F438456

General Info

Members Datasets Scaffolds Average Seq Length
414 238 355 277

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2897803580|2897804738
Length 263
Sequence AMASTRPVADAEPVIRVRGLVTRFGTQTVHDGLDLDVRAGEVLGVVGGSGTGKSVLLKEILGLIRPTEGTIELLGHDTDGLSQRERTALQARTGVLFQNGALFSSMTVAENVMLPLKEHTALHPDLIAEIARVKIAMAGLPPDAGAKHPAQLSGGMIKRAGLARALALDPAILFLDEPTAGLDPIGAAAFDALIRGLQRSLGLTVFMVTHDLDSLTSICDRIAVLVDKKIKVATLEEHLADPHPWIHDYFHGPRGRAARHAKD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2643221720 Lysobacter sp. Root916 Isolate Unclassified
14 2643221727 Lysobacter sp. Root96 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
24 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
25 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
26 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
27 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
34 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
35 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
36 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
37 2919513703 Luteimonas sp. 3794 Isolate Unclassified
38 2919675420 Luteimonas terrae 4099 Isolate Unclassified
39 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
40 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
41 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
42 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
43 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
44 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
45 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
46 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
47 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
48 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
49 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
50 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
51 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
52 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
53 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
54 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
94 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
95 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
149 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
173 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
177 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
229 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
234 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
235 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
236 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
237 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
238 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.75
Metatranscriptomes 0
Isolates 14.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 23.19
Nodule 0.24
Rhizoplane 3.86
Rhizosphere 52.9
Stem 0
Stem Tuber 0
Unclassified 19.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_735520 2162886007 Bacteria 2161
2 JGI25152J39213_1000025 3300002773 Bacteria 103262
3 JGI25150J39212_1000066 3300002774 Bacteria 63677
4 JGI25151J46595_10000048 3300003187 Bacteria 166842
5 JGI25151J46595_10000139 3300003187 Bacteria 96000
6 JGI25153J46596_10000101 3300003215 Bacteria 96639
7 Ga0055526_1000005 3300003771 Bacteria 344542
8 Ga0055526_1014828 3300003771 Bacteria 3173
9 Ga0055537_1000155 3300003773 Bacteria 51676
10 Ga0055537_1000196 3300003773 Bacteria 45345
11 Ga0055524_1000005 3300003775 Bacteria 344542
12 Ga0055524_1032508 3300003775 Bacteria 1477
13 Ga0055524_1034119 3300003775 Bacteria 1414
14 Ga0055524_1034210 3300003775 Bacteria 1410
15 Ga0055524_1034694 3300003775 Bacteria 1390
16 Ga0055536_1000884 3300003781 Bacteria 19498
17 Ga0055536_1001044 3300003781 Bacteria 17503
18 Ga0055536_1002805 3300003781 Bacteria 9623
19 Ga0055536_1006076 3300003781 Bacteria 5724
20 Ga0055536_1006077 3300003781 Bacteria 5723
21 Ga0055536_1007437 3300003781 Bacteria 4903
22 Ga0055536_1014710 3300003781 Bacteria 2723
23 Ga0055534_1000002 3300003784 Bacteria 390762
24 Ga0055534_1000061 3300003784 Bacteria 82050
25 Ga0055528_1000002 3300003790 Bacteria 368879
26 Ga0055528_1000332 3300003790 Bacteria 39798
27 Ga0055530_10007112 3300003791 Bacteria 4796
28 Ga0055530_10007345 3300003791 Bacteria 4665
29 Ga0055531_10003356 3300003794 Bacteria 10233
30 Ga0055531_10007880 3300003794 Bacteria 5724
31 Ga0055531_10007883 3300003794 Bacteria 5723
32 Ga0055531_10008870 3300003794 Bacteria 5224
33 Ga0055531_10009144 3300003794 Bacteria 5106
34 Ga0055531_10013101 3300003794 Bacteria 3847
35 Ga0055531_10014484 3300003794 Bacteria 3545
36 Ga0055531_10038076 3300003794 Bacteria 1450
37 Ga0058692_1000026 3300003856 Bacteria 203096
38 Ga0058692_1000040 3300003856 Bacteria 132805
39 Ga0065165_1026565 3300005262 Bacteria 1903
40 Ga0065714_10008298 3300005288 Bacteria 3292
41 Ga0065704_10070252 3300005289 Bacteria 48050
42 Ga0065704_10103838 3300005289 Bacteria 2160
43 Ga0065715_10006280 3300005293 Bacteria 4636
44 Ga0065715_10141927 3300005293 Bacteria 1841
45 Ga0070670_100000703 3300005331 Bacteria 25979
46 Ga0070660_100042366 3300005339 Bacteria 3474
47 Ga0070687_100203200 3300005343 Bacteria 1202
48 Ga0070668_100002756 3300005347 Bacteria 12918
49 Ga0070669_100058092 3300005353 Bacteria 2839
50 Ga0070669_100154257 3300005353 Bacteria 1780
51 Ga0070671_100174774 3300005355 Bacteria 1817
52 Ga0070671_100323967 3300005355 Bacteria 1313
53 Ga0070673_100114767 3300005364 Bacteria 2239
54 Ga0070667_100172692 3300005367 Bacteria 1909
55 Ga0068867_100153999 3300005459 Bacteria 1808
56 Ga0070679_100250249 3300005530 Bacteria 1728
57 Ga0070672_100018635 3300005543 Bacteria 5023
58 Ga0070665_100016470 3300005548 Bacteria 7411
59 Ga0070665_100153254 3300005548 Bacteria 2307
60 Ga0070665_100195974 3300005548 Bacteria 2021
61 Ga0070664_100186641 3300005564 Bacteria 1845
62 Ga0068863_100123765 3300005841 Bacteria 2467
63 Ga0068862_100429034 3300005844 Bacteria 1242
64 Ga0081539_10007672 3300005985 Bacteria 9701
65 Ga0075364_10000338 3300006051 Bacteria 23298
66 Ga0075364_10046450 3300006051 Bacteria 2827
67 Ga0075364_10131340 3300006051 Bacteria 1681
68 Ga0075364_10229886 3300006051 Bacteria 1259
69 Ga0075364_10364371 3300006051 Bacteria 985
70 Ga0075369_10043378 3300006186 Bacteria 1930
71 Ga0105251_10000137 3300009011 Bacteria 74569
72 Ga0105251_10002139 3300009011 Bacteria 15876
73 Ga0105244_10055851 3300009036 Bacteria 2000
74 Ga0105244_10069057 3300009036 Bacteria 1765
75 Ga0105244_10076100 3300009036 Bacteria 1667
76 Ga0105243_10002790 3300009148 Bacteria 14512
77 Ga0105243_10017455 3300009148 Bacteria 5425
78 Ga0105028_100356 3300009993 Bacteria 4910
79 Ga0157318_1000886 3300012482 Bacteria 1405
80 Ga0157327_1001357 3300012512 Bacteria 1516
81 Ga0157373_10099945 3300013100 Bacteria 2041
82 Ga0157371_10000450 3300013102 Bacteria 50419
83 Ga0157371_10062123 3300013102 Bacteria 2648
84 Ga0157371_10297434 3300013102 Bacteria 1168
85 Ga0157370_10009863 3300013104 Bacteria 10122
86 Ga0157370_10065222 3300013104 Bacteria 3445
87 Ga0157370_10083661 3300013104 Bacteria 3000
88 Ga0157370_10362245 3300013104 Bacteria 1336
89 Ga0157375_10137834 3300013308 Bacteria 2565
90 Ga0182008_10000337 3300014497 Bacteria 36748
91 Ga0182008_10006047 3300014497 Bacteria 6808
92 Ga0182006_1038072 3300015261 Bacteria 1903
93 Ga0182006_1038798 3300015261 Bacteria 1882
94 Ga0182006_1043775 3300015261 Bacteria 1749
95 Ga0182006_1112792 3300015261 Bacteria 952
96 Ga0182007_10000190 3300015262 Bacteria 41334
97 Ga0182005_1000608 3300015265 Bacteria 17350
98 Ga0182005_1002422 3300015265 Bacteria 6676
99 Ga0163161_10002716 3300017792 Bacteria 12575
100 Ga0163161_10171474 3300017792 Bacteria 1659
101 Ga0163161_10326615 3300017792 Bacteria 1214
102 Ga0207425_1000040 3300025245 Bacteria 218121
103 Ga0207425_1003937 3300025245 Bacteria 4591
104 Ga0209129_1000011 3300025258 Bacteria 568657
105 Ga0209565_1000001 3300025263 Bacteria 2950419
106 Ga0209565_1000037 3300025263 Bacteria 289371
107 Ga0209673_1000001 3300025273 Bacteria 3176258
108 Ga0209673_1000032 3300025273 Bacteria 339956
109 Ga0209673_1013598 3300025273 Bacteria 3201
110 Ga0209130_1008098 3300025284 Bacteria 3148
111 Ga0209675_1000001 3300025291 Bacteria 2950293
112 Ga0209675_1000020 3300025291 Bacteria 335854
113 Ga0209675_1005655 3300025291 Bacteria 5171
114 Ga0209675_1009148 3300025291 Bacteria 3529
115 Ga0209676_1000052 3300025292 Bacteria 371539
116 Ga0209676_1000149 3300025292 Bacteria 167854
117 Ga0209676_1000199 3300025292 Bacteria 134270
118 Ga0209676_1000809 3300025292 Bacteria 40893
119 Ga0209676_1004762 3300025292 Bacteria 7400
120 Ga0209676_1005188 3300025292 Bacteria 6913
121 Ga0209676_1038263 3300025292 Bacteria 1375
122 Ga0209676_1039822 3300025292 Bacteria 1330
123 Ga0209025_1000002 3300025294 Bacteria 1393142
124 Ga0209025_1000006 3300025294 Bacteria 1153444
125 Ga0209025_1001646 3300025294 Bacteria 27568
126 Ga0209025_1002555 3300025294 Bacteria 18988
127 Ga0209025_1059002 3300025294 Bacteria 1452
128 Ga0209564_1000001 3300025295 Bacteria 3176258
129 Ga0209564_1000210 3300025295 Bacteria 133323
130 Ga0209564_1003278 3300025295 Bacteria 11286
131 Ga0209758_1000003 3300025297 Bacteria 1398533
132 Ga0209758_1015761 3300025297 Bacteria 3889
133 Ga0209050_1000199 3300025298 Bacteria 134682
134 Ga0209050_1000712 3300025298 Bacteria 48980
135 Ga0209050_1001428 3300025298 Bacteria 25771
136 Ga0209256_1000006 3300025299 Bacteria 1250310
137 Ga0209256_1003634 3300025299 Bacteria 10569
138 Ga0209256_1004476 3300025299 Bacteria 8739
139 Ga0209256_1005368 3300025299 Bacteria 7419
140 Ga0209256_1005687 3300025299 Bacteria 7005
141 Ga0209256_1011572 3300025299 Bacteria 3508
142 Ga0209051_1001701 3300025303 Bacteria 17612
143 Ga0209051_1022435 3300025303 Bacteria 2657
144 Ga0209257_1000067 3300025304 Bacteria 342468
145 Ga0209257_1000078 3300025304 Bacteria 317483
146 Ga0209257_1000086 3300025304 Bacteria 287437
147 Ga0209257_1000210 3300025304 Bacteria 140822
148 Ga0209257_1000856 3300025304 Bacteria 43386
149 Ga0209257_1002551 3300025304 Bacteria 17780
150 Ga0209257_1003823 3300025304 Bacteria 12350
151 Ga0209257_1007682 3300025304 Bacteria 6440
152 Ga0209257_1008450 3300025304 Bacteria 5846
153 Ga0207713_1000253 3300025735 Bacteria 66728
154 Ga0207705_10086111 3300025909 Bacteria 2296
155 Ga0207657_10005751 3300025919 Bacteria 12936
156 Ga0207681_10042775 3300025923 Bacteria 3028
157 Ga0207681_10125472 3300025923 Bacteria 1889
158 Ga0207650_10002182 3300025925 Bacteria 13673
159 Ga0207664_10512289 3300025929 Bacteria 1075
160 Ga0207644_10019318 3300025931 Bacteria 4621
161 Ga0207644_10062773 3300025931 Bacteria 2696
162 Ga0207709_10001199 3300025935 Bacteria 18687
163 Ga0207709_10089360 3300025935 Bacteria 2008
164 Ga0207669_10041033 3300025937 Bacteria 2690
165 Ga0207691_10006060 3300025940 Bacteria 11679
166 Ga0207691_10521247 3300025940 Bacteria 1009
167 Ga0207711_10403144 3300025941 Bacteria 1271
168 Ga0207651_10165609 3300025960 Bacteria 1738
169 Ga0207668_10028783 3300025972 Bacteria 3636
170 Ga0207658_10203367 3300025986 Bacteria 1655
171 Ga0207641_10224987 3300026088 Bacteria 1742
172 Ga0207648_10107481 3300026089 Bacteria 2449
173 Ga0207675_100162268 3300026118 Bacteria 2132
174 Ga0207683_10057958 3300026121 Bacteria 3400
175 Ga0209371_1000028 3300027312 Bacteria 429688
176 Ga0209371_1000048 3300027312 Bacteria 281705
177 Ga0209984_1002478 3300027424 Bacteria 2066
178 Ga0209995_1006177 3300027471 Bacteria 1926
179 Ga0209982_1001785 3300027552 Bacteria 2968
180 Ga0209970_1005807 3300027614 Bacteria 2029
181 Ga0209983_1002679 3300027665 Bacteria 3863
182 Ga0209971_1001328 3300027682 Bacteria 6144
183 Ga0209974_10006855 3300027876 Bacteria 3952
184 Ga0268266_10152671 3300028379 Bacteria 2083
185 Ga0268266_10165070 3300028379 Bacteria 2005
186 Ga0268256_1000030 3300030500 Bacteria 429688
187 Ga0268256_1000049 3300030500 Bacteria 307229
188 Ga0316177_1058281 3300030731 Bacteria 4365
189 Ga0316176_1171281 3300030732 Bacteria 7751
190 Ga0316183_1047705 3300030742 Bacteria 4470
191 Ga0316182_1098843 3300030745 Bacteria 2343
192 Ga0316182_1386178 3300030745 Bacteria 4883
193 Ga0307513_10025478 3300031456 Bacteria 6851
194 Ga0307513_10079193 3300031456 Bacteria 3396
195 Ga0307513_10367311 3300031456 Bacteria 1182
196 Ga0307408_100176765 3300031548 Bacteria 1708
197 Ga0307408_100190686 3300031548 Bacteria 1651
198 Ga0307405_10078178 3300031731 Bacteria 2152
199 Ga0307405_10533244 3300031731 Bacteria 947
200 Ga0307413_10001177 3300031824 Bacteria 9634
201 Ga0307413_10011886 3300031824 Bacteria 4305
202 Ga0307413_10347559 3300031824 Bacteria 1143
203 Ga0307410_10071283 3300031852 Bacteria 2409
204 Ga0307406_10004205 3300031901 Bacteria 7839
205 Ga0307406_10023287 3300031901 Bacteria 3683
206 Ga0307412_10123177 3300031911 Bacteria 1870
207 Ga0307412_10141018 3300031911 Bacteria 1765
208 Ga0307412_10313508 3300031911 Bacteria 1245
209 Ga0307412_10315244 3300031911 Bacteria 1242
210 Ga0307412_10489538 3300031911 Bacteria 1021
211 Ga0307412_10548967 3300031911 Bacteria 970
212 Ga0307409_100465508 3300031995 Bacteria 1223
213 Ga0307414_10014168 3300032004 Bacteria 4768
214 Ga0307414_10026607 3300032004 Bacteria 3726
215 Ga0307414_10032758 3300032004 Bacteria 3426
216 Ga0307414_10055362 3300032004 Bacteria 2777
217 Ga0307414_10115433 3300032004 Bacteria 2053
218 Ga0307414_10123902 3300032004 Bacteria 1992
219 Ga0307414_10293621 3300032004 Bacteria 1371
220 Ga0307414_10341168 3300032004 Bacteria 1282
221 Ga0307414_10365657 3300032004 Bacteria 1243
222 Ga0307414_10499884 3300032004 Bacteria 1075
223 Ga0307411_10045450 3300032005 Bacteria 2824
224 Ga0307411_10065231 3300032005 Bacteria 2441
225 Ga0307415_100130555 3300032126 Bacteria 1901
226 Ga0307415_100135359 3300032126 Bacteria 1873
227 Ga0307415_100673627 3300032126 Bacteria 930
228 Ga0395899_0022990 3300037312 Bacteria 4723
229 Ga0395900_0017998 3300037418 Bacteria 7214
230 Ga0395900_0063155 3300037418 Bacteria 3807
231 Ga0395900_0444042 3300037418 Bacteria 1254
232 Ga0395898_0073105 3300037466 Bacteria 3312
233 Ga0395898_0171631 3300037466 Bacteria 2073
234 Ga0395905_0001074 3300037471 Bacteria 34427
235 Ga0395901_0183095 3300038443 Bacteria 2197
236 Ga0237819_00359 3300038705 Bacteria 16293
237 Ga0237819_04327 3300038705 Bacteria 2351
238 Ga0439436_0003041 3300041404 Bacteria 5085
239 Ga0439436_0021588 3300041404 Bacteria 1912
240 Ga0439436_0027022 3300041404 Bacteria 1681
241 Ga0439439_0015142 3300041406 Bacteria 1881
242 Ga0439447_000572 3300041407 Bacteria 13707
243 Ga0439465_0001726 3300041413 Bacteria 7145
244 Ga0439465_0005377 3300041413 Bacteria 4086
245 Ga0439465_0009343 3300041413 Bacteria 3089
246 Ga0451791_0496661 3300041451 Bacteria 1117
247 Ga0451793_0812868 3300041452 Bacteria 2361
248 Ga0451800_0090666 3300041459 Bacteria 11492
249 Ga0451802_0609880 3300041460 Bacteria 1592
250 Ga0451806_089816 3300041462 Bacteria 6209
251 Ga0451804_0284152 3300041463 Bacteria 3976
252 Ga0451807_1017421 3300041486 Bacteria 6510
253 Ga0451837_0327209 3300041494 Bacteria 2441
254 Ga0451853_2125846 3300041512 Bacteria 1741
255 Ga0439445_0000632 3300042004 Bacteria 7231
256 Ga0439445_0012204 3300042004 Bacteria 2061
257 Ga0439432_015435 3300042006 Bacteria 2577
258 Ga0439449_0000110 3300042007 Bacteria 26752
259 Ga0439449_0011713 3300042007 Bacteria 3297
260 Ga0439449_0012058 3300042007 Bacteria 3249
261 Ga0439449_0019262 3300042007 Bacteria 2558
262 Ga0439449_0065186 3300042007 Bacteria 1344
263 Ga0450911_018138 3300042115 Bacteria 924
264 Ga0451577_0089906 3300042876 Bacteria 2740
265 Ga0453684_0865559 3300044712 Bacteria 970
266 Ga0495627_015437 3300046453 Bacteria 2636
267 Ga0495638_0001623 3300046460 Bacteria 20015
268 Ga0495638_0097576 3300046460 Bacteria 1762
269 Ga0495606_0004925 3300046507 Bacteria 13065
270 Ga0495610_0010873 3300046512 Bacteria 5617
271 Ga0495616_0079145 3300046513 Bacteria 1576
272 Ga0495643_0001001 3300046522 Bacteria 28863
273 Ga0495663_0000476 3300046525 Bacteria 14635
274 Ga0495663_0007639 3300046525 Bacteria 2991
275 Ga0495663_0037387 3300046525 Bacteria 1464
276 Ga0495663_0061048 3300046525 Bacteria 1185
277 Ga0495656_0001726 3300046615 Bacteria 7154
278 Ga0495625_0060295 3300046660 Bacteria 2688
279 Ga0495636_0004313 3300047318 Bacteria 5582
280 Ga0495636_0040614 3300047318 Bacteria 1929
281 Ga0495672_0000079 3300047320 Bacteria 161885
282 Ga0495686_0187303 3300047472 Bacteria 1195
283 Ga0496101_0028411 3300048904 Bacteria 3904
284 Ga0496102_0064577 3300048905 Bacteria 3353
285 Ga0496107_0042741 3300048910 Bacteria 3255
286 Ga0496108_0011721 3300048911 Bacteria 7131
287 Ga0496110_0364487 3300048913 Bacteria 1316
288 Ga0496113_0002864 3300048916 Bacteria 10150
289 Ga0496113_0063180 3300048916 Bacteria 2798
290 Ga0496114_0027535 3300048917 Bacteria 4657
291 Ga0496114_0168743 3300048917 Bacteria 1906
292 Ga0496116_0127837 3300048919 Bacteria 1455
293 Ga0496116_0189257 3300048919 Bacteria 1091
294 Ga0496117_0002697 3300048920 Bacteria 21945
295 Ga0496117_0003166 3300048920 Bacteria 19565
296 Ga0496117_0004571 3300048920 Bacteria 15148
297 Ga0496117_0267203 3300048920 Bacteria 923
298 Ga0496118_0001003 3300048921 Bacteria 43972
299 Ga0496118_0003380 3300048921 Bacteria 20165
300 Ga0496118_0059472 3300048921 Bacteria 2845
301 Ga0496118_0062370 3300048921 Bacteria 2752
302 Ga0496118_0287648 3300048921 Bacteria 910
303 Ga0496119_0002376 3300048922 Bacteria 20680
304 Ga0496119_0008016 3300048922 Bacteria 9383
305 Ga0496120_0000187 3300048923 Bacteria 105936
306 Ga0496120_0000262 3300048923 Bacteria 88205
307 Ga0496121_0004653 3300048924 Bacteria 18233
308 Ga0496121_0023676 3300048924 Bacteria 5903
309 Ga0496121_0047866 3300048924 Bacteria 3643
310 Ga0496122_0000537 3300048925 Bacteria 78505
311 Ga0496122_0004336 3300048925 Bacteria 17741
312 Ga0496122_0005021 3300048925 Bacteria 16008
313 Ga0496123_0000987 3300048926 Bacteria 43765
314 Ga0496123_0002493 3300048926 Bacteria 22713
315 Ga0496123_0022047 3300048926 Bacteria 4926
316 Ga0496123_0085368 3300048926 Bacteria 1899
317 Ga0496124_0000034 3300048927 Bacteria 325332
318 Ga0496124_0001915 3300048927 Bacteria 28557
319 Ga0496124_0003704 3300048927 Bacteria 18456
320 Ga0496124_0003734 3300048927 Bacteria 18364
321 Ga0496124_0144232 3300048927 Bacteria 1875
322 Ga0496125_0002381 3300048928 Bacteria 24515
323 Ga0496125_0046423 3300048928 Bacteria 3644
324 Ga0496125_0059428 3300048928 Bacteria 3080
325 Ga0496125_0086174 3300048928 Bacteria 2376
326 Ga0496125_0101801 3300048928 Bacteria 2112
327 Ga0496125_0107796 3300048928 Bacteria 2028
328 Ga0496126_0000847 3300048929 Bacteria 54109
329 Ga0496126_0052845 3300048929 Bacteria 3690
330 Ga0496126_0346804 3300048929 Bacteria 1215
331 Ga0501032_0010454 3300049569 Bacteria 6694
332 Ga0501032_0077170 3300049569 Bacteria 2218
333 Ga0501033_0036640 3300049570 Bacteria 3674
334 Ga0501034_0000841 3300049571 Bacteria 45502
335 Ga0501034_0002118 3300049571 Bacteria 24708
336 Ga0501034_0004379 3300049571 Bacteria 15729
337 Ga0501034_0013621 3300049571 Bacteria 8366
338 Ga0501036_0023284 3300049572 Bacteria 5216
339 Ga0501037_0012880 3300049573 Bacteria 6164
340 Ga0501039_0068805 3300049575 Bacteria 2748
341 Ga0501043_0006846 3300049579 Bacteria 9101
342 Ga0501043_0009855 3300049579 Bacteria 7491
343 Ga0501070_0028559 3300049586 Bacteria 4679
344 Ga0501070_0066699 3300049586 Bacteria 2980
345 Ga0501073_0059486 3300049589 Bacteria 2668
346 Ga0501252_005528 3300049682 Bacteria 1378
347 Ga0501080_0008923 3300049742 Bacteria 9118
348 Ga0501266_007081 3300049763 Bacteria 1400
349 Ga0501275_000990 3300049772 Bacteria 2969
350 Ga0501035_0013862 3300049822 Bacteria 7441
351 Ga0501044_0001736 3300049823 Bacteria 25462
352 Ga0501044_0156919 3300049823 Bacteria 2254
353 nmdc:mga00v17_122406_c1 3300050491 Bacteria 1658
354 nmdc:mga00v17_4430_c1 3300050491 Bacteria 7308
355 nmdc:mga00v17_99684_c1 3300050491 Bacteria 1833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2522572158 2523105237 253
2 iso_pu_bacteria 2897803580 2897804738 253
3 3300032004 Ga0307414_10341168 Ga0307414_103411682 254
4 3300005339 Ga0070660_100042366 Ga0070660_1000423662 256
5 3300013104 Ga0157370_10065222 Ga0157370_100652225 256
6 3300025919 Ga0207657_10005751 Ga0207657_100057516 256
7 3300031911 Ga0307412_10313508 Ga0307412_103135082 256
8 3300049569 Ga0501032_0077170 Ga0501032_0077170_14_799 256
9 3300049586 Ga0501070_0028559 Ga0501070_0028559_2311_3096 256
10 3300049823 Ga0501044_0156919 Ga0501044_0156919_160_945 256
11 3300005355 Ga0070671_100323967 Ga0070671_1003239672 257
12 3300005530 Ga0070679_100250249 Ga0070679_1002502492 257
13 3300005841 Ga0068863_100123765 Ga0068863_1001237653 257
14 3300012482 Ga0157318_1000886 Ga0157318_10008862 257
15 3300025909 Ga0207705_10086111 Ga0207705_100861113 257
16 3300025940 Ga0207691_10521247 Ga0207691_105212472 257
17 3300026088 Ga0207641_10224987 Ga0207641_102249872 257
18 3300026118 Ga0207675_100162268 Ga0207675_1001622683 257
19 3300046507 Ga0495606_0004925 Ga0495606_0004925_11280_12101 257
20 3300046513 Ga0495616_0079145 Ga0495616_0079145_568_1389 257
21 3300046615 Ga0495656_0001726 Ga0495656_0001726_2162_2968 257
22 3300047318 Ga0495636_0040614 Ga0495636_0040614_854_1648 257
23 3300048905 Ga0496102_0064577 Ga0496102_0064577_2302_3096 257
24 3300048910 Ga0496107_0042741 Ga0496107_0042741_289_1083 257
25 3300048911 Ga0496108_0011721 Ga0496108_0011721_4521_5315 257
26 3300048913 Ga0496110_0364487 Ga0496110_0364487_482_1276 257
27 3300048916 Ga0496113_0063180 Ga0496113_0063180_1510_2304 257
28 3300048917 Ga0496114_0168743 Ga0496114_0168743_243_1037 257
29 3300048927 Ga0496124_0000034 Ga0496124_0000034_169616_170434 257
30 3300048928 Ga0496125_0101801 Ga0496125_0101801_161_937 257
31 3300049570 Ga0501033_0036640 Ga0501033_0036640_2070_2855 257
32 iso_pu_bacteria 2842780639 2842782022 257
33 3300005564 Ga0070664_100186641 Ga0070664_1001866412 258
34 3300012512 Ga0157327_1001357 Ga0157327_10013572 258
35 3300015261 Ga0182006_1038798 Ga0182006_10387982 258
36 3300037418 Ga0395900_0063155 Ga0395900_0063155_2678_3487 258
37 3300046525 Ga0495663_0037387 Ga0495663_0037387_50_889 258
38 3300047472 Ga0495686_0187303 Ga0495686_0187303_117_905 258
39 3300003856 Ga0058692_1000040 Ga0058692_100004095 259
40 3300005289 Ga0065704_10070252 Ga0065704_100702528 259
41 3300005331 Ga0070670_100000703 Ga0070670_10000070318 259
42 3300005343 Ga0070687_100203200 Ga0070687_1002032002 259
43 3300005353 Ga0070669_100154257 Ga0070669_1001542572 259
44 3300005355 Ga0070671_100174774 Ga0070671_1001747742 259
45 3300005364 Ga0070673_100114767 Ga0070673_1001147672 259
46 3300005459 Ga0068867_100153999 Ga0068867_1001539992 259
47 3300005543 Ga0070672_100018635 Ga0070672_1000186353 259
48 3300009011 Ga0105251_10000137 Ga0105251_1000013726 259
49 3300009993 Ga0105028_100356 Ga0105028_1003563 259
50 3300013308 Ga0157375_10137834 Ga0157375_101378341 259
51 3300025735 Ga0207713_1000253 Ga0207713_100025360 259
52 3300025923 Ga0207681_10125472 Ga0207681_101254722 259
53 3300025925 Ga0207650_10002182 Ga0207650_100021828 259
54 3300025931 Ga0207644_10062773 Ga0207644_100627732 259
55 3300025937 Ga0207669_10041033 Ga0207669_100410332 259
56 3300025940 Ga0207691_10006060 Ga0207691_100060607 259
57 3300025960 Ga0207651_10165609 Ga0207651_101656092 259
58 3300026089 Ga0207648_10107481 Ga0207648_101074812 259
59 3300027312 Ga0209371_1000048 Ga0209371_1000048224 259
60 3300030500 Ga0268256_1000049 Ga0268256_100004944 259
61 3300031731 Ga0307405_10078178 Ga0307405_100781782 259
62 3300031852 Ga0307410_10071283 Ga0307410_100712833 259
63 3300031911 Ga0307412_10141018 Ga0307412_101410182 259
64 3300032005 Ga0307411_10045450 Ga0307411_100454503 259
65 3300032126 Ga0307415_100135359 Ga0307415_1001353592 259
66 3300038705 Ga0237819_00359 Ga0237819_00359_9874_10695 259
67 3300042007 Ga0439449_0011713 Ga0439449_0011713_2297_3121 259
68 3300048920 Ga0496117_0002697 Ga0496117_0002697_16800_17615 259
69 3300048922 Ga0496119_0008016 Ga0496119_0008016_8298_9113 259
70 3300048923 Ga0496120_0000262 Ga0496120_0000262_74184_74999 259
71 3300048925 Ga0496122_0000537 Ga0496122_0000537_9889_10698 259
72 3300048925 Ga0496122_0004336 Ga0496122_0004336_8668_9483 259
73 3300048926 Ga0496123_0000987 Ga0496123_0000987_9740_10549 259
74 3300048926 Ga0496123_0002493 Ga0496123_0002493_13209_14024 259
75 3300048927 Ga0496124_0001915 Ga0496124_0001915_14750_15565 259
76 iso_pu_bacteria 2987605356 2987608849 259
77 3300003794 Ga0055531_10003356 Ga0055531_100033569 260
78 3300006051 Ga0075364_10000338 Ga0075364_1000033822 260
79 3300025304 Ga0209257_1000067 Ga0209257_100006787 260
80 3300048925 Ga0496122_0005021 Ga0496122_0005021_2913_3728 260
81 3300048929 Ga0496126_0346804 Ga0496126_0346804_234_1049 260
82 3300050491 nmdc:mga00v17_4430_c1 nmdc:mga00v17_4430_c1_1477_2277 260
83 3300003771 Ga0055526_1014828 Ga0055526_10148283 261
84 3300003773 Ga0055537_1000196 Ga0055537_100019623 261
85 3300003775 Ga0055524_1032508 Ga0055524_10325082 261
86 3300003775 Ga0055524_1034119 Ga0055524_10341192 261
87 3300003775 Ga0055524_1034210 Ga0055524_10342102 261
88 3300003775 Ga0055524_1034694 Ga0055524_10346942 261
89 3300003781 Ga0055536_1000884 Ga0055536_10008844 261
90 3300003781 Ga0055536_1002805 Ga0055536_10028055 261
91 3300003781 Ga0055536_1006076 Ga0055536_10060765 261
92 3300003781 Ga0055536_1006077 Ga0055536_10060771 261
93 3300003781 Ga0055536_1007437 Ga0055536_10074372 261
94 3300003781 Ga0055536_1014710 Ga0055536_10147102 261
95 3300003784 Ga0055534_1000061 Ga0055534_100006146 261
96 3300003790 Ga0055528_1000332 Ga0055528_10003325 261
97 3300003791 Ga0055530_10007112 Ga0055530_100071122 261
98 3300003791 Ga0055530_10007345 Ga0055530_100073454 261
99 3300003794 Ga0055531_10007880 Ga0055531_100078805 261
100 3300003794 Ga0055531_10007883 Ga0055531_100078835 261
101 3300003794 Ga0055531_10008870 Ga0055531_100088705 261
102 3300003794 Ga0055531_10009144 Ga0055531_100091443 261
103 3300003794 Ga0055531_10013101 Ga0055531_100131015 261
104 3300003794 Ga0055531_10038076 Ga0055531_100380762 261
105 3300003856 Ga0058692_1000026 Ga0058692_1000026168 261
106 3300005262 Ga0065165_1026565 Ga0065165_10265652 261
107 3300005353 Ga0070669_100058092 Ga0070669_1000580922 261
108 3300005548 Ga0070665_100016470 Ga0070665_1000164707 261
109 3300005548 Ga0070665_100153254 Ga0070665_1001532542 261
110 3300005985 Ga0081539_10007672 Ga0081539_100076725 261
111 3300006051 Ga0075364_10364371 Ga0075364_103643712 261
112 3300006186 Ga0075369_10043378 Ga0075369_100433782 261
113 3300009011 Ga0105251_10002139 Ga0105251_100021397 261
114 3300009036 Ga0105244_10055851 Ga0105244_100558512 261
115 3300009036 Ga0105244_10069057 Ga0105244_100690572 261
116 3300009036 Ga0105244_10076100 Ga0105244_100761002 261
117 3300009148 Ga0105243_10002790 Ga0105243_100027906 261
118 3300009148 Ga0105243_10017455 Ga0105243_100174554 261
119 3300013100 Ga0157373_10099945 Ga0157373_100999451 261
120 3300013102 Ga0157371_10000450 Ga0157371_100004505 261
121 3300013102 Ga0157371_10062123 Ga0157371_100621232 261
122 3300013102 Ga0157371_10297434 Ga0157371_102974342 261
123 3300013104 Ga0157370_10009863 Ga0157370_100098634 261
124 3300013104 Ga0157370_10083661 Ga0157370_100836611 261
125 3300013104 Ga0157370_10362245 Ga0157370_103622452 261
126 3300014497 Ga0182008_10000337 Ga0182008_1000033733 261
127 3300014497 Ga0182008_10006047 Ga0182008_100060473 261
128 3300015261 Ga0182006_1038072 Ga0182006_10380722 261
129 3300015261 Ga0182006_1043775 Ga0182006_10437752 261
130 3300015261 Ga0182006_1112792 Ga0182006_11127922 261
131 3300015262 Ga0182007_10000190 Ga0182007_1000019014 261
132 3300015265 Ga0182005_1000608 Ga0182005_10006087 261
133 3300015265 Ga0182005_1002422 Ga0182005_10024222 261
134 3300017792 Ga0163161_10002716 Ga0163161_1000271611 261
135 3300017792 Ga0163161_10171474 Ga0163161_101714742 261
136 3300017792 Ga0163161_10326615 Ga0163161_103266151 261
137 3300025263 Ga0209565_1000037 Ga0209565_100003754 261
138 3300025273 Ga0209673_1000032 Ga0209673_1000032158 261
139 3300025273 Ga0209673_1013598 Ga0209673_10135982 261
140 3300025284 Ga0209130_1008098 Ga0209130_10080982 261
141 3300025291 Ga0209675_1000020 Ga0209675_100002089 261
142 3300025291 Ga0209675_1005655 Ga0209675_10056555 261
143 3300025291 Ga0209675_1009148 Ga0209675_10091483 261
144 3300025292 Ga0209676_1000149 Ga0209676_100014974 261
145 3300025292 Ga0209676_1000199 Ga0209676_100019939 261
146 3300025292 Ga0209676_1000809 Ga0209676_10008095 261
147 3300025292 Ga0209676_1004762 Ga0209676_10047625 261
148 3300025292 Ga0209676_1005188 Ga0209676_10051882 261
149 3300025292 Ga0209676_1038263 Ga0209676_10382632 261
150 3300025292 Ga0209676_1039822 Ga0209676_10398222 261
151 3300025294 Ga0209025_1002555 Ga0209025_10025555 261
152 3300025294 Ga0209025_1059002 Ga0209025_10590022 261
153 3300025295 Ga0209564_1000210 Ga0209564_100021034 261
154 3300025295 Ga0209564_1003278 Ga0209564_10032788 261
155 3300025298 Ga0209050_1000199 Ga0209050_100019972 261
156 3300025298 Ga0209050_1000712 Ga0209050_100071235 261
157 3300025298 Ga0209050_1001428 Ga0209050_100142816 261
158 3300025299 Ga0209256_1003634 Ga0209256_10036342 261
159 3300025299 Ga0209256_1004476 Ga0209256_10044762 261
160 3300025299 Ga0209256_1005368 Ga0209256_10053682 261
161 3300025299 Ga0209256_1005687 Ga0209256_10056877 261
162 3300025299 Ga0209256_1011572 Ga0209256_10115723 261
163 3300025303 Ga0209051_1001701 Ga0209051_100170117 261
164 3300025303 Ga0209051_1022435 Ga0209051_10224353 261
165 3300025304 Ga0209257_1000086 Ga0209257_1000086181 261
166 3300025304 Ga0209257_1000210 Ga0209257_100021038 261
167 3300025304 Ga0209257_1000856 Ga0209257_10008569 261
168 3300025304 Ga0209257_1002551 Ga0209257_100255112 261
169 3300025304 Ga0209257_1003823 Ga0209257_10038232 261
170 3300025304 Ga0209257_1007682 Ga0209257_10076826 261
171 3300025304 Ga0209257_1008450 Ga0209257_10084505 261
172 3300025923 Ga0207681_10042775 Ga0207681_100427752 261
173 3300025931 Ga0207644_10019318 Ga0207644_100193183 261
174 3300025935 Ga0207709_10001199 Ga0207709_100011995 261
175 3300025935 Ga0207709_10089360 Ga0207709_100893602 261
176 3300025941 Ga0207711_10403144 Ga0207711_104031442 261
177 3300026121 Ga0207683_10057958 Ga0207683_100579583 261
178 3300027312 Ga0209371_1000028 Ga0209371_1000028190 261
179 3300028379 Ga0268266_10165070 Ga0268266_101650702 261
180 3300030500 Ga0268256_1000030 Ga0268256_1000030204 261
181 3300030732 Ga0316176_1171281 Ga0316176_11712813 261
182 3300030742 Ga0316183_1047705 Ga0316183_10477055 261
183 3300030745 Ga0316182_1386178 Ga0316182_13861783 261
184 3300031548 Ga0307408_100176765 Ga0307408_1001767652 261
185 3300031731 Ga0307405_10533244 Ga0307405_105332441 261
186 3300031901 Ga0307406_10004205 Ga0307406_100042052 261
187 3300031901 Ga0307406_10023287 Ga0307406_100232873 261
188 3300031911 Ga0307412_10123177 Ga0307412_101231772 261
189 3300031911 Ga0307412_10489538 Ga0307412_104895381 261
190 3300032004 Ga0307414_10055362 Ga0307414_100553622 261
191 3300032004 Ga0307414_10293621 Ga0307414_102936212 261
192 3300032004 Ga0307414_10499884 Ga0307414_104998842 261
193 3300037312 Ga0395899_0022990 Ga0395899_0022990_3554_4360 261
194 3300037418 Ga0395900_0017998 Ga0395900_0017998_2069_2875 261
195 3300037418 Ga0395900_0444042 Ga0395900_0444042_123_935 261
196 3300037466 Ga0395898_0073105 Ga0395898_0073105_1877_2683 261
197 3300037466 Ga0395898_0171631 Ga0395898_0171631_198_1010 261
198 3300037471 Ga0395905_0001074 Ga0395905_0001074_30714_31520 261
199 3300038443 Ga0395901_0183095 Ga0395901_0183095_1196_2002 261
200 3300038705 Ga0237819_04327 Ga0237819_04327_1263_2090 261
201 3300041452 Ga0451793_0812868 Ga0451793_0812868_1211_2041 261
202 3300041459 Ga0451800_0090666 Ga0451800_0090666_6625_7455 261
203 3300041462 Ga0451806_089816 Ga0451806_089816_5230_6060 261
204 3300041463 Ga0451804_0284152 Ga0451804_0284152_1439_2269 261
205 3300041486 Ga0451807_1017421 Ga0451807_1017421_2961_3791 261
206 3300042007 Ga0439449_0012058 Ga0439449_0012058_1280_2098 261
207 3300042115 Ga0450911_018138 Ga0450911_018138_30_857 261
208 3300042876 Ga0451577_0089906 Ga0451577_0089906_101_907 261
209 3300044712 Ga0453684_0865559 Ga0453684_0865559_79_885 261
210 3300046460 Ga0495638_0001623 Ga0495638_0001623_7400_8230 261
211 3300046512 Ga0495610_0010873 Ga0495610_0010873_167_997 261
212 3300046522 Ga0495643_0001001 Ga0495643_0001001_10888_11718 261
213 3300046660 Ga0495625_0060295 Ga0495625_0060295_1506_2336 261
214 3300047320 Ga0495672_0000079 Ga0495672_0000079_10891_11721 261
215 3300048904 Ga0496101_0028411 Ga0496101_0028411_998_1804 261
216 3300048916 Ga0496113_0002864 Ga0496113_0002864_3602_4408 261
217 3300048919 Ga0496116_0127837 Ga0496116_0127837_154_984 261
218 3300048919 Ga0496116_0189257 Ga0496116_0189257_140_934 261
219 3300048920 Ga0496117_0003166 Ga0496117_0003166_8127_8957 261
220 3300048920 Ga0496117_0267203 Ga0496117_0267203_22_816 261
221 3300048921 Ga0496118_0001003 Ga0496118_0001003_13013_13843 261
222 3300048921 Ga0496118_0059472 Ga0496118_0059472_216_1046 261
223 3300048921 Ga0496118_0062370 Ga0496118_0062370_983_1804 261
224 3300048921 Ga0496118_0287648 Ga0496118_0287648_87_881 261
225 3300048922 Ga0496119_0002376 Ga0496119_0002376_8400_9230 261
226 3300048923 Ga0496120_0000187 Ga0496120_0000187_41213_42043 261
227 3300048924 Ga0496121_0023676 Ga0496121_0023676_139_969 261
228 3300048924 Ga0496121_0047866 Ga0496121_0047866_433_1263 261
229 3300048926 Ga0496123_0022047 Ga0496123_0022047_3859_4689 261
230 3300048927 Ga0496124_0003704 Ga0496124_0003704_7387_8217 261
231 3300048927 Ga0496124_0003734 Ga0496124_0003734_10425_11255 261
232 3300048927 Ga0496124_0144232 Ga0496124_0144232_284_1114 261
233 3300048928 Ga0496125_0002381 Ga0496125_0002381_9440_10270 261
234 3300048928 Ga0496125_0046423 Ga0496125_0046423_2469_3278 261
235 3300048928 Ga0496125_0059428 Ga0496125_0059428_196_1026 261
236 3300048928 Ga0496125_0086174 Ga0496125_0086174_601_1431 261
237 3300048928 Ga0496125_0107796 Ga0496125_0107796_236_1066 261
238 3300048929 Ga0496126_0000847 Ga0496126_0000847_41169_41999 261
239 3300049579 Ga0501043_0006846 Ga0501043_0006846_4869_5732 261
240 3300049772 Ga0501275_000990 Ga0501275_000990_1055_1849 261
241 iso_pu_bacteria 2576861471 2578459756 261
242 iso_pu_bacteria 2747842428 2747949606 261
243 iso_pu_bacteria 2765235840 2765577563 261
244 iso_pu_bacteria 2816332141 2816519329 261
245 iso_pu_bacteria 2818991457 2819662516 261
246 iso_pu_bacteria 2842391507 2842392552 261
247 iso_pu_bacteria 2842757796 2842759522 261
248 iso_pu_bacteria 2852649853 2852653483 261
249 iso_pu_bacteria 2852684882 2852687759 261
250 iso_pu_bacteria 2874220319 2874224406 261
251 iso_pu_bacteria 2894414249 2894415067 261
252 iso_pu_bacteria 2919089067 2919091420 261
253 iso_pu_bacteria 2919130084 2919132073 261
254 iso_pu_bacteria 2919134579 2919135169 261
255 iso_pu_bacteria 2928496128 2928499551 261
256 iso_pu_bacteria 2929195423 2929199188 261
257 iso_pu_bacteria 2931380184 2931382187 261
258 iso_pu_bacteria 2937610967 2937611025 261
259 iso_pu_bacteria 2939589442 2939592468 261
260 iso_pu_bacteria 2939622612 2939624781 261
261 iso_pu_bacteria 2939626828 2939628878 261
262 iso_pu_bacteria 2941475908 2941477493 261
263 iso_pu_bacteria 2961047084 2961051170 261
264 iso_pu_bacteria 2961064222 2961065486 261
265 iso_pu_bacteria 2974307012 2974310178 261
266 iso_pu_bacteria 2977247770 2977250912 261
267 iso_pu_bacteria 2984514374 2984514601 261
268 iso_pu_bacteria 8003014200 8003015275 261
269 iso_pu_bacteria 8021622325 8021625215 261
270 iso_pu_bacteria 8021626552 8021627491 261
271 iso_pu_bacteria 8021648035 8021649259 261
272 3300005293 Ga0065715_10141927 Ga0065715_101419272 262
273 3300025294 Ga0209025_1001646 Ga0209025_100164610 262
274 3300030731 Ga0316177_1058281 Ga0316177_10582812 262
275 3300032004 Ga0307414_10123902 Ga0307414_101239022 262
276 3300041404 Ga0439436_0003041 Ga0439436_0003041_265_1086 262
277 3300046525 Ga0495663_0007639 Ga0495663_0007639_1769_2575 262
278 3300046525 Ga0495663_0061048 Ga0495663_0061048_234_1070 262
279 3300047318 Ga0495636_0004313 Ga0495636_0004313_4521_5327 262
280 3300048920 Ga0496117_0004571 Ga0496117_0004571_11794_12645 262
281 3300048921 Ga0496118_0003380 Ga0496118_0003380_11820_12671 262
282 iso_pu_bacteria 2643221559 2643818413 262
283 iso_pu_bacteria 2643221586 2643938447 262
284 iso_pu_bacteria 2643221612 2644079098 262
285 iso_pu_bacteria 2643221727 2644693874 262
286 iso_pu_bacteria 2857442823 2857445891 262
287 iso_pu_bacteria 8054002106 8054007887 262
288 3300005367 Ga0070667_100172692 Ga0070667_1001726922 263
289 3300031824 Ga0307413_10001177 Ga0307413_100011772 263
290 3300031824 Ga0307413_10011886 Ga0307413_100118865 263
291 3300041494 Ga0451837_0327209 Ga0451837_0327209_312_1106 263
292 iso_pu_bacteria 2643221695 2644530598 263
293 iso_pu_bacteria 2747842501 2748019031 263
294 iso_pu_bacteria 2919513703 2919515704 263
295 iso_pu_bacteria 2919675420 2919678523 263
296 3300005347 Ga0070668_100002756 Ga0070668_1000027563 264
297 3300006051 Ga0075364_10046450 Ga0075364_100464502 264
298 3300006051 Ga0075364_10131340 Ga0075364_101313402 264
299 3300006051 Ga0075364_10229886 Ga0075364_102298862 264
300 3300025972 Ga0207668_10028783 Ga0207668_100287832 264
301 3300030745 Ga0316182_1098843 Ga0316182_10988432 264
302 3300031824 Ga0307413_10347559 Ga0307413_103475592 264
303 3300031911 Ga0307412_10315244 Ga0307412_103152442 264
304 3300031995 Ga0307409_100465508 Ga0307409_1004655081 264
305 3300032004 Ga0307414_10014168 Ga0307414_100141683 264
306 3300032004 Ga0307414_10115433 Ga0307414_101154332 264
307 3300032005 Ga0307411_10065231 Ga0307411_100652313 264
308 3300032126 Ga0307415_100130555 Ga0307415_1001305552 264
309 3300032126 Ga0307415_100673627 Ga0307415_1006736271 264
310 3300041404 Ga0439436_0021588 Ga0439436_0021588_539_1348 264
311 3300041404 Ga0439436_0027022 Ga0439436_0027022_293_1102 264
312 3300041406 Ga0439439_0015142 Ga0439439_0015142_113_943 264
313 3300042006 Ga0439432_015435 Ga0439432_015435_319_1134 264
314 3300042007 Ga0439449_0065186 Ga0439449_0065186_490_1299 264
315 3300046460 Ga0495638_0097576 Ga0495638_0097576_361_1209 264
316 3300049682 Ga0501252_005528 Ga0501252_005528_176_979 264
317 3300049763 Ga0501266_007081 Ga0501266_007081_335_1138 264
318 3300050491 nmdc:mga00v17_122406_c1 nmdc:mga00v17_122406_c1_224_1117 264
319 3300050491 nmdc:mga00v17_99684_c1 nmdc:mga00v17_99684_c1_938_1765 264
320 iso_pu_bacteria 2571042365 2572254865 264
321 iso_pu_bacteria 2895498888 2895501405 264
322 iso_pu_bacteria 2895511927 2895514548 264
323 iso_pu_bacteria 2895522137 2895523970 264
324 iso_pu_bacteria 2895525241 2895527458 264
325 iso_pu_bacteria 8002869464 8002869809 264
326 3300003187 JGI25151J46595_10000048 JGI25151J46595_1000004843 265
327 3300003771 Ga0055526_1000005 Ga0055526_100000588 265
328 3300003773 Ga0055537_1000155 Ga0055537_10001555 265
329 3300003775 Ga0055524_1000005 Ga0055524_100000589 265
330 3300003784 Ga0055534_1000002 Ga0055534_1000002240 265
331 3300003790 Ga0055528_1000002 Ga0055528_1000002240 265
332 3300005288 Ga0065714_10008298 Ga0065714_100082984 265
333 3300025245 Ga0207425_1003937 Ga0207425_10039373 265
334 3300025263 Ga0209565_1000001 Ga0209565_1000001690 265
335 3300025273 Ga0209673_1000001 Ga0209673_1000001690 265
336 3300025291 Ga0209675_1000001 Ga0209675_10000011842 265
337 3300025294 Ga0209025_1000006 Ga0209025_1000006397 265
338 3300025295 Ga0209564_1000001 Ga0209564_10000012004 265
339 3300025297 Ga0209758_1015761 Ga0209758_10157613 265
340 3300025299 Ga0209256_1000006 Ga0209256_1000006440 265
341 3300025986 Ga0207658_10203367 Ga0207658_102033672 265
342 3300032004 Ga0307414_10365657 Ga0307414_103656572 265
343 3300041407 Ga0439447_000572 Ga0439447_000572_1385_2254 265
344 3300048924 Ga0496121_0004653 Ga0496121_0004653_10260_11201 265
345 3300049571 Ga0501034_0000841 Ga0501034_0000841_11447_12280 265
346 3300049571 Ga0501034_0004379 Ga0501034_0004379_9856_10701 265
347 iso_pu_bacteria 2643221573 2643880728 265
348 iso_pu_bacteria 2643221579 2643907007 265
349 iso_pu_bacteria 2643221581 2643913593 265
350 iso_pu_bacteria 2643221593 2643973106 265
351 iso_pu_bacteria 2643221720 2644661298 265
352 iso_pu_bacteria 2643221728 2644699377 265
353 iso_pu_bacteria 2941489479 2941493464 265
354 iso_pu_bacteria 2995948881 2995949867 265
355 3300005293 Ga0065715_10006280 Ga0065715_100062803 266
356 3300027424 Ga0209984_1002478 Ga0209984_10024782 266
357 3300027471 Ga0209995_1006177 Ga0209995_10061772 266
358 3300027552 Ga0209982_1001785 Ga0209982_10017852 266
359 3300027614 Ga0209970_1005807 Ga0209970_10058072 266
360 3300027665 Ga0209983_1002679 Ga0209983_10026793 266
361 3300027682 Ga0209971_1001328 Ga0209971_10013283 266
362 3300027876 Ga0209974_10006855 Ga0209974_100068554 266
363 3300031548 Ga0307408_100190686 Ga0307408_1001906862 266
364 3300002773 JGI25152J39213_1000025 JGI25152J39213_100002581 267
365 3300002774 JGI25150J39212_1000066 JGI25150J39212_100006618 267
366 3300003187 JGI25151J46595_10000139 JGI25151J46595_1000013920 267
367 3300003215 JGI25153J46596_10000101 JGI25153J46596_1000010120 267
368 3300005548 Ga0070665_100195974 Ga0070665_1001959742 267
369 3300005844 Ga0068862_100429034 Ga0068862_1004290342 267
370 3300025245 Ga0207425_1000040 Ga0207425_1000040138 267
371 3300025258 Ga0209129_1000011 Ga0209129_1000011124 267
372 3300025294 Ga0209025_1000002 Ga0209025_1000002673 267
373 3300025297 Ga0209758_1000003 Ga0209758_1000003680 267
374 3300025929 Ga0207664_10512289 Ga0207664_105122891 267
375 3300028379 Ga0268266_10152671 Ga0268266_101526712 267
376 3300041451 Ga0451791_0496661 Ga0451791_0496661_212_1063 267
377 3300046453 Ga0495627_015437 Ga0495627_015437_1542_2393 267
378 3300049569 Ga0501032_0010454 Ga0501032_0010454_391_1257 268
379 3300049571 Ga0501034_0013621 Ga0501034_0013621_5001_5867 268
380 3300049572 Ga0501036_0023284 Ga0501036_0023284_1883_2749 268
381 3300049573 Ga0501037_0012880 Ga0501037_0012880_3728_4594 268
382 3300049575 Ga0501039_0068805 Ga0501039_0068805_1714_2580 268
383 3300049579 Ga0501043_0009855 Ga0501043_0009855_5171_6037 268
384 3300049586 Ga0501070_0066699 Ga0501070_0066699_1743_2609 268
385 3300049589 Ga0501073_0059486 Ga0501073_0059486_1631_2497 268
386 3300049742 Ga0501080_0008923 Ga0501080_0008923_1543_2409 268
387 3300049822 Ga0501035_0013862 Ga0501035_0013862_3040_3906 268
388 3300049823 Ga0501044_0001736 Ga0501044_0001736_21045_21911 268
389 2162886007 SwRhRL2b_contig_735520 SwRhRL2b_0660.00008480 269
390 3300003781 Ga0055536_1001044 Ga0055536_10010447 269
391 3300003794 Ga0055531_10014484 Ga0055531_100144842 269
392 3300005289 Ga0065704_10103838 Ga0065704_101038382 269
393 3300025292 Ga0209676_1000052 Ga0209676_100005224 269
394 3300025304 Ga0209257_1000078 Ga0209257_1000078299 269
395 3300031456 Ga0307513_10025478 Ga0307513_100254785 269
396 3300031456 Ga0307513_10079193 Ga0307513_100791932 269
397 3300031456 Ga0307513_10367311 Ga0307513_103673111 269
398 3300031911 Ga0307412_10548967 Ga0307412_105489671 269
399 3300032004 Ga0307414_10026607 Ga0307414_100266074 269
400 3300032004 Ga0307414_10032758 Ga0307414_100327583 269
401 3300041413 Ga0439465_0001726 Ga0439465_0001726_1401_2222 269
402 3300041413 Ga0439465_0005377 Ga0439465_0005377_95_949 269
403 3300041413 Ga0439465_0009343 Ga0439465_0009343_577_1386 269
404 3300041460 Ga0451802_0609880 Ga0451802_0609880_195_1037 269
405 3300041512 Ga0451853_2125846 Ga0451853_2125846_556_1398 269
406 3300042004 Ga0439445_0000632 Ga0439445_0000632_1321_2142 269
407 3300042004 Ga0439445_0012204 Ga0439445_0012204_53_874 269
408 3300042007 Ga0439449_0000110 Ga0439449_0000110_12193_13014 269
409 3300042007 Ga0439449_0019262 Ga0439449_0019262_1472_2284 269
410 3300046525 Ga0495663_0000476 Ga0495663_0000476_11045_11917 269
411 3300048917 Ga0496114_0027535 Ga0496114_0027535_196_1005 269
412 3300048926 Ga0496123_0085368 Ga0496123_0085368_288_1163 269
413 3300048929 Ga0496126_0052845 Ga0496126_0052845_281_1090 269
414 3300049571 Ga0501034_0002118 Ga0501034_0002118_12042_12926 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

30

180

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9646 5 247
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.963 5 247
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9553 5 247
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9552 8 247
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9478 5 235
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9644 5 248 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9513 8 245 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9512 7 247 3.40.50.300
af_P37313_10_333_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 5 247 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 6 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1G0E135-F1-model_v4 ABC transporter ATP-binding protein 0.9645 1 247 GO:0005524
GO:0016887
AF-C2Z676-F1-model_v4 deleted 0.95 6 237
AF-A0A0V8J7U4-F1-model_v4 Antibiotic ABC transporter ATP-binding protein 0.9481 5 237 GO:0005524
GO:0016887
AF-A0A4Q6CSI3-F1-model_v4 deleted 0.9461 3 146
AF-A0A5M6IEF2-F1-model_v4 ABC transporter ATP-binding protein 0.9448 3 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
92.19 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map