARLVDTAASSQDAQSYPPYNIEKTGDDTYRLTMAVAGFRPDDLDLTVKDNTLVVSGRVANDGPKAEILYRGIAGRAFERRFVLADHIVVEGADVQHGLLHVGLKRIVPESLKPRKITIGSGQQAGVAPASIANNSDTSVVAKAA

Samples

Sample ID Description Type Environment
1 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
24 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
35 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
36 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
37 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
38 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300019176 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
88 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 14.22
Metatranscriptomes 85.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.24
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265778_038899 3300036457 Bacteria 630
2 Ga0006763J43179_101788 3300002870 Bacteria 583
3 Ga0006779J45831_103634 3300003160 Unclassified 532
4 Ga0006779J45831_105811 3300003160 Bacteria 557
5 Ga0006765J45826_109527 3300003161 Bacteria 532
6 Ga0006765J45826_110727 3300003161 Bacteria 592
7 Ga0006778J45830_1001600 3300003162 Bacteria 585
8 Ga0006778J45830_1008017 3300003162 Bacteria 593
9 Ga0006778J45830_1012467 3300003162 Bacteria 574
10 Ga0006778J45830_1013136 3300003162 Bacteria 581
11 Ga0006778J45830_1017061 3300003162 Bacteria 595
12 Ga0006778J45830_1035316 3300003162 Bacteria 562
13 Ga0006759J45824_1023437 3300003163 Bacteria 583
14 Ga0006759J45824_1031084 3300003163 Bacteria 570
15 Ga0006759J45824_1036901 3300003163 Bacteria 589
16 Ga0006759J45824_1042858 3300003163 Bacteria 594
17 Ga0007428J48920_101086 3300003288 Bacteria 582
18 Ga0007428J48920_107420 3300003288 Bacteria 582
19 Ga0006770J48903_1002727 3300003305 Bacteria 582
20 Ga0006770J48903_1013835 3300003305 Bacteria 591
21 Ga0006770J48903_1020078 3300003305 Bacteria 579
22 Ga0006770J48903_1048518 3300003305 Bacteria 566
23 Ga0006777J48905_1001634 3300003308 Bacteria 575
24 Ga0006777J48905_1005611 3300003308 Bacteria 596
25 Ga0006777J48905_1011707 3300003308 Bacteria 574
26 Ga0006777J48905_1011925 3300003308 Bacteria 593
27 Ga0006777J48905_1013168 3300003308 Bacteria 597
28 Ga0007417J51691_1008033 3300003544 Bacteria 594
29 Ga0007417J51691_1010830 3300003544 Bacteria 571
30 Ga0007417J51691_1014720 3300003544 Bacteria 588
31 Ga0007417J51691_1022095 3300003544 Unclassified 570
32 Ga0007417J51691_1028413 3300003544 Bacteria 597
33 Ga0007417J51691_1089422 3300003544 Bacteria 604
34 Ga0007427J51700_104080 3300003559 Bacteria 596
35 Ga0007427J51700_107993 3300003559 Bacteria 573
36 Ga0007427J51700_109565 3300003559 Bacteria 593
37 Ga0006781J51513_1001458 3300003568 Bacteria 583
38 Ga0006781J51513_1009633 3300003568 Bacteria 574
39 Ga0006781J51513_1012628 3300003568 Bacteria 572
40 Ga0006781J51513_1013136 3300003568 Bacteria 587
41 Ga0006781J51513_1018746 3300003568 Bacteria 580
42 Ga0006781J51513_1021489 3300003568 Bacteria 571
43 Ga0007410J51695_1014338 3300003574 Bacteria 574
44 Ga0007410J51695_1025304 3300003574 Unclassified 585
45 Ga0007410J51695_1025920 3300003574 Bacteria 591
46 Ga0007409J51694_1012669 3300003575 Unclassified 590
47 Ga0007409J51694_1021167 3300003575 Bacteria 573
48 Ga0007409J51694_1055258 3300003575 Bacteria 561
49 Ga0007416J51690_1010467 3300003577 Bacteria 592
50 Ga0007416J51690_1011503 3300003577 Bacteria 574
51 Ga0007416J51690_1012493 3300003577 Bacteria 584
52 Ga0007416J51690_1020360 3300003577 Bacteria 571
53 Ga0007416J51690_1083005 3300003577 Bacteria 578
54 Ga0007416J51690_1093496 3300003577 Bacteria 578
55 Ga0007429J51699_1004302 3300003579 Bacteria 667
56 Ga0007429J51699_1004981 3300003579 Bacteria 591
57 Ga0007429J51699_1011534 3300003579 Bacteria 600
58 Ga0007429J51699_1020242 3300003579 Bacteria 576
59 Ga0007429J51699_1044156 3300003579 Bacteria 593
60 Ga0007415J51800_101800 3300003613 Bacteria 585
61 Ga0007415J51800_110259 3300003613 Bacteria 575
62 Ga0032354_1023349 3300003693 Bacteria 575
63 Ga0032354_1056821 3300003693 Bacteria 579
64 Ga0006780_1000603 3300003735 Bacteria 583
65 Ga0006780_1002092 3300003735 Bacteria 609
66 Ga0006780_1005350 3300003735 Bacteria 593
67 Ga0006780_1010408 3300003735 Bacteria 582
68 Ga0058859_11522812 3300004798 Bacteria 590
69 Ga0058859_11632497 3300004798 Bacteria 619
70 Ga0058863_11713781 3300004799 Bacteria 595
71 Ga0058861_10101867 3300004800 Bacteria 556
72 Ga0058861_11659145 3300004800 Unclassified 502
73 Ga0058861_11679846 3300004800 Bacteria 882
74 Ga0058860_11984802 3300004801 Bacteria 571
75 Ga0058862_10154774 3300004803 Bacteria 556
76 Ga0058862_12843178 3300004803 Bacteria 687
77 Ga0070680_100500854 3300005336 Bacteria 1039
78 Ga0070714_102103127 3300005435 Bacteria 550
79 Ga0070710_10465874 3300005437 Bacteria 859
80 Ga0070681_11223327 3300005458 Bacteria 673
81 Ga0070679_100059278 3300005530 Bacteria 3815
82 Ga0068853_100775337 3300005539 Bacteria 917
83 Ga0068856_100165510 3300005614 Bacteria 2222
84 Ga0070717_10997140 3300006028 Bacteria 763
85 Ga0105240_10373708 3300009093 Bacteria 1611
86 Ga0130087_1075334 3300009828 Bacteria 602
87 Ga0130086_1092599 3300009829 Bacteria 602
88 Ga0130084_1091216 3300009835 Bacteria 602
89 Ga0130085_1016975 3300009850 Bacteria 602
90 Ga0154016_109395 3300013045 Bacteria 573
91 Ga0154012_104758 3300013059 Bacteria 580
92 Ga0154012_128387 3300013059 Bacteria 577
93 Ga0154012_152542 3300013059 Bacteria 574
94 Ga0157371_10688974 3300013102 Bacteria 764
95 Ga0157370_10557135 3300013104 Bacteria 1051
96 Ga0157374_10532541 3300013296 Bacteria 1181
97 Ga0163163_10081939 3300014325 Bacteria 3229
98 Ga0182008_10236850 3300014497 Bacteria 938
99 Ga0184597_100264 3300019162 Bacteria 587
100 Ga0184596_124343 3300019176 Viruses 712
101 Ga0184594_108596 3300019181 Bacteria 601
102 Ga0184598_124769 3300019182 Bacteria 584
103 Ga0184601_114118 3300019183 Bacteria 636
104 Ga0184601_121586 3300019183 Viruses 575
105 Ga0184599_101573 3300019188 Bacteria 689
106 Ga0184599_118389 3300019188 Bacteria 569
107 Ga0184600_125807 3300019190 Bacteria 786
108 Ga0184603_126901 3300019192 Bacteria 578
109 Ga0184603_150217 3300019192 Bacteria 600
110 Ga0197907_10033368 3300020069 Bacteria 581
111 Ga0197907_10318646 3300020069 Bacteria 595
112 Ga0197907_10888164 3300020069 Bacteria 574
113 Ga0197907_11311859 3300020069 Bacteria 571
114 Ga0206356_10659037 3300020070 Bacteria 559
115 Ga0206356_10768633 3300020070 Bacteria 580
116 Ga0206356_10788068 3300020070 Unclassified 578
117 Ga0206356_11077860 3300020070 Bacteria 596
118 Ga0206356_11442610 3300020070 Bacteria 578
119 Ga0206356_11754535 3300020070 Bacteria 545
120 Ga0206349_1056690 3300020075 Bacteria 792
121 Ga0206349_1085986 3300020075 Bacteria 588
122 Ga0206349_1178703 3300020075 Bacteria 576
123 Ga0206349_1184620 3300020075 Bacteria 616
124 Ga0206349_1250873 3300020075 Bacteria 563
125 Ga0206349_1375223 3300020075 Bacteria 576
126 Ga0206349_1532933 3300020075 Bacteria 590
127 Ga0206349_1544670 3300020075 Bacteria 643
128 Ga0206349_1803490 3300020075 Bacteria 629
129 Ga0206349_1935357 3300020075 Bacteria 578
130 Ga0206349_1954091 3300020075 Bacteria 599
131 Ga0206355_1020796 3300020076 Bacteria 596
132 Ga0206355_1075332 3300020076 Bacteria 568
133 Ga0206355_1122546 3300020076 Bacteria 651
134 Ga0206355_1154078 3300020076 Bacteria 604
135 Ga0206355_1200943 3300020076 Bacteria 582
136 Ga0206355_1526936 3300020076 Bacteria 588
137 Ga0206355_1548062 3300020076 Bacteria 581
138 Ga0206351_10112101 3300020077 Bacteria 542
139 Ga0206351_10199246 3300020077 Unclassified 573
140 Ga0206351_10553996 3300020077 Bacteria 715
141 Ga0206351_10634775 3300020077 Unclassified 568
142 Ga0206351_10738629 3300020077 Bacteria 645
143 Ga0206351_10818474 3300020077 Bacteria 581
144 Ga0206351_10845107 3300020077 Bacteria 575
145 Ga0206351_10850984 3300020077 Bacteria 610
146 Ga0206351_10879226 3300020077 Bacteria 612
147 Ga0206352_10014235 3300020078 Unclassified 574
148 Ga0206352_10196601 3300020078 Bacteria 513
149 Ga0206352_10272989 3300020078 Bacteria 556
150 Ga0206352_10311590 3300020078 Bacteria 584
151 Ga0206352_10536331 3300020078 Bacteria 571
152 Ga0206352_10647601 3300020078 Bacteria 571
153 Ga0206352_10787746 3300020078 Bacteria 583
154 Ga0206352_11169133 3300020078 Bacteria 577
155 Ga0206350_10286042 3300020080 Bacteria 571
156 Ga0206350_10340346 3300020080 Unclassified 566
157 Ga0206350_10373664 3300020080 Bacteria 605
158 Ga0206350_10468851 3300020080 Bacteria 580
159 Ga0206350_10556266 3300020080 Bacteria 585
160 Ga0206350_10661590 3300020080 Bacteria 608
161 Ga0206350_11271435 3300020080 Bacteria 575
162 Ga0206354_11258773 3300020081 Bacteria 605
163 Ga0206354_11287075 3300020081 Bacteria 743
164 Ga0206354_11617461 3300020081 Bacteria 578
165 Ga0206354_11641378 3300020081 Bacteria 522
166 Ga0206353_10358935 3300020082 Bacteria 596
167 Ga0206353_10418300 3300020082 Bacteria 569
168 Ga0206353_10534153 3300020082 Bacteria 766
169 Ga0206353_10858731 3300020082 Bacteria 678
170 Ga0206353_10884672 3300020082 Bacteria 704
171 Ga0206353_11068395 3300020082 Bacteria 601
172 Ga0206353_11825793 3300020082 Unclassified 571
173 Ga0206353_11845975 3300020082 Viruses 569
174 Ga0154015_1014313 3300020610 Bacteria 709
175 Ga0154015_1088008 3300020610 Bacteria 604
176 Ga0154015_1112766 3300020610 Bacteria 605
177 Ga0154015_1235973 3300020610 Bacteria 568
178 Ga0154015_1305739 3300020610 Bacteria 582
179 Ga0154015_1330142 3300020610 Bacteria 583
180 Ga0154015_1535960 3300020610 Bacteria 570
181 Ga0154015_1645856 3300020610 Bacteria 603
182 Ga0154015_1676621 3300020610 Bacteria 581
183 Ga0213875_10001607 3300021388 Bacteria 14297
184 Ga0213875_10011628 3300021388 Bacteria 4374
185 Ga0213871_10058982 3300021441 Unclassified 1066
186 Ga0224712_10088841 3300022467 Bacteria 1291
187 Ga0224712_10126970 3300022467 Bacteria 1110
188 Ga0224712_10194769 3300022467 Bacteria 919
189 Ga0224712_10235367 3300022467 Bacteria 842
190 Ga0224712_10250482 3300022467 Bacteria 818
191 Ga0224712_10289120 3300022467 Bacteria 764
192 Ga0224712_10306949 3300022467 Bacteria 743
193 Ga0224712_10391142 3300022467 Bacteria 662
194 Ga0224712_10437624 3300022467 Bacteria 627
195 Ga0224712_10482723 3300022467 Bacteria 598
196 Ga0224712_10506665 3300022467 Bacteria 584
197 Ga0224712_10507935 3300022467 Bacteria 583
198 Ga0224712_10509900 3300022467 Bacteria 582
199 Ga0224712_10518282 3300022467 Bacteria 577
200 Ga0224712_10521407 3300022467 Unclassified 576
201 Ga0224712_10526229 3300022467 Bacteria 573
202 Ga0224712_10534808 3300022467 Bacteria 569
203 Ga0224712_10543741 3300022467 Bacteria 564
204 Ga0247554_102999 3300023547 Bacteria 649
205 Ga0247554_104432 3300023547 Bacteria 575
206 Ga0247554_105854 3300023547 Bacteria 525
207 Ga0247551_103261 3300023552 Bacteria 618
208 Ga0247553_103883 3300023672 Bacteria 743
209 Ga0247553_108937 3300023672 Bacteria 563
210 Ga0207692_10901179 3300025898 Bacteria 582
211 Ga0207693_10465093 3300025915 Bacteria 988
212 Ga0207693_10897529 3300025915 Bacteria 680
213 Ga0207652_10084791 3300025921 Bacteria 2776
214 Ga0207700_11092572 3300025928 Bacteria 713
215 Ga0207702_11251036 3300026078 Bacteria 736
216 Ga0207698_11845496 3300026142 Bacteria 619
217 Ga0265762_1139071 3300030760 Bacteria 569
218 Ga0265762_1140282 3300030760 Bacteria 567
219 Ga0265775_108206 3300030762 Bacteria 634
220 Ga0265775_110862 3300030762 Bacteria 578
221 Ga0265775_111302 3300030762 Bacteria 570
222 Ga0265763_1033640 3300030763 Bacteria 592
223 Ga0265766_1012689 3300030863 Bacteria 625
224 Ga0265766_1015045 3300030863 Bacteria 594
225 Ga0265766_1016812 3300030863 Bacteria 576
226 Ga0265766_1018515 3300030863 Bacteria 559
227 Ga0265777_109239 3300030877 Bacteria 709
228 Ga0265777_114315 3300030877 Bacteria 611
229 Ga0265777_115242 3300030877 Bacteria 599
230 Ga0265777_117403 3300030877 Bacteria 574
231 Ga0265777_118743 3300030877 Bacteria 561
232 Ga0265777_119085 3300030877 Unclassified 557
233 Ga0265777_121682 3300030877 Bacteria 534
234 Ga0265776_105333 3300030880 Bacteria 674
235 Ga0265776_108142 3300030880 Unclassified 591
236 Ga0265776_109389 3300030880 Bacteria 569
237 Ga0265772_105033 3300030886 Bacteria 584
238 Ga0265769_103436 3300030888 Bacteria 884
239 Ga0265769_116039 3300030888 Bacteria 563
240 Ga0265761_107768 3300030889 Unclassified 591
241 Ga0265768_109781 3300030963 Bacteria 609
242 Ga0265768_110462 3300030963 Bacteria 597
243 Ga0265768_110891 3300030963 Bacteria 590
244 Ga0265773_1015059 3300031018 Bacteria 708
245 Ga0265779_110615 3300031043 Bacteria 567
246 Ga0265779_110846 3300031043 Unclassified 563
247 Ga0310117_128899 3300031592 Bacteria 540
248 Ga0316053_115132 3300032120 Bacteria 572
249 Ga0316053_115570 3300032120 Bacteria 567
250 Ga0373926_0019699 3300035083 Bacteria 2327
251 Ga0373943_0449944 3300035170 Bacteria 748
252 Ga0373927_0041422 3300035695 Bacteria 2987
253 Ga0373933_0051080 3300035724 Bacteria 2470
254 Ga0373947_0212557 3300035725 Bacteria 1269
255 Ga0310104_16700 3300036242 Bacteria 566
256 Ga0373937_0230286 3300036401 Bacteria 1745
257 Ga0373937_0368910 3300036401 Bacteria 1361
258 Ga0265778_028408 3300036457 Bacteria 716
259 Ga0265778_037382 3300036457 Bacteria 641
260 Ga0265778_045674 3300036457 Unclassified 591
261 Ga0265778_056422 3300036457 Bacteria 544
262 Ga0310112_048566 3300036458 Bacteria 576
263 Ga0373925_0122052 3300037068 Bacteria 2023
264 Ga0436364_0341381 3300037853 Bacteria 15601
265 Ga0436364_1505086 3300037853 Bacteria 23518
266 Ga0436360_1311691 3300039438 Bacteria 835
267 Ga0436361_0440751 3300039447 Bacteria 6102
268 Ga0436363_1325229 3300039450 Bacteria 744
269 Ga0436363_1439466 3300039450 Bacteria 641
270 Ga0436362_1059684 3300039453 Bacteria 712
271 Ga0495651_0015072 3300046462 Bacteria 5975
272 Ga0495662_0174674 3300046476 Bacteria 1059
273 Ga0495618_0474671 3300046514 Bacteria 757
274 Ga0495587_0354932 3300046536 Bacteria 817
275 Ga0495599_0036892 3300046678 Bacteria 3071
276 Ga0495674_0490983 3300047319 Bacteria 983
277 Ga0495680_0054882 3300047322 Bacteria 3092
278 Ga0495602_0186424 3300048088 Unclassified 1595
279 Ga0495602_0786001 3300048088 Bacteria 640
280 Ga0496112_0291473 3300048915 Bacteria 1578
281 Ga0496119_0008078 3300048922 Bacteria 9334
282 Ga0496120_0039790 3300048923 Bacteria 2770
283 Ga0496126_0216674 3300048929 Bacteria 1610
284 Ga0501037_0040233 3300049573 Bacteria 3440
285 Ga0501038_0039279 3300049574 Bacteria 4140
286 Ga0501035_0571166 3300049822 Bacteria 924
287 Ga0501044_0146401 3300049823 Bacteria 2347
288 nmdc:mga0sz30_147452_c1 3300050516 Bacteria 1040
289 Ga0495619_0241036 3300053085 Bacteria 1253
290 Ga0495619_0322556 3300053085 Bacteria 1069
291 Ga0587084_111680 3300059477 Bacteria 566
292 Ga0587093_054970 3300059478 Bacteria 637
293 Ga0587093_073177 3300059478 Bacteria 579
294 Ga0587093_077893 3300059478 Unclassified 567
295 Ga0587066_120954 3300059490 Bacteria 618
296 Ga0587066_136268 3300059490 Bacteria 595
297 Ga0587066_149196 3300059490 Bacteria 578
298 Ga0587070_122992 3300059491 Bacteria 623
299 Ga0587070_141431 3300059491 Bacteria 595
300 Ga0587073_0118867 3300059492 Bacteria 711
301 Ga0587073_0176974 3300059492 Bacteria 623
302 Ga0587073_0215368 3300059492 Bacteria 584
303 Ga0587077_092539 3300059493 Bacteria 713
304 Ga0587077_167757 3300059493 Bacteria 586
305 Ga0587077_175539 3300059493 Bacteria 577
306 Ga0587080_127478 3300059503 Bacteria 570
307 Ga0587080_129588 3300059503 Bacteria 567
308 Ga0587082_087766 3300059504 Bacteria 659
309 Ga0587082_089555 3300059504 Bacteria 654
310 Ga0587082_104796 3300059504 Bacteria 621
311 Ga0587082_118602 3300059504 Bacteria 595
312 Ga0587083_0186475 3300059505 Bacteria 584
313 Ga0587083_0194862 3300059505 Bacteria 575
314 Ga0587085_016139 3300059506 Bacteria 1077
315 Ga0587085_093876 3300059506 Bacteria 624
316 Ga0587085_123466 3300059506 Bacteria 571
317 Ga0587085_124762 3300059506 Bacteria 569
318 Ga0587085_127197 3300059506 Bacteria 566
319 Ga0587086_066264 3300059507 Bacteria 612
320 Ga0587086_079343 3300059507 Bacteria 576
321 Ga0587086_079917 3300059507 Bacteria 575
322 Ga0587086_082733 3300059507 Unclassified 568
323 Ga0587088_114387 3300059508 Bacteria 617
324 Ga0587088_128092 3300059508 Bacteria 594
325 Ga0587088_143135 3300059508 Bacteria 572
326 Ga0587089_069700 3300059509 Bacteria 595
327 Ga0587090_105907 3300059510 Bacteria 594
328 Ga0587090_115503 3300059510 Bacteria 577
329 Ga0587091_113352 3300059511 Bacteria 650
330 Ga0587091_118521 3300059511 Bacteria 640
331 Ga0587091_212355 3300059511 Bacteria 525
332 Ga0587092_076746 3300059512 Bacteria 653
333 Ga0587092_105110 3300059512 Viruses 586
334 Ga0587092_108472 3300059512 Bacteria 580
335 Ga0587094_051234 3300059513 Unclassified 700
336 Ga0587094_084013 3300059513 Bacteria 593
337 Ga0587095_027521 3300059514 Bacteria 575
338 Ga0587097_06811 3300059603 Bacteria 563
339 Ga0587098_074439 3300059604 Bacteria 556
340 Ga0587106_072906 3300059605 Viruses 654
341 Ga0587106_105853 3300059605 Bacteria 580
342 Ga0587106_113575 3300059605 Bacteria 567
343 Ga0587106_127768 3300059605 Bacteria 546
344 Ga0587125_036776 3300059607 Bacteria 647
345 Ga0587125_039178 3300059607 Bacteria 634
346 Ga0587125_061735 3300059607 Bacteria 549
347 Ga0587129_021612 3300059608 Unclassified 574
348 Ga0587131_017211 3300059609 Bacteria 571
349 Ga0587099_043849 3300059622 Bacteria 580
350 Ga0587099_045188 3300059622 Bacteria 575
351 Ga0587099_046974 3300059622 Unclassified 567
352 Ga0587101_028796 3300059623 Unclassified 853
353 Ga0587101_041768 3300059623 Bacteria 759
354 Ga0587101_099355 3300059623 Bacteria 576
355 Ga0587109_156663 3300059624 Bacteria 567
356 Ga0587109_180447 3300059624 Unclassified 539
357 Ga0587113_015261 3300059625 Unclassified 760
358 Ga0587113_033049 3300059625 Bacteria 594
359 Ga0587115_082782 3300059626 Bacteria 571
360 Ga0587115_083623 3300059626 Bacteria 569
361 Ga0587117_079936 3300059627 Bacteria 594
362 Ga0587122_044447 3300059628 Bacteria 561
363 Ga0587122_046298 3300059628 Bacteria 554
364 Ga0587127_019410 3300059629 Bacteria 593
365 Ga0587127_027296 3300059629 Bacteria 534
366 Ga0587128_066030 3300059630 Bacteria 694
367 Ga0587128_085497 3300059630 Bacteria 639
368 Ga0587130_034186 3300059631 Bacteria 595
369 Ga0587062_097392 3300059639 Bacteria 568
370 Ga0587067_050482 3300059640 Bacteria 840
371 Ga0587068_106732 3300059641 Bacteria 594
372 Ga0587069_107671 3300059642 Bacteria 577
373 Ga0587069_116119 3300059642 Bacteria 563
374 Ga0587072_128705 3300059643 Bacteria 594
375 Ga0587072_148802 3300059643 Bacteria 564
376 Ga0587075_023099 3300059644 Bacteria 938
377 Ga0587075_051859 3300059644 Unclassified 718
378 Ga0587075_098006 3300059644 Unclassified 581
379 Ga0587075_104063 3300059644 Bacteria 570
380 Ga0587075_104389 3300059644 Bacteria 569
381 Ga0587075_104626 3300059644 Unclassified 569
382 Ga0587075_111037 3300059644 Bacteria 558
383 Ga0587075_135364 3300059644 Bacteria 522
384 Ga0587076_150676 3300059645 Bacteria 564
385 Ga0587078_058539 3300059646 Bacteria 579
386 Ga0587078_060258 3300059646 Bacteria 574
387 Ga0587079_171170 3300059647 Bacteria 575
388 Ga0587079_173306 3300059647 Bacteria 572
389 Ga0587079_177877 3300059647 Bacteria 567
390 Ga0587100_029397 3300059648 Bacteria 576
391 Ga0587100_029603 3300059648 Bacteria 575
392 Ga0587102_044020 3300059649 Bacteria 584
393 Ga0587104_016655 3300059650 Bacteria 586
394 Ga0587104_017667 3300059650 Bacteria 575
395 Ga0587105_019018 3300059651 Bacteria 590
396 Ga0587107_070335 3300059652 Bacteria 637
397 Ga0587107_075911 3300059652 Bacteria 623
398 Ga0587108_029750 3300059653 Bacteria 554
399 Ga0587110_044357 3300059654 Bacteria 580
400 Ga0587110_044873 3300059654 Bacteria 577
401 Ga0587114_025847 3300059655 Bacteria 864
402 Ga0587114_073387 3300059655 Bacteria 624
403 Ga0587114_085671 3300059655 Bacteria 593
404 Ga0587114_091700 3300059655 Bacteria 580
405 Ga0587114_121044 3300059655 Bacteria 530
406 Ga0587118_19994 3300059657 Bacteria 554
407 Ga0587119_065657 3300059658 Bacteria 567
408 Ga0587120_028360 3300059659 Bacteria 563
409 Ga0587124_032883 3300059660 Bacteria 580
410 Ga0587071_108932 3300060344 Bacteria 649
411 Ga0587071_158921 3300060344 Bacteria 567
412 Ga0587071_189959 3300060344 Bacteria 532
413 Ga0587111_0055114 3300060346 Bacteria 888
414 Ga0587111_0113478 3300060346 Bacteria 689
415 Ga0587111_0162638 3300060346 Bacteria 608
416 Ga0265778_038899
417 Ga0006763J43179_101788
418 Ga0006779J45831_103634
419 Ga0006779J45831_105811
420 Ga0006765J45826_109527
421 Ga0006765J45826_110727
422 Ga0006778J45830_1001600
423 Ga0006778J45830_1008017
424 Ga0006778J45830_1012467
425 Ga0006778J45830_1013136
426 Ga0006778J45830_1017061
427 Ga0006778J45830_1035316
428 Ga0006759J45824_1023437
429 Ga0006759J45824_1031084
430 Ga0006759J45824_1036901
431 Ga0006759J45824_1042858
432 Ga0007428J48920_101086
433 Ga0007428J48920_107420
434 Ga0006770J48903_1002727
435 Ga0006770J48903_1013835
436 Ga0006770J48903_1020078
437 Ga0006770J48903_1048518
438 Ga0006777J48905_1001634
439 Ga0006777J48905_1005611
440 Ga0006777J48905_1011707
441 Ga0006777J48905_1011925
442 Ga0006777J48905_1013168
443 Ga0007417J51691_1008033
444 Ga0007417J51691_1010830
445 Ga0007417J51691_1014720
446 Ga0007417J51691_1022095
447 Ga0007417J51691_1028413
448 Ga0007417J51691_1089422
449 Ga0007427J51700_104080
450 Ga0007427J51700_107993
451 Ga0007427J51700_109565
452 Ga0006781J51513_1001458
453 Ga0006781J51513_1009633
454 Ga0006781J51513_1012628
455 Ga0006781J51513_1013136
456 Ga0006781J51513_1018746
457 Ga0006781J51513_1021489
458 Ga0007410J51695_1014338
459 Ga0007410J51695_1025304
460 Ga0007410J51695_1025920
461 Ga0007409J51694_1012669
462 Ga0007409J51694_1021167
463 Ga0007409J51694_1055258
464 Ga0007416J51690_1010467
465 Ga0007416J51690_1011503
466 Ga0007416J51690_1012493
467 Ga0007416J51690_1020360
468 Ga0007416J51690_1083005
469 Ga0007416J51690_1093496
470 Ga0007429J51699_1004302
471 Ga0007429J51699_1004981
472 Ga0007429J51699_1011534
473 Ga0007429J51699_1020242
474 Ga0007429J51699_1044156
475 Ga0007415J51800_101800
476 Ga0007415J51800_110259
477 Ga0032354_1023349
478 Ga0032354_1056821
479 Ga0006780_1000603
480 Ga0006780_1002092
481 Ga0006780_1005350
482 Ga0006780_1010408
483 Ga0058859_11522812
484 Ga0058859_11632497
485 Ga0058863_11713781
486 Ga0058861_10101867
487 Ga0058861_11659145
488 Ga0058861_11679846
489 Ga0058860_11984802
490 Ga0058862_10154774
491 Ga0058862_12843178
492 Ga0070680_100500854
493 Ga0070714_102103127
494 Ga0070710_10465874
495 Ga0070681_11223327
496 Ga0070679_100059278
497 Ga0068853_100775337
498 Ga0068856_100165510
499 Ga0070717_10997140
500 Ga0105240_10373708
501 Ga0130087_1075334
502 Ga0130086_1092599
503 Ga0130084_1091216
504 Ga0130085_1016975
505 Ga0154016_109395
506 Ga0154012_104758
507 Ga0154012_128387
508 Ga0154012_152542
509 Ga0157371_10688974
510 Ga0157370_10557135
511 Ga0157374_10532541
512 Ga0163163_10081939
513 Ga0182008_10236850
514 Ga0184597_100264
515 Ga0184596_124343
516 Ga0184594_108596
517 Ga0184598_124769
518 Ga0184601_114118
519 Ga0184601_121586
520 Ga0184599_101573
521 Ga0184599_118389
522 Ga0184600_125807
523 Ga0184603_126901
524 Ga0184603_150217
525 Ga0197907_10033368
526 Ga0197907_10318646
527 Ga0197907_10888164
528 Ga0197907_11311859
529 Ga0206356_10659037
530 Ga0206356_10768633
531 Ga0206356_10788068
532 Ga0206356_11077860
533 Ga0206356_11442610
534 Ga0206356_11754535
535 Ga0206349_1056690
536 Ga0206349_1085986
537 Ga0206349_1178703
538 Ga0206349_1184620
539 Ga0206349_1250873
540 Ga0206349_1375223
541 Ga0206349_1532933
542 Ga0206349_1544670
543 Ga0206349_1803490
544 Ga0206349_1935357
545 Ga0206349_1954091
546 Ga0206355_1020796
547 Ga0206355_1075332
548 Ga0206355_1122546
549 Ga0206355_1154078
550 Ga0206355_1200943
551 Ga0206355_1526936
552 Ga0206355_1548062
553 Ga0206351_10112101
554 Ga0206351_10199246
555 Ga0206351_10553996
556 Ga0206351_10634775
557 Ga0206351_10738629
558 Ga0206351_10818474
559 Ga0206351_10845107
560 Ga0206351_10850984
561 Ga0206351_10879226
562 Ga0206352_10014235
563 Ga0206352_10196601
564 Ga0206352_10272989
565 Ga0206352_10311590
566 Ga0206352_10536331
567 Ga0206352_10647601
568 Ga0206352_10787746
569 Ga0206352_11169133
570 Ga0206350_10286042
571 Ga0206350_10340346
572 Ga0206350_10373664
573 Ga0206350_10468851
574 Ga0206350_10556266
575 Ga0206350_10661590
576 Ga0206350_11271435
577 Ga0206354_11258773
578 Ga0206354_11287075
579 Ga0206354_11617461
580 Ga0206354_11641378
581 Ga0206353_10358935
582 Ga0206353_10418300
583 Ga0206353_10534153
584 Ga0206353_10858731
585 Ga0206353_10884672
586 Ga0206353_11068395
587 Ga0206353_11825793
588 Ga0206353_11845975
589 Ga0154015_1014313
590 Ga0154015_1088008
591 Ga0154015_1112766
592 Ga0154015_1235973
593 Ga0154015_1305739
594 Ga0154015_1330142
595 Ga0154015_1535960
596 Ga0154015_1645856
597 Ga0154015_1676621
598 Ga0213875_10001607
599 Ga0213875_10011628
600 Ga0213871_10058982
601 Ga0224712_10088841
602 Ga0224712_10126970
603 Ga0224712_10194769
604 Ga0224712_10235367
605 Ga0224712_10250482
606 Ga0224712_10289120
607 Ga0224712_10306949
608 Ga0224712_10391142
609 Ga0224712_10437624
610 Ga0224712_10482723
611 Ga0224712_10506665
612 Ga0224712_10507935
613 Ga0224712_10509900
614 Ga0224712_10518282
615 Ga0224712_10521407
616 Ga0224712_10526229
617 Ga0224712_10534808
618 Ga0224712_10543741
619 Ga0247554_102999
620 Ga0247554_104432
621 Ga0247554_105854
622 Ga0247551_103261
623 Ga0247553_103883
624 Ga0247553_108937
625 Ga0207692_10901179
626 Ga0207693_10465093
627 Ga0207693_10897529
628 Ga0207652_10084791
629 Ga0207700_11092572
630 Ga0207702_11251036
631 Ga0207698_11845496
632 Ga0265762_1139071
633 Ga0265762_1140282
634 Ga0265775_108206
635 Ga0265775_110862
636 Ga0265775_111302
637 Ga0265763_1033640
638 Ga0265766_1012689
639 Ga0265766_1015045
640 Ga0265766_1016812
641 Ga0265766_1018515
642 Ga0265777_109239
643 Ga0265777_114315
644 Ga0265777_115242
645 Ga0265777_117403
646 Ga0265777_118743
647 Ga0265777_119085
648 Ga0265777_121682
649 Ga0265776_105333
650 Ga0265776_108142
651 Ga0265776_109389
652 Ga0265772_105033
653 Ga0265769_103436
654 Ga0265769_116039
655 Ga0265761_107768
656 Ga0265768_109781
657 Ga0265768_110462
658 Ga0265768_110891
659 Ga0265773_1015059
660 Ga0265779_110615
661 Ga0265779_110846
662 Ga0310117_128899
663 Ga0316053_115132
664 Ga0316053_115570
665 Ga0373926_0019699
666 Ga0373943_0449944
667 Ga0373927_0041422
668 Ga0373933_0051080
669 Ga0373947_0212557
670 Ga0310104_16700
671 Ga0373937_0230286
672 Ga0373937_0368910
673 Ga0265778_028408
674 Ga0265778_037382
675 Ga0265778_045674
676 Ga0265778_056422
677 Ga0310112_048566
678 Ga0373925_0122052
679 Ga0436364_0341381
680 Ga0436364_1505086
681 Ga0436360_1311691
682 Ga0436361_0440751
683 Ga0436363_1325229
684 Ga0436363_1439466
685 Ga0436362_1059684
686 Ga0495651_0015072
687 Ga0495662_0174674
688 Ga0495618_0474671
689 Ga0495587_0354932
690 Ga0495599_0036892
691 Ga0495674_0490983
692 Ga0495680_0054882
693 Ga0495602_0186424
694 Ga0495602_0786001
695 Ga0496112_0291473
696 Ga0496119_0008078
697 Ga0496120_0039790
698 Ga0496126_0216674
699 Ga0501037_0040233
700 Ga0501038_0039279
701 Ga0501035_0571166
702 Ga0501044_0146401
703 nmdc:mga0sz30_147452_c1
704 Ga0495619_0241036
705 Ga0495619_0322556
706 Ga0587084_111680
707 Ga0587093_054970
708 Ga0587093_073177
709 Ga0587093_077893
710 Ga0587066_120954
711 Ga0587066_136268
712 Ga0587066_149196
713 Ga0587070_122992
714 Ga0587070_141431
715 Ga0587073_0118867
716 Ga0587073_0176974
717 Ga0587073_0215368
718 Ga0587077_092539
719 Ga0587077_167757
720 Ga0587077_175539
721 Ga0587080_127478
722 Ga0587080_129588
723 Ga0587082_087766
724 Ga0587082_089555
725 Ga0587082_104796
726 Ga0587082_118602
727 Ga0587083_0186475
728 Ga0587083_0194862
729 Ga0587085_016139
730 Ga0587085_093876
731 Ga0587085_123466
732 Ga0587085_124762
733 Ga0587085_127197
734 Ga0587086_066264
735 Ga0587086_079343
736 Ga0587086_079917
737 Ga0587086_082733
738 Ga0587088_114387
739 Ga0587088_128092
740 Ga0587088_143135
741 Ga0587089_069700
742 Ga0587090_105907
743 Ga0587090_115503
744 Ga0587091_113352
745 Ga0587091_118521
746 Ga0587091_212355
747 Ga0587092_076746
748 Ga0587092_105110
749 Ga0587092_108472
750 Ga0587094_051234
751 Ga0587094_084013
752 Ga0587095_027521
753 Ga0587097_06811
754 Ga0587098_074439
755 Ga0587106_072906
756 Ga0587106_105853
757 Ga0587106_113575
758 Ga0587106_127768
759 Ga0587125_036776
760 Ga0587125_039178
761 Ga0587125_061735
762 Ga0587129_021612
763 Ga0587131_017211
764 Ga0587099_043849
765 Ga0587099_045188
766 Ga0587099_046974
767 Ga0587101_028796
768 Ga0587101_041768
769 Ga0587101_099355
770 Ga0587109_156663
771 Ga0587109_180447
772 Ga0587113_015261
773 Ga0587113_033049
774 Ga0587115_082782
775 Ga0587115_083623
776 Ga0587117_079936
777 Ga0587122_044447
778 Ga0587122_046298
779 Ga0587127_019410
780 Ga0587127_027296
781 Ga0587128_066030
782 Ga0587128_085497
783 Ga0587130_034186
784 Ga0587062_097392
785 Ga0587067_050482
786 Ga0587068_106732
787 Ga0587069_107671
788 Ga0587069_116119
789 Ga0587072_128705
790 Ga0587072_148802
791 Ga0587075_023099
792 Ga0587075_051859
793 Ga0587075_098006
794 Ga0587075_104063
795 Ga0587075_104389
796 Ga0587075_104626
797 Ga0587075_111037
798 Ga0587075_135364
799 Ga0587076_150676
800 Ga0587078_058539
801 Ga0587078_060258
802 Ga0587079_171170
803 Ga0587079_173306
804 Ga0587079_177877
805 Ga0587100_029397
806 Ga0587100_029603
807 Ga0587102_044020
808 Ga0587104_016655
809 Ga0587104_017667
810 Ga0587105_019018
811 Ga0587107_070335
812 Ga0587107_075911
813 Ga0587108_029750
814 Ga0587110_044357
815 Ga0587110_044873
816 Ga0587114_025847
817 Ga0587114_073387
818 Ga0587114_085671
819 Ga0587114_091700
820 Ga0587114_121044
821 Ga0587118_19994
822 Ga0587119_065657
823 Ga0587120_028360
824 Ga0587124_032883
825 Ga0587071_108932
826 Ga0587071_158921
827 Ga0587071_189959
828 Ga0587111_0055114
829 Ga0587111_0113478
830 Ga0587111_0162638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

61

159

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zjd-assembly1.cif.gz_A small heat shock protein agsa from salmonella typhimurium: truncations at n- and c- termini 0.8386 34 124
7ck4-assembly1.cif.gz_F structural and functional analysis of small heat shock protein from synechococcus phage s-shm2 0.8202 36 127
4zjd-assembly1.cif.gz_A small heat shock protein agsa from salmonella typhimurium: truncations at n- and c- termini 0.8148 34 124
6pi9-assembly1.cif.gz_A-2 crystal structure of 16s rrna methyltransferase rmtf in complex with s-adenosyl-l-homocysteine 0.8104 102 125
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8002 34 125
ID Description Score Start End Superfamily
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.888 34 124 2.60.40.790
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8849 34 138 2.60.40.790
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.877 34 138 2.60.40.790
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8617 34 124 2.60.40.790
af_P0C058_31_135_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8338 34 138 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A812G2A0-F1-model_v4 Belongs to the small heat shock protein (HSP20) family 0.8944 52 138
AF-F3KHI5-F1-model_v4 16 kDa heat shock protein A 0.8915 43 138
AF-A0A4S0IBR2-F1-model_v4 deleted 0.8789 28 123
AF-A0A812G2A0-F1-model_v4 Belongs to the small heat shock protein (HSP20) family 0.8755 52 138
AF-A0A3B9EP23-F1-model_v4 Heat-shock protein 0.8464 35 146

Map